Citrus Sinensis ID: 032497


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MQGAIQSFLSHGNIVKSAVLQRIRLVNPMLRPVVSSRFESVSSARMEEHGFESTTISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKIIVQGRSSKSTKVGDIMTEEV
cHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHcccccccHHHHHHHccccccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccccEEEEEcHHHHHHHHHHcccccccccccccccccc
ccHHHHHHHHcccHHHHHHHHEEccccccccccEEEcccccccccHHHccccccEHHHHHHHccccccccEEEEcccHHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEHHHHHHHHHHcccccccccHHHHccccc
MQGAIQSFLSHGNIVKSAVLQRIRLvnpmlrpvvssrFESVSSarmeehgfesttISDILKakgkgadgswlwcttdDTVYDAVKSMTQHNVGAlvvvkpgeqksvagiITERDYLRKIIVQgrsskstkvgdimteev
MQGAIQSFLSHGNIVKSAVLQRIRLVNPMLRPVVSSRFESVSsarmeehgfesttisdILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVgalvvvkpgeqksvagiiterdylrkiivqgrsskstkvgdimteev
MQGAIQSFLSHGNIVKSAVLQRIRLVNPMLRPVVSSRFESVSSARMEEHGFESTTISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKIIVQGRSSKSTKVGDIMTEEV
*******FLSHGNIVKSAVLQRIRLVNPMLRPVV********************TISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKIIVQ*****************
*************IVKSAVLQRIRL********************************DILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKIIVQGRSSKSTKVGDIMTEE*
MQGAIQSFLSHGNIVKSAVLQRIRLVNPMLRPVVSSRFESVSSARMEEHGFESTTISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKIIVQGRSSKSTKVGDIMTEEV
*QGAIQSFLSHGNIVKSAVLQRIRLVNPMLRPVVSSRFESVSSARME*HGFESTTISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKIIVQGRS**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQGAIQSFLSHGNIVKSAVLQRIRLVNPMLRPVVSSRFESVSSARMEEHGFESTTISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKIIVQGRSSKSTKVGDIMTEEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
Q9LEV3206 CBS domain-containing pro yes no 0.992 0.669 0.791 2e-60
Q58069 194 Uncharacterized protein M yes no 0.410 0.293 0.369 7e-05
O34682148 Uncharacterized protein Y yes no 0.539 0.506 0.360 0.0002
P54606140 CBS domain-containing pro no no 0.446 0.442 0.363 0.0004
>sp|Q9LEV3|CBSX3_ARATH CBS domain-containing protein CBSX3, mitochondrial OS=Arabidopsis thaliana GN=CBSX3 PE=1 SV=1 Back     alignment and function desciption
 Score =  230 bits (586), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 125/139 (89%), Gaps = 1/139 (0%)

Query: 1   MQGAIQSFLSHGNIVKSAVLQRIRLVNPMLRP-VVSSRFESVSSARMEEHGFESTTISDI 59
           MQG I+SF+S GN+VK +VLQ +R++NP ++P V  SR ES   ARMEE GFESTTISD+
Sbjct: 1   MQGVIRSFVSGGNVVKGSVLQHLRVINPAIQPSVFCSRSESTQPARMEESGFESTTISDV 60

Query: 60  LKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKI 119
           +K+KGK ADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQ+++AGIITERDYLRKI
Sbjct: 61  MKSKGKSADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQQALAGIITERDYLRKI 120

Query: 120 IVQGRSSKSTKVGDIMTEE 138
           IVQGRSSKSTKVGDIMTEE
Sbjct: 121 IVQGRSSKSTKVGDIMTEE 139





Arabidopsis thaliana (taxid: 3702)
>sp|Q58069|Y653_METJA Uncharacterized protein MJ0653 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0653 PE=4 SV=1 Back     alignment and function description
>sp|O34682|YLBB_BACSU Uncharacterized protein YlbB OS=Bacillus subtilis (strain 168) GN=ylbB PE=4 SV=2 Back     alignment and function description
>sp|P54606|YHCV_BACSU CBS domain-containing protein YhcV OS=Bacillus subtilis (strain 168) GN=yhcV PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
357491621205 Cbs domain protein [Medicago truncatula] 0.992 0.673 0.847 6e-66
357491617 242 Cbs domain protein [Medicago truncatula] 0.992 0.570 0.847 1e-65
357491619 254 Cbs domain protein [Medicago truncatula] 0.992 0.543 0.847 1e-65
357491615205 Cbs domain protein [Medicago truncatula] 0.992 0.673 0.847 3e-65
224127037205 predicted protein [Populus trichocarpa] 0.992 0.673 0.840 1e-64
351722175205 uncharacterized protein LOC100527191 [Gl 0.992 0.673 0.833 6e-64
225434277205 PREDICTED: CBS domain-containing protein 0.992 0.673 0.840 5e-63
297745725 262 unnamed protein product [Vitis vinifera] 0.992 0.526 0.840 8e-63
388511535205 unknown [Lotus japonicus] 0.992 0.673 0.804 5e-62
449444316206 PREDICTED: CBS domain-containing protein 0.992 0.669 0.820 1e-61
>gi|357491621|ref|XP_003616098.1| Cbs domain protein [Medicago truncatula] gi|355517433|gb|AES99056.1| Cbs domain protein [Medicago truncatula] Back     alignment and taxonomy information
 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 117/138 (84%), Positives = 132/138 (95%)

Query: 1   MQGAIQSFLSHGNIVKSAVLQRIRLVNPMLRPVVSSRFESVSSARMEEHGFESTTISDIL 60
           MQG ++SFLS+GN++K+AVLQR+R+VNP+L+PV  SRFES + AR+EEHGFESTTISDIL
Sbjct: 38  MQGGLRSFLSNGNVIKNAVLQRVRMVNPLLQPVAFSRFESATPARIEEHGFESTTISDIL 97

Query: 61  KAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKII 120
           K KGKGADGSWLWCTTDDTVYDAVKSMTQ+NVGALVVVKPGE+KS+AGIITERDYLRKII
Sbjct: 98  KGKGKGADGSWLWCTTDDTVYDAVKSMTQNNVGALVVVKPGEEKSIAGIITERDYLRKII 157

Query: 121 VQGRSSKSTKVGDIMTEE 138
           VQGRSSKSTKVGDIMTEE
Sbjct: 158 VQGRSSKSTKVGDIMTEE 175




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357491617|ref|XP_003616096.1| Cbs domain protein [Medicago truncatula] gi|355517431|gb|AES99054.1| Cbs domain protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357491619|ref|XP_003616097.1| Cbs domain protein [Medicago truncatula] gi|355517432|gb|AES99055.1| Cbs domain protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357491615|ref|XP_003616095.1| Cbs domain protein [Medicago truncatula] gi|217073214|gb|ACJ84966.1| unknown [Medicago truncatula] gi|355517430|gb|AES99053.1| Cbs domain protein [Medicago truncatula] gi|388522955|gb|AFK49539.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224127037|ref|XP_002319991.1| predicted protein [Populus trichocarpa] gi|222858367|gb|EEE95914.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351722175|ref|NP_001236211.1| uncharacterized protein LOC100527191 [Glycine max] gi|255631750|gb|ACU16242.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225434277|ref|XP_002262902.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial isoform 1 [Vitis vinifera] gi|225434279|ref|XP_002262927.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial isoform 2 [Vitis vinifera] gi|225434281|ref|XP_002262956.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745725|emb|CBI15781.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388511535|gb|AFK43829.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449444316|ref|XP_004139921.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like isoform 1 [Cucumis sativus] gi|449444318|ref|XP_004139922.1| PREDICTED: CBS domain-containing protein CBSX3, mitochondrial-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
TAIR|locus:2183740206 CBSX3 "AT5G10860" [Arabidopsis 0.992 0.669 0.791 3.7e-55
TAIR|locus:4515102654193 AT1G47271 "AT1G47271" [Arabido 0.856 0.616 0.483 8.4e-26
UNIPROTKB|Q48IU0146 PSPPH_2494 "CBS domain protein 0.431 0.410 0.476 1.1e-09
UNIPROTKB|Q60B97150 MCA0583 "CBS domain protein" [ 0.453 0.42 0.375 1.3e-06
UNIPROTKB|Q0BYV1144 HNE_2660 "CBS domain protein" 0.553 0.534 0.305 2.6e-05
UNIPROTKB|Q81UY6139 BAS0687 "CBS domain protein" [ 0.424 0.424 0.333 9.5e-05
TIGR_CMR|BA_0720139 BA_0720 "CBS domain protein" [ 0.424 0.424 0.333 9.5e-05
TAIR|locus:2183740 CBSX3 "AT5G10860" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 569 (205.4 bits), Expect = 3.7e-55, P = 3.7e-55
 Identities = 110/139 (79%), Positives = 125/139 (89%)

Query:     1 MQGAIQSFLSHGNIVKSAVLQRIRLVNPMLRP-VVSSRFESVSSARMEEHGFESTTISDI 59
             MQG I+SF+S GN+VK +VLQ +R++NP ++P V  SR ES   ARMEE GFESTTISD+
Sbjct:     1 MQGVIRSFVSGGNVVKGSVLQHLRVINPAIQPSVFCSRSESTQPARMEESGFESTTISDV 60

Query:    60 LKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKI 119
             +K+KGK ADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQ+++AGIITERDYLRKI
Sbjct:    61 MKSKGKSADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQQALAGIITERDYLRKI 120

Query:   120 IVQGRSSKSTKVGDIMTEE 138
             IVQGRSSKSTKVGDIMTEE
Sbjct:   121 IVQGRSSKSTKVGDIMTEE 139




GO:0005739 "mitochondrion" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP;RCA
GO:0050897 "cobalt ion binding" evidence=IDA
GO:0045454 "cell redox homeostasis" evidence=IDA
GO:0006096 "glycolysis" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
TAIR|locus:4515102654 AT1G47271 "AT1G47271" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q48IU0 PSPPH_2494 "CBS domain protein" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q60B97 MCA0583 "CBS domain protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BYV1 HNE_2660 "CBS domain protein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|Q81UY6 BAS0687 "CBS domain protein" [Bacillus anthracis (taxid:1392)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0720 BA_0720 "CBS domain protein" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LEV3CBSX3_ARATHNo assigned EC number0.79130.99280.6699yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after 9e-25
cd04800111 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c 4e-14
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after h 2e-13
cd04587113 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd 3e-10
cd04802112 cd04802, CBS_pair_3, The CBS domain, named after h 4e-10
cd04630114 cd04630, CBS_pair_17, The CBS domain, named after 5e-10
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 4e-09
COG0517117 COG0517, COG0517, FOG: CBS domain [General functio 9e-09
cd04624112 cd04624, CBS_pair_11, The CBS domain, named after 3e-08
COG2905 610 COG2905, COG2905, Predicted signal-transduction pr 5e-08
cd04611111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co 1e-07
cd04604114 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain 3e-07
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after 7e-07
cd04625112 cd04625, CBS_pair_12, The CBS domain, named after 7e-07
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two 3e-06
pfam0057157 pfam00571, CBS, CBS domain 6e-06
cd04601110 cd04601, CBS_pair_IMPDH, This cd contains two tand 1e-05
cd04609110 cd04609, CBS_pair_PALP_assoc2, This cd contains tw 1e-05
cd04600124 cd04600, CBS_pair_HPP_assoc, This cd contains two 2e-05
cd04633121 cd04633, CBS_pair_20, The CBS domain, named after 3e-05
smart0011649 smart00116, CBS, Domain in cystathionine beta-synt 4e-05
cd04589111 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd 7e-05
cd04617118 cd04617, CBS_pair_4, The CBS domain, named after h 7e-05
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after h 8e-05
cd04800111 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This c 1e-04
cd04599105 cd04599, CBS_pair_GGDEF_assoc2, This cd contains t 1e-04
cd04620115 cd04620, CBS_pair_7, The CBS domain, named after h 1e-04
PRK14869 546 PRK14869, PRK14869, putative manganese-dependent i 2e-04
cd04632128 cd04632, CBS_pair_19, The CBS domain, named after 2e-04
cd02205113 cd02205, CBS_pair, The CBS domain, named after hum 3e-04
COG3448382 COG3448, COG3448, CBS-domain-containing membrane p 3e-04
COG3620187 COG3620, COG3620, Predicted transcriptional regula 3e-04
cd04588110 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This c 5e-04
cd04595110 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd con 6e-04
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after 6e-04
PRK05567 486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 8e-04
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont 0.001
cd04586135 cd04586, CBS_pair_BON_assoc, This cd contains two 0.001
cd04621135 cd04621, CBS_pair_8, The CBS domain, named after h 0.001
COG2524294 COG2524, COG2524, Predicted transcriptional regula 0.002
cd04629114 cd04629, CBS_pair_16, The CBS domain, named after 0.002
cd04613114 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd con 0.003
cd04633121 cd04633, CBS_pair_20, The CBS domain, named after 0.004
>gnl|CDD|239995 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
 Score = 91.0 bits (227), Expect = 9e-25
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 69  GSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKIIVQGRSSKS 128
              +    D TV +A K M + N+GA+VVV  G +  + GI +ERD +RK+ ++G S+  
Sbjct: 1   RDVITVRPDATVAEAAKLMAEKNIGAVVVVDDGGR--LVGIFSERDIVRKVALRGASALD 58

Query: 129 TKVGDIMTEEV 139
           T V +IMT  V
Sbjct: 59  TPVSEIMTRNV 69


CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic generalized epilepsy, hypercalciuric nephrolithiasis, and classic Bartter syndrome (CLC chloride channel family members), Wolff-Parkinson-White syndrome (gamma 2 subunit of AMP-activated protein kinase), retinitis pigmentosa (IMP dehydrogenase-1), and homocystinuria (cystathionine beta-synthase). Length = 113

>gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|240115 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240001 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>gnl|CDD|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239997 cd04625, CBS_pair_12, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|201313 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|239974 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|239982 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|239962 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|239989 cd04617, CBS_pair_4, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|240113 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|239972 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>gnl|CDD|239992 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|240003 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226147 COG3620, COG3620, Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|239961 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|239968 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|239959 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>gnl|CDD|239993 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|225321 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|240000 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|239986 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|240004 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
COG3620187 Predicted transcriptional regulator with C-termina 99.41
PF0057157 CBS: CBS domain CBS domain web page. Mutations in 99.37
COG3448382 CBS-domain-containing membrane protein [Signal tra 99.12
COG2524294 Predicted transcriptional regulator, contains C-te 99.05
COG2524294 Predicted transcriptional regulator, contains C-te 99.05
COG2905 610 Predicted signal-transduction protein containing c 99.01
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 98.96
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 98.88
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 98.85
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 98.85
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 98.82
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 98.79
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 98.77
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem 98.74
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 98.73
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 98.72
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 98.68
PRK01862574 putative voltage-gated ClC-type chloride channel C 98.68
COG3448382 CBS-domain-containing membrane protein [Signal tra 98.68
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, 98.67
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 98.67
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 98.66
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 98.64
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 98.64
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, 98.62
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 98.62
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 98.61
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 98.61
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 98.6
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 98.6
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 98.6
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 98.6
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 98.59
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 98.58
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 98.57
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 98.57
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two 98.57
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 98.56
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, 98.56
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, 98.56
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 98.56
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 98.55
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 98.55
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 98.54
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 98.54
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisiona 98.54
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 98.54
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 98.54
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 98.53
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem re 98.53
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 98.52
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 98.52
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 98.52
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 98.51
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 98.51
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 98.51
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 98.5
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, 98.5
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains 98.5
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 98.49
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 98.49
TIGR03520 408 GldE gliding motility-associated protein GldE. Mem 98.49
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, 98.49
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, 98.49
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 98.49
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 98.49
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 98.49
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 98.48
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 98.48
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 98.48
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, 98.48
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, 98.48
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 98.47
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains tw 98.47
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two 98.47
PRK15094 292 magnesium/cobalt efflux protein CorC; Provisional 98.47
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 98.47
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 98.47
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 98.47
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, 98.46
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 98.46
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, 98.46
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, 98.45
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 98.45
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, 98.45
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem rep 98.45
PRK14869 546 putative manganese-dependent inorganic pyrophospha 98.44
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 98.44
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan 98.44
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, 98.43
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 98.43
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem re 98.43
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 98.43
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 98.43
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 98.43
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 98.42
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 98.42
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, 98.42
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 98.42
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, 98.42
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem re 98.42
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, 98.41
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains 98.41
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 98.41
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, 98.41
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 98.41
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains 98.41
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tand 98.4
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 98.4
COG4109 432 Predicted transcriptional regulator containing CBS 98.4
TIGR00400 449 mgtE Mg2+ transporter (mgtE). This family of proka 98.4
cd04801114 CBS_pair_M50_like This cd contains two tandem repe 98.39
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 98.39
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, 98.39
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 98.39
smart0011649 CBS Domain in cystathionine beta-synthase and othe 98.39
PRK01862574 putative voltage-gated ClC-type chloride channel C 98.39
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 98.37
COG0517117 FOG: CBS domain [General function prediction only] 98.37
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, 98.37
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, 98.37
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tand 98.36
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem r 98.36
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains 98.35
PLN02274 505 inosine-5'-monophosphate dehydrogenase 98.35
PRK14869 546 putative manganese-dependent inorganic pyrophospha 98.35
COG0517117 FOG: CBS domain [General function prediction only] 98.34
COG2905 610 Predicted signal-transduction protein containing c 98.33
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, 98.33
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 98.33
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two t 98.31
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two 98.3
cd04586135 CBS_pair_BON_assoc This cd contains two tandem rep 98.29
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two 98.28
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 98.28
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tand 98.28
PRK11573 413 hypothetical protein; Provisional 98.27
COG3620187 Predicted transcriptional regulator with C-termina 98.27
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, 98.27
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, 98.26
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 98.25
cd02205113 CBS_pair The CBS domain, named after human CBS, is 98.23
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, 98.23
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, 98.23
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, 98.22
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repea 98.22
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 98.21
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 98.2
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 98.2
COG4109 432 Predicted transcriptional regulator containing CBS 98.2
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem re 98.2
PRK15094292 magnesium/cobalt efflux protein CorC; Provisional 98.19
cd02205113 CBS_pair The CBS domain, named after human CBS, is 98.19
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats 98.18
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 98.16
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem 98.16
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem r 98.15
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, 98.14
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 98.13
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem r 98.13
PLN02274 505 inosine-5'-monophosphate dehydrogenase 98.12
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 98.12
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 98.12
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 98.1
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 98.07
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, 98.06
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 98.05
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two t 98.04
TIGR00393268 kpsF KpsF/GutQ family protein. This model describe 98.02
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem rep 98.01
TIGR03520408 GldE gliding motility-associated protein GldE. Mem 97.98
cd04606109 CBS_pair_Mg_transporter This cd contains two tande 97.98
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem r 97.93
COG1253 429 TlyC Hemolysins and related proteins containing CB 97.84
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domai 97.8
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 97.78
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two t 97.73
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, 97.73
PRK10070400 glycine betaine transporter ATP-binding subunit; P 97.6
TIGR01137454 cysta_beta cystathionine beta-synthase. Members of 97.58
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 97.38
PRK11573413 hypothetical protein; Provisional 97.31
COG4535 293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 96.96
COG1253429 TlyC Hemolysins and related proteins containing CB 96.92
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 96.89
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 96.89
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tande 96.86
KOG1764381 consensus 5'-AMP-activated protein kinase, gamma s 96.8
COG4536 423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 96.76
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 96.46
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 96.37
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inor 96.17
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 95.94
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 94.93
KOG0476 931 consensus Cl- channel CLC-2 and related proteins ( 94.83
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inor 94.18
KOG0474762 consensus Cl- channel CLC-7 and related proteins ( 94.15
PRK10070400 glycine betaine transporter ATP-binding subunit; P 93.52
COG4175386 ProV ABC-type proline/glycine betaine transport sy 93.09
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 92.02
KOG0475696 consensus Cl- channel CLC-3 and related proteins ( 89.75
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 88.09
KOG0476931 consensus Cl- channel CLC-2 and related proteins ( 82.8
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 81.36
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
Probab=99.41  E-value=5.9e-13  Score=95.25  Aligned_cols=125  Identities=22%  Similarity=0.331  Sum_probs=93.3

Q ss_pred             HHHHhhcCCCchHHHHhhhCCccccccchhhhhhcccc---h---hhhhhcCCccCcHHHHhhhcCCCCCCCcEEecCCC
Q 032497            5 IQSFLSHGNIVKSAVLQRIRLVNPMLRPVVSSRFESVS---S---ARMEEHGFESTTISDILKAKGKGADGSWLWCTTDD   78 (139)
Q Consensus         5 ~~~~~~~~~i~~~~v~~~~~~~~~~~~~d~~~~~~~~~---~---~~~~~~~~~~~~v~dvm~~~~~~~~~~~~~v~~~~   78 (139)
                      |+..|...+|+++.+|+.-+++...+..--.-.+....   .   +.+.+..-...++..+|++       +.+.+.|++
T Consensus        10 lrk~Rk~LGitQ~dLA~~aGVSQ~~IArlE~G~vdPrlSt~k~Il~aL~e~e~~~ita~~iM~s-------pvv~v~pdD   82 (187)
T COG3620          10 LRKRRKELGITQKDLARRAGVSQPYIARLEAGKVDPRLSTVKRILEALEEAEKTRITAKTIMHS-------PVVSVSPDD   82 (187)
T ss_pred             HHHHHHHcCCCHHHHHHHcCccHHHHHHHhcCCCCccHHHHHHHHHHHHHhhcceEeHhhhccC-------CeeEECchh
Confidence            67788999999999999988876543211111111111   0   1111222246789999999       899999999


Q ss_pred             CHHHHHHHHHHcCCCEEEEEecCCCCceEEEEeHHHHHHHHHHcCCCCccCccccccccCC
Q 032497           79 TVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKIIVQGRSSKSTKVGDIMTEEV  139 (139)
Q Consensus        79 tl~~a~~~m~~~~~~~lpVv~~d~~~~lvGivt~~dll~~~~~~~~~~~~~~v~~im~~~v  139 (139)
                      ++.+++++|.++|++++||+   ++++++|-||..++.++.+.......+..|.++|..|+
T Consensus        83 si~~vv~lM~~~g~SQlPVi---~~~k~VGsItE~~iv~~~le~~e~i~~~~vr~vM~e~f  140 (187)
T COG3620          83 SISDVVNLMRDKGISQLPVI---EEDKVVGSITENDIVRALLEGMESIRSLRVREVMGEPF  140 (187)
T ss_pred             hHHHHHHHHHHcCCccCcee---eCCeeeeeecHHHHHHHHhccccchhhhhHHHHhcCCC
Confidence            99999999999999999999   45999999999999998865445555677889998653



>PF00571 CBS: CBS domain CBS domain web page Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>TIGR00400 mgtE Mg2+ transporter (mgtE) Back     alignment and domain information
>cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>smart00116 CBS Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>COG0517 FOG: CBS domain [General function prediction only] Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>PRK15094 magnesium/cobalt efflux protein CorC; Provisional Back     alignment and domain information
>cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>TIGR00393 kpsF KpsF/GutQ family protein Back     alignment and domain information
>cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>TIGR03520 GldE gliding motility-associated protein GldE Back     alignment and domain information
>cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria Back     alignment and domain information
>cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>PRK11573 hypothetical protein; Provisional Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
4fry_A157 The Structure Of A Putative Signal-Transduction Pro 3e-15
2rc3_A135 Crystal Structure Of Cbs Domain, Ne2398 Length = 13 4e-08
3ghd_A70 Crystal Structure Of A Cystathionine Beta-Synthase 9e-04
>pdb|4FRY|A Chain A, The Structure Of A Putative Signal-Transduction Protein With Cbs Domains From Burkholderia Ambifaria Mc40-6 Length = 157 Back     alignment and structure

Iteration: 1

Score = 77.0 bits (188), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 44/91 (48%), Positives = 63/91 (69%), Gaps = 6/91 (6%) Query: 50 GFESTTISDILKAKGKGADGSWLWCTT-DDTVYDAVKSMTQHNVGALVVVKPGEQKSVAG 108 G STT++ ILKAK G ++ T +D VYDA+K M + +GAL+VV + +AG Sbjct: 3 GSMSTTVAQILKAKPDS--GRTIYTVTKNDFVYDAIKLMAEKGIGALLVV---DGDDIAG 57 Query: 109 IITERDYLRKIIVQGRSSKSTKVGDIMTEEV 139 I+TERDY RK+++Q RSSK+T+V +IMT +V Sbjct: 58 IVTERDYARKVVLQERSSKATRVEEIMTAKV 88
>pdb|2RC3|A Chain A, Crystal Structure Of Cbs Domain, Ne2398 Length = 135 Back     alignment and structure
>pdb|3GHD|A Chain A, Crystal Structure Of A Cystathionine Beta-Synthase Domain Protein Fused To A Zn-Ribbon-Like Domain Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 8e-25
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 1e-04
4fry_A157 Putative signal-transduction protein with CBS DOM; 1e-24
4fry_A157 Putative signal-transduction protein with CBS DOM; 3e-05
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 2e-23
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 1e-05
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 3e-20
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 7e-06
3fio_A70 A cystathionine beta-synthase domain protein fused 6e-20
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 2e-18
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 2e-07
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 8e-18
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 6e-06
1pvm_A184 Conserved hypothetical protein TA0289; structural 3e-17
1pvm_A184 Conserved hypothetical protein TA0289; structural 6e-05
1pbj_A125 Hypothetical protein; structural genomics, domain, 1e-15
1pbj_A125 Hypothetical protein; structural genomics, domain, 5e-07
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 4e-15
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 3e-07
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 8e-15
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 2e-06
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 6e-13
2o16_A160 Acetoin utilization protein ACUB, putative; struct 5e-10
2o16_A160 Acetoin utilization protein ACUB, putative; struct 3e-05
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 6e-10
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 7e-06
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 6e-10
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 1e-05
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 9e-10
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 9e-05
1o50_A157 CBS domain-containing predicted protein TM0935; CB 3e-09
1o50_A157 CBS domain-containing predicted protein TM0935; CB 3e-04
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 6e-09
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 1e-08
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 8e-07
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 7e-09
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 1e-08
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 2e-08
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 7e-06
3lqn_A150 CBS domain protein; csgid, structural genomics, un 2e-08
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 3e-08
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 4e-08
3ddj_A 296 CBS domain-containing protein; structural genomics 5e-08
3ddj_A 296 CBS domain-containing protein; structural genomics 9e-08
3ddj_A296 CBS domain-containing protein; structural genomics 2e-07
3ddj_A296 CBS domain-containing protein; structural genomics 5e-07
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 5e-08
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 1e-07
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 3e-06
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 1e-07
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 7e-04
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 2e-07
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 3e-07
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 1e-06
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 2e-04
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 3e-07
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 9e-07
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 9e-07
3t4n_C 323 Nuclear protein SNF4; CBS domain, nucleotide bindi 1e-04
1vr9_A 213 CBS domain protein/ACT domain protein; structural 1e-06
1vr9_A213 CBS domain protein/ACT domain protein; structural 2e-04
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 1e-06
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 2e-06
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 1e-04
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 3e-06
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 7e-05
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 7e-05
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 9e-05
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 1e-04
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 6e-04
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 Back     alignment and structure
 Score = 92.0 bits (229), Expect = 8e-25
 Identities = 27/105 (25%), Positives = 44/105 (41%), Gaps = 6/105 (5%)

Query: 35  SSRFESVSSARMEEHGFESTTISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGA 94
                  S          +T + D+L  KG+      +    D ++ +A  ++  H +GA
Sbjct: 5   HHHHHHSSGRENLYFQGMATFVKDLLDRKGRDV----VTVGPDVSIGEAAGTLHAHKIGA 60

Query: 95  LVVVKPGEQKSVAGIITERDYLRKIIVQGRSSKSTKVGDIMTEEV 139
           +VV        V GI TERD ++ +  QG +S    V   MT+ V
Sbjct: 61  VVVT--DADGVVLGIFTERDLVKAVAGQGAASLQQSVSVAMTKNV 103


>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Length = 149 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
3ghd_A70 A cystathionine beta-synthase domain protein FUSE 99.6
3fio_A70 A cystathionine beta-synthase domain protein fused 99.42
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 99.35
4esy_A170 CBS domain containing membrane protein; structural 99.33
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 99.32
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 99.32
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 99.3
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.28
1pbj_A125 Hypothetical protein; structural genomics, domain, 99.28
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 99.28
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.27
1pvm_A184 Conserved hypothetical protein TA0289; structural 99.27
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 99.26
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 99.26
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 99.25
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 99.24
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 99.24
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 99.24
3lqn_A150 CBS domain protein; csgid, structural genomics, un 99.24
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.23
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 99.22
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 99.22
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.22
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 99.21
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.21
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.21
2o16_A160 Acetoin utilization protein ACUB, putative; struct 99.19
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 99.19
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.19
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.15
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 99.14
3kxr_A205 Magnesium transporter, putative; cystathionine bet 99.13
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 99.11
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 99.11
4esy_A170 CBS domain containing membrane protein; structural 99.09
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 99.09
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 99.08
3ocm_A173 Putative membrane protein; structural genomics, PS 99.07
1o50_A157 CBS domain-containing predicted protein TM0935; CB 99.07
4fry_A157 Putative signal-transduction protein with CBS DOM; 99.07
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.07
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 99.06
3nqr_A127 Magnesium and cobalt efflux protein CORC; structur 99.05
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.05
2d4z_A 250 Chloride channel protein; CLC chloride channel cyt 99.04
3i8n_A130 Uncharacterized protein VP2912; APC64273.1, vibrio 99.04
3lv9_A148 Putative transporter; CBS domain, PSI, MCSG, struc 99.04
3kh5_A 280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 99.03
3hf7_A130 Uncharacterized CBS-domain protein; CSB-domain PAI 99.02
4gqw_A152 CBS domain-containing protein CBSX1, chloroplasti; 99.02
3jtf_A129 Magnesium and cobalt efflux protein; CBS domain, C 99.02
3sl7_A180 CBS domain-containing protein CBSX2; CBS-PAIR prot 99.01
3lhh_A172 CBS domain protein; structural genomics, PSI-2, pr 99.0
3oco_A153 Hemolysin-like protein containing CBS domains; str 99.0
3kpb_A122 Uncharacterized protein MJ0100; CBS domain, S-aden 98.99
3l2b_A 245 Probable manganase-dependent inorganic pyrophospha 98.98
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 98.98
1pbj_A125 Hypothetical protein; structural genomics, domain, 98.96
3lfr_A136 Putative metal ION transporter; CBS, AMP, PSI, MCS 98.95
2oux_A286 Magnesium transporter; 10001B, structural genomics 98.95
3gby_A128 Uncharacterized protein CT1051; CBS domain, struct 98.95
2ef7_A133 Hypothetical protein ST2348; CBS-domain, structura 98.95
3fhm_A165 Uncharacterized protein ATU1752; CBS domain, proka 98.94
3k6e_A156 CBS domain protein; streptococcus pneumoniae TIGR4 98.94
3kxr_A205 Magnesium transporter, putative; cystathionine bet 98.94
2p9m_A138 Hypothetical protein MJ0922; structural genomics, 98.93
2nyc_A144 Nuclear protein SNF4; bateman2 domain, AMP kinase, 98.92
1vr9_A 213 CBS domain protein/ACT domain protein; structural 98.92
2rc3_A135 CBS domain; in SITU proteolysis, BR, structural ge 98.91
2uv4_A152 5'-AMP-activated protein kinase subunit gamma-1; t 98.91
3ddj_A 296 CBS domain-containing protein; structural genomics 98.9
3lqn_A150 CBS domain protein; csgid, structural genomics, un 98.9
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 98.89
2o16_A160 Acetoin utilization protein ACUB, putative; struct 98.89
2rih_A141 Conserved protein with 2 CBS domains; bateman doma 98.89
1y5h_A133 Hypothetical protein RV2626C; CBS domain, unknown 98.88
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 98.87
3l2b_A245 Probable manganase-dependent inorganic pyrophospha 98.87
1o50_A157 CBS domain-containing predicted protein TM0935; CB 98.87
2pfi_A164 Chloride channel protein CLC-Ka; cystathionine bet 98.85
2yzq_A282 Putative uncharacterized protein PH1780; sheet/hel 98.83
1vr9_A213 CBS domain protein/ACT domain protein; structural 98.83
2yzi_A138 Hypothetical protein PH0107; sheet/helix/sheet/she 98.83
2emq_A157 Hypothetical conserved protein; CBS domains, NPPSF 98.82
3oi8_A156 Uncharacterized protein; structural genomics, PSI- 98.81
2yzq_A 282 Putative uncharacterized protein PH1780; sheet/hel 98.81
3kh5_A280 Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a 98.8
2j9l_A185 Chloride channel protein 5; ION channel, ION trans 98.8
3k2v_A149 Putative D-arabinose 5-phosphate isomerase; KPSF-l 98.8
3ddj_A296 CBS domain-containing protein; structural genomics 98.79
2oux_A286 Magnesium transporter; 10001B, structural genomics 98.78
3fv6_A159 YQZB protein; CBS domain dimer, metabolism regulat 98.78
1yav_A159 Hypothetical protein BSU14130; cystathionine beta 98.77
1pvm_A184 Conserved hypothetical protein TA0289; structural 98.77
3ctu_A156 CBS domain protein; structural genomics, PSI-2, pr 98.77
3t4n_C323 Nuclear protein SNF4; CBS domain, nucleotide bindi 98.74
2yvy_A278 MGTE, Mg2+ transporter MGTE; membrane protein, tra 98.72
3ocm_A173 Putative membrane protein; structural genomics, PS 98.72
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 98.7
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 98.7
2qrd_G334 Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, 98.7
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 98.67
2v8q_E330 5'-AMP-activated protein kinase subunit gamma-1; p 98.59
2d4z_A250 Chloride channel protein; CLC chloride channel cyt 98.59
2zy9_A 473 Mg2+ transporter MGTE; membrane protien, metal tra 98.59
2v8q_E 330 5'-AMP-activated protein kinase subunit gamma-1; p 98.54
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 98.47
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 98.45
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 98.42
3pc3_A527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 98.36
3org_A632 CMCLC; transporter, transport protein; 3.50A {Cyan 98.35
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 98.35
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 98.32
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 98.29
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.21
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 98.2
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.2
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.18
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 98.12
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 98.05
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 97.99
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 97.98
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 97.98
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 97.93
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 97.78
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 97.55
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 87.46
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 86.65
>3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} Back     alignment and structure
Probab=99.60  E-value=2.8e-15  Score=93.29  Aligned_cols=66  Identities=33%  Similarity=0.557  Sum_probs=59.4

Q ss_pred             cEEecCCCCHHHHHHHHHHcCCCEEEEEecCCCCceEEEEeHHHHHHHHHHcCCCCccCccccccccCC
Q 032497           71 WLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKIIVQGRSSKSTKVGDIMTEEV  139 (139)
Q Consensus        71 ~~~v~~~~tl~~a~~~m~~~~~~~lpVv~~d~~~~lvGivt~~dll~~~~~~~~~~~~~~v~~im~~~v  139 (139)
                      ++++.|++|+.+|+++|.+++++++||+   ++++++||+|.+|+++++...+..+.+.+|+++|++++
T Consensus         2 ~vtv~p~~tv~ea~~~M~~~~i~~~~V~---d~~~lvGIvT~~Di~~~~~~~~~~~~~~~V~~iMt~~~   67 (70)
T 3ghd_A            2 AIVVQPKDTVDRVAKILSRNKAGSAVVM---EGDEILGVVTERDILDKVVAKGKNPKEVKVEEIMTKNP   67 (70)
T ss_dssp             EEEECTTCBHHHHHHHHHHTTCSEEEEE---ETTEEEEEEEHHHHHHHTTTTTCCGGGCBGGGTCEECT
T ss_pred             CEEECCCCcHHHHHHHHHHcCCCEEEEE---ECCEEEEEEEHHHHHHHHHhcCCCcccCCHHHhcCCCC
Confidence            6889999999999999999999999999   36899999999999988877777666789999999874



>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} Back     alignment and structure
>3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Back     alignment and structure
>3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Back     alignment and structure
>3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Back     alignment and structure
>3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Back     alignment and structure
>3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Back     alignment and structure
>3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Back     alignment and structure
>2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Back     alignment and structure
>3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} Back     alignment and structure
>3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} Back     alignment and structure
>2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Back     alignment and structure
>2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Back     alignment and structure
>2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Back     alignment and structure
>1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Back     alignment and structure
>1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Back     alignment and structure
>2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Back     alignment and structure
>2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Back     alignment and structure
>3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Back     alignment and structure
>2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Back     alignment and structure
>2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Back     alignment and structure
>3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* Back     alignment and structure
>3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Back     alignment and structure
>2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 Back     alignment and structure
>3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Back     alignment and structure
>1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Back     alignment and structure
>1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Back     alignment and structure
>3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Back     alignment and structure
>2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A Back     alignment and structure
>3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Back     alignment and structure
>2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A Back     alignment and structure
>2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d2rc3a1127 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 2e-05
d2ooxe1179 d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 1e-04
d2v8qe2159 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas 1e-04
d2yzia1132 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 6e-04
d1jr1a4120 d.37.1.1 (A:113-232) Type II inosine monophosphate 7e-04
d2yzqa2122 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 0.002
d2o16a3139 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V 0.002
d2d4za3160 d.37.1.1 (A:527-606,A:691-770) Chloride channel pr 0.004
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Uncharacterized protein NE2398
species: Nitrosomonas europaea [TaxId: 915]
 Score = 39.0 bits (90), Expect = 2e-05
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 7/82 (8%)

Query: 54  TTISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITER 113
            T+  +L+ KG     + +    DD+V++A++ M   N+GAL+V+K  +     GI+TER
Sbjct: 2   KTVKHLLQEKGH----TVVAIGPDDSVFNAMQKMAADNIGALLVMKDEKLV---GILTER 54

Query: 114 DYLRKIIVQGRSSKSTKVGDIM 135
           D+ RK  +  +  K T+V +IM
Sbjct: 55  DFSRKSYLLDKPVKDTQVKEIM 76


>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.5
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.47
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 99.47
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.43
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.38
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.37
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 99.33
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.31
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.3
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.22
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.21
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.2
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.19
d3ddja1141 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.18
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.17
d2ef7a1127 Uncharacterized protein ST2348 {Sulfolobus tokodai 99.17
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 99.16
d2rc3a1127 Uncharacterized protein NE2398 {Nitrosomonas europ 99.15
d2ouxa2127 Magnesium transporter MgtE {Enterococcus faecalis 99.1
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 99.09
d2yzqa1156 Uncharacterized protein PH1780 {Pyrococcus horikos 99.08
d1pbja3120 Hypothetical protein MTH1622 {Archaeon Methanobact 99.06
d2o16a3139 Hypothetical protein VC0737 {Vibrio cholerae [TaxI 99.06
d2yzqa2122 Uncharacterized protein PH1780 {Pyrococcus horikos 99.05
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 99.04
d1vr9a3121 Hypothetical protein TM0892, CBS tandem {Thermotog 99.03
d1y5ha3123 Hypothetical protein Rv2626c {Mycobacterium tuberc 99.03
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 99.03
d1pvma4142 Hypothetical protein Ta0289 {Archaeon Thermoplasma 99.03
d2yvxa2144 Magnesium transporter MgtE {Thermus thermophilus [ 99.02
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 99.01
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 98.99
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 98.98
d3ddja2135 Uncharacterized protein SSO3205 {Sulfolobus solfat 98.98
d2d4za3160 Chloride channel protein, CBS tandem {Marbled elec 98.96
d2j9la1169 Chloride channel protein 5, ClC-5 {Human (Homo sap 98.94
d2yzia1132 Uncharacterized protein PH0107 {Pyrococcus horikos 98.94
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 98.93
d2ooxe2153 Uncharacterized protein C1556.08c {Schizosaccharom 98.93
d1o50a3145 Hypothetical protein TM0935 {Thermotoga maritima [ 98.93
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 98.93
d2nyca1140 Nuclear protein SNF4 {Baker's yeast (Saccharomyces 98.92
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 98.89
d1zfja4126 Type II inosine monophosphate dehydrogenase CBS do 98.89
d1yava3132 Hypothetical protein YkuL {Bacillus subtilis [TaxI 98.87
d2v8qe1145 5'-AMP-activated protein kinase subunit gamma-1, A 98.85
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 98.85
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 98.83
d2riha1131 Uncharacterized protein PAE2072 {Pyrobaculum aerop 98.79
d2v8qe2159 5'-AMP-activated protein kinase subunit gamma-1, A 98.75
d1jr1a4120 Type II inosine monophosphate dehydrogenase CBS do 98.61
d2ooxe1179 Uncharacterized protein C1556.08c {Schizosaccharom 98.58
d1lkvx_213 FliG {Thermotoga maritima [TaxId: 2336]} 91.76
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 86.28
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 82.51
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: CBS-domain pair
superfamily: CBS-domain pair
family: CBS-domain pair
domain: Hypothetical protein Rv2626c
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.50  E-value=1.1e-14  Score=97.37  Aligned_cols=77  Identities=26%  Similarity=0.500  Sum_probs=67.7

Q ss_pred             CcHHHHhhhcCCCCCCCcEEecCCCCHHHHHHHHHHcCCCEEEEEecCCCCceEEEEeHHHHHHHHHHcCCCCccCcccc
Q 032497           54 TTISDILKAKGKGADGSWLWCTTDDTVYDAVKSMTQHNVGALVVVKPGEQKSVAGIITERDYLRKIIVQGRSSKSTKVGD  133 (139)
Q Consensus        54 ~~v~dvm~~~~~~~~~~~~~v~~~~tl~~a~~~m~~~~~~~lpVv~~d~~~~lvGivt~~dll~~~~~~~~~~~~~~v~~  133 (139)
                      .+++|+|++       ++.++.+++++.+|++.|.+++++++||+  |++|+++|++|.+|+++.+..++.......+++
T Consensus         1 tt~~diM~~-------~~~~v~~~~tl~~a~~~m~~~~~~~~pVv--d~~~~~~Giit~~Di~~~~~~~~~~~~~~~v~~   71 (123)
T d1y5ha3           1 TTARDIMNA-------GVTCVGEHETLTAAAQYMREHDIGALPIC--GDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGE   71 (123)
T ss_dssp             CCHHHHSEE-------TCCCEETTSBHHHHHHHHHHHTCSEEEEE--CGGGBEEEEEEHHHHHHTTGGGTCCTTTSBHHH
T ss_pred             CCHHHhcCC-------CCcEECCcCcHHHHHHHHHHcCCCceEEE--eccchhhhhhhhhhHhhhhhhcCCCcccceEEE
Confidence            479999998       89999999999999999999999999999  778999999999999887776776655667889


Q ss_pred             ccccCC
Q 032497          134 IMTEEV  139 (139)
Q Consensus       134 im~~~v  139 (139)
                      +|++++
T Consensus        72 im~~~~   77 (123)
T d1y5ha3          72 LARDSI   77 (123)
T ss_dssp             HHTTCC
T ss_pred             Eeeccc
Confidence            987753



>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Back     information, alignment and structure
>d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure