Citrus Sinensis ID: 032506

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MASVTGTSACMTSLSCSFKQTQGRISSVNSVSLSINGKSFPSLRMRSAPRFRVSCAAKPETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLEEEFGISVEEESAQTISTVQDAADLIEKLIETKSA
cccccccccccccccccccccccccccccEEEEEcccccccccccccccccEEEccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcc
cccHHHcccccccccccccccccEEcccccEEEcccccccccEEccccccEEEEEcccHHHHHHHHHHHHHHHcccHHHcccccEccccccccHHHHHHHHHHHHHHccccccHHHHccccEHHHHHHHHcHHHHHccc
masvtgtsacmtslscsfkqtqgrissvnsvslsingksfpslrmrsaprfrvscaakpetVDKVCQIVKKQlalpadttvtgeskfaalgadsldTVEIVMGLEEEFGISVEEESAQTISTVQDAADLIEKLIETKSA
masvtgtsacmtslscsfkqtqgrissvnsvslsingksfpslrmrsaPRFRVSCAAKPETVDKVCQIVKKQlalpadttvtgeSKFAALGADSLDTVEIVMGLEEEFGISVEEESAQTISTVQDAADLIEKLIETKSA
MASVTGTSACMTSLSCSFKQTQGRissvnsvslsinGKSFPSLRMRSAPRFRVSCAAKPETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLeeefgisveeeSAQTISTVQDAADLIEKLIETKSA
**************************************************FRVSCAAKPETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLEEEFGISV***************************
*******************************************************AA*PETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLEEEFGISVEEESAQTISTVQDAADLIE*LI*****
***********TSLSCSFKQTQGRISSVNSVSLSINGKSFPSLRMRSAPRFRVSCAAKPETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLEEEFGISVEEESAQTISTVQDAADLIEKLIETKSA
***************************VNSVSLSINGKSFPSLRMRSAPRFRVSCAAKPETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLEEEFGISVEEESAQTISTVQDAADLIEKLIETK**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASVTGTSACMTSLSCSFKQTQGRISSVNSVSLSINGKSFPSLRMRSAPRFRVSCAAKPETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLEEEFGISVEEESAQTISTVQDAADLIEKLIETKSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
P93092136 Acyl carrier protein 1, c N/A no 0.971 0.992 0.760 8e-50
P52414139 Acyl carrier protein 4, c N/A no 0.978 0.978 0.717 4e-45
P52411140 Acyl carrier protein 1, c N/A no 0.978 0.971 0.705 7e-43
P52413143 Acyl carrier protein 3, c N/A no 0.920 0.895 0.694 3e-42
P52412137 Acyl carrier protein 2, c N/A no 0.964 0.978 0.681 3e-41
P08817129 Acyl carrier protein 2, c N/A no 0.769 0.829 0.685 7e-32
P15543132 Acyl carrier protein 3, c N/A no 0.928 0.977 0.542 5e-31
P02902149 Acyl carrier protein 1, c N/A no 0.726 0.677 0.666 1e-30
Q9SW21137 Acyl carrier protein 4, c yes no 0.956 0.970 0.546 2e-30
P07854138 Acyl carrier protein 1, c N/A no 0.964 0.971 0.535 4e-30
>sp|P93092|ACP1_CASGL Acyl carrier protein 1, chloroplastic OS=Casuarina glauca GN=ACP1 PE=2 SV=1 Back     alignment and function desciption
 Score =  195 bits (495), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 114/138 (82%), Gaps = 3/138 (2%)

Query: 1   MASVTGTSACMTSLSCSFKQTQGRISSVNSVSLSINGKSFPSLRMRSAPRFRVSCAAKPE 60
           MASVTGTS  M S   S   +  R+S++ SVSL I GKSF  LRMRSA RF V CAAKPE
Sbjct: 1   MASVTGTSISMASFKASLAPS--RVSNLRSVSLPIKGKSFAPLRMRSA-RFVVCCAAKPE 57

Query: 61  TVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLEEEFGISVEEESAQTI 120
           TV+KVC IVKKQLALP D+ VTGESKFA LGADSLDTVEIVMGLEEEFGI+VEEESAQ+I
Sbjct: 58  TVEKVCAIVKKQLALPDDSAVTGESKFATLGADSLDTVEIVMGLEEEFGINVEEESAQSI 117

Query: 121 STVQDAADLIEKLIETKS 138
           +TVQDAADLIEKLIE KS
Sbjct: 118 ATVQDAADLIEKLIEKKS 135
Carrier of the growing fatty acid chain in fatty acid biosynthesis.
Casuarina glauca (taxid: 3522)
>sp|P52414|ACP4_CUPLA Acyl carrier protein 4, chloroplastic OS=Cuphea lanceolata GN=ACL1 PE=3 SV=1 Back     alignment and function description
>sp|P52411|ACP1_CUPLA Acyl carrier protein 1, chloroplastic OS=Cuphea lanceolata GN=ACL1.1 PE=2 SV=1 Back     alignment and function description
>sp|P52413|ACP3_CUPLA Acyl carrier protein 3, chloroplastic OS=Cuphea lanceolata GN=ACL1.3 PE=2 SV=1 Back     alignment and function description
>sp|P52412|ACP2_CUPLA Acyl carrier protein 2, chloroplastic OS=Cuphea lanceolata GN=ACL1.2 PE=2 SV=1 Back     alignment and function description
>sp|P08817|ACP2_HORVU Acyl carrier protein 2, chloroplastic OS=Hordeum vulgare GN=ACL1.2 PE=1 SV=2 Back     alignment and function description
>sp|P15543|ACP3_HORVU Acyl carrier protein 3, chloroplastic OS=Hordeum vulgare GN=ACL1.3 PE=1 SV=2 Back     alignment and function description
>sp|P02902|ACP1_HORVU Acyl carrier protein 1, chloroplastic OS=Hordeum vulgare GN=ACL1.1 PE=1 SV=2 Back     alignment and function description
>sp|Q9SW21|ACP4_ARATH Acyl carrier protein 4, chloroplastic OS=Arabidopsis thaliana GN=ACP4 PE=1 SV=1 Back     alignment and function description
>sp|P07854|ACP1_SPIOL Acyl carrier protein 1, chloroplastic OS=Spinacia oleracea GN=ACL1.1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
189498314141 plastid acyl carrier protein [Camellia o 0.992 0.978 0.780 4e-54
359477442138 PREDICTED: acyl carrier protein 1, chlor 0.985 0.992 0.746 1e-50
317373683139 acyl carrier protein 3 [Helianthus annuu 0.985 0.985 0.755 2e-49
20137323136 RecName: Full=Acyl carrier protein 1, ch 0.971 0.992 0.760 6e-48
297736921131 unnamed protein product [Vitis vinifera] 0.913 0.969 0.759 9e-47
16518983134 acyl carrier protein [Olea europaea] 0.928 0.962 0.721 1e-45
388504194139 unknown [Lotus japonicus] 0.992 0.992 0.676 2e-44
357447473 350 Acyl carrier protein [Medicago truncatul 0.992 0.394 0.690 4e-44
5669599137 acyl carrier protein [Coriandrum sativum 0.971 0.985 0.710 5e-44
388518997139 unknown [Medicago truncatula] 0.992 0.992 0.690 5e-44
>gi|189498314|gb|ACE06753.1| plastid acyl carrier protein [Camellia oleifera] Back     alignment and taxonomy information
 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 122/141 (86%), Gaps = 3/141 (2%)

Query: 1   MASVTGTSACMTSLSCSFKQTQG--RISSVNSVSLSINGKSFPSLRMRSA-PRFRVSCAA 57
           MA V G+S  MTS SCSFKQ Q   +ISS+NSVSLSINGK FPSLR+R    RFR+SCAA
Sbjct: 1   MAFVAGSSMSMTSFSCSFKQNQAPTKISSLNSVSLSINGKCFPSLRLRPVTHRFRISCAA 60

Query: 58  KPETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLEEEFGISVEEESA 117
           KPETVDKVC+IV+KQLALPA+T VTG+SKF  LGADSLDTVEIVMGLEEEFGISVEEESA
Sbjct: 61  KPETVDKVCEIVRKQLALPAETAVTGDSKFTTLGADSLDTVEIVMGLEEEFGISVEEESA 120

Query: 118 QTISTVQDAADLIEKLIETKS 138
           Q I+TVQDAADLI+KLIE K+
Sbjct: 121 QNIATVQDAADLIDKLIEKKA 141

Source: Camellia oleifera

Species: Camellia oleifera

Genus: Camellia

Family: Theaceae

Order: Ericales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359477442|ref|XP_003631979.1| PREDICTED: acyl carrier protein 1, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|317373683|gb|ADV16367.1| acyl carrier protein 3 [Helianthus annuus] Back     alignment and taxonomy information
>gi|20137323|sp|P93092.1|ACP1_CASGL RecName: Full=Acyl carrier protein 1, chloroplastic; Short=ACP 1; Flags: Precursor gi|1838961|emb|CAA71885.1| acyl carrier protein [Casuarina glauca] Back     alignment and taxonomy information
>gi|297736921|emb|CBI26122.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|16518983|gb|AAL25091.1|AF428256_1 acyl carrier protein [Olea europaea] Back     alignment and taxonomy information
>gi|388504194|gb|AFK40163.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|357447473|ref|XP_003594012.1| Acyl carrier protein [Medicago truncatula] gi|355483060|gb|AES64263.1| Acyl carrier protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|5669599|gb|AAD46394.1|AF083950_1 acyl carrier protein [Coriandrum sativum] Back     alignment and taxonomy information
>gi|388518997|gb|AFK47560.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
TAIR|locus:2199461136 ACP2 "AT1G54580" [Arabidopsis 0.964 0.985 0.453 1.1e-21
TAIR|locus:2199517136 ACP3 "acyl carrier protein 3" 0.964 0.985 0.467 6.3e-21
TAIR|locus:2114820137 ACP1 "acyl carrier protein 1" 0.935 0.948 0.448 1.7e-20
TAIR|locus:2181216139 ACP5 "AT5G27200" [Arabidopsis 0.949 0.949 0.463 2.1e-20
GENEDB_PFALCIPARUM|PFB0385w137 PFB0385w "acyl carrier protein 0.510 0.518 0.424 1.1e-07
UNIPROTKB|Q7KWJ1137 PFB0385w "Apicoplast ACP" [Pla 0.510 0.518 0.424 1.1e-07
TIGR_CMR|GSU_160477 GSU_1604 "acyl carrier protein 0.474 0.857 0.426 2.1e-06
UNIPROTKB|Q9KQH878 acpP "Acyl carrier protein" [V 0.482 0.858 0.405 4.3e-06
TIGR_CMR|VC_202078 VC_2020 "acyl carrier protein" 0.482 0.858 0.405 4.3e-06
UNIPROTKB|P0A6A878 acpP [Escherichia coli K-12 (t 0.482 0.858 0.405 7e-06
TAIR|locus:2199461 ACP2 "AT1G54580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 253 (94.1 bits), Expect = 1.1e-21, P = 1.1e-21
 Identities = 63/139 (45%), Positives = 79/139 (56%)

Query:     1 MASVTGTSACMTSLSCSFKQTQGRXXXXXXXXXXXXGKSFPSLRMRSAP-RFRVSCAAKP 59
             MAS+    A   S+S   +  Q               +S  S  +R  P R  VSCAAKP
Sbjct:     1 MASI----AASASISLQARPRQLAIAASQVKSFSNGRRSSLSFNLRQLPTRLTVSCAAKP 56

Query:    60 ETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLXXXXXXXXXXXSAQT 119
             ETVDKVC +V+KQL+L     +T  +KFAALGADSLDTVEIVMGL            AQ+
Sbjct:    57 ETVDKVCAVVRKQLSLKEADEITAATKFAALGADSLDTVEIVMGLEEEFGIEMAEEKAQS 116

Query:   120 ISTVQDAADLIEKLIETKS 138
             I+TV+ AA LIE+L+  K+
Sbjct:   117 IATVEQAAALIEELLFEKA 135
GO:0006633 "fatty acid biosynthetic process" evidence=TAS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0031177 "phosphopantetheine binding" evidence=IEA
GO:0000036 "ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process" evidence=IDA
TAIR|locus:2199517 ACP3 "acyl carrier protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114820 ACP1 "acyl carrier protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181216 ACP5 "AT5G27200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFB0385w PFB0385w "acyl carrier protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q7KWJ1 PFB0385w "Apicoplast ACP" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1604 GSU_1604 "acyl carrier protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KQH8 acpP "Acyl carrier protein" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2020 VC_2020 "acyl carrier protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P0A6A8 acpP [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SW21ACP4_ARATHNo assigned EC number0.54670.95680.9708yesno
P32887ACP3_BRANANo assigned EC number0.5750.83450.8656N/Ano
P52412ACP2_CUPLANo assigned EC number0.68110.96400.9781N/Ano
P52414ACP4_CUPLANo assigned EC number0.71730.97840.9784N/Ano
P52411ACP1_CUPLANo assigned EC number0.70500.97840.9714N/Ano
P52413ACP3_CUPLANo assigned EC number0.69460.92080.8951N/Ano
P08971ACP5_BRANANo assigned EC number0.52550.95680.9925N/Ano
P07854ACP1_SPIOLNo assigned EC number0.53520.96400.9710N/Ano
P10352ACP1_BRANANo assigned EC number0.53540.85610.8880N/Ano
P93092ACP1_CASGLNo assigned EC number0.76080.97120.9926N/Ano
P15543ACP3_HORVUNo assigned EC number0.54220.92800.9772N/Ano
P23235ACP2_SPIOLNo assigned EC number0.55070.92800.9923N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
TIGR0051777 TIGR00517, acyl_carrier, acyl carrier protein 2e-22
PRK0098278 PRK00982, acpP, acyl carrier protein; Provisional 1e-21
CHL0012482 CHL00124, acpP, acyl carrier protein; Validated 4e-20
COG023680 COG0236, AcpP, Acyl carrier protein [Lipid metabol 3e-16
PTZ00171148 PTZ00171, PTZ00171, acyl carrier protein; Provisio 8e-16
pfam0055066 pfam00550, PP-binding, Phosphopantetheine attachme 3e-09
PRK1244980 PRK12449, PRK12449, acyl carrier protein; Provisio 4e-08
PRK0817282 PRK08172, PRK08172, putative acyl carrier protein 4e-06
PRK0582884 PRK05828, PRK05828, acyl carrier protein; Validate 6e-06
smart0082386 smart00823, PKS_PP, Phosphopantetheine attachment 4e-04
PRK0708183 PRK07081, PRK07081, acyl carrier protein; Provisio 8e-04
PRK0650893 PRK06508, PRK06508, acyl carrier protein; Provisio 0.004
>gnl|CDD|213536 TIGR00517, acyl_carrier, acyl carrier protein Back     alignment and domain information 
 Score = 83.6 bits (207), Expect = 2e-22
 Identities = 36/75 (48%), Positives = 47/75 (62%)

Query: 60  ETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLEEEFGISVEEESAQT 119
           E  +KV  I+K+QL +  D   T       LGADSLDTVE+VM LEEEF I + +E A+ 
Sbjct: 3   EIFEKVKAIIKEQLNVDEDQITTDARFVEDLGADSLDTVELVMALEEEFDIEIPDEEAEK 62

Query: 120 ISTVQDAADLIEKLI 134
           I+TV DA + IE+  
Sbjct: 63  IATVGDAVNYIEENQ 77

This small protein has phosphopantetheine covalently bound to a Ser residue. It acts as a carrier of the growing fatty acid chain, which is bound to the prosthetic group, during fatty acid biosynthesis. Homologous phosphopantetheine-binding domains are found in longer proteins. Acyl carrier proteins scoring above the noise cutoff but below the trusted cutoff may be specialized versions. These include those involved in mycolic acid biosynthesis in the Mycobacteria, lipid A biosynthesis in Rhizobium, actinorhodin polyketide synthesis in Streptomyces coelicolor, etc. This protein is not found in the Archaea.Gene name acpP.S (Ser) at position 37 in the seed alignment, in the motif DSLD, is the phosphopantetheine attachment site [Fatty acid and phospholipid metabolism, Biosynthesis]. Length = 77
>gnl|CDD|179197 PRK00982, acpP, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|177047 CHL00124, acpP, acyl carrier protein; Validated Back     alignment and domain information
>gnl|CDD|223314 COG0236, AcpP, Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|240304 PTZ00171, PTZ00171, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|215989 pfam00550, PP-binding, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|183533 PRK12449, PRK12449, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|181266 PRK08172, PRK08172, putative acyl carrier protein IacP; Validated Back     alignment and domain information
>gnl|CDD|180278 PRK05828, PRK05828, acyl carrier protein; Validated Back     alignment and domain information
>gnl|CDD|214834 smart00823, PKS_PP, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|180828 PRK07081, PRK07081, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|180597 PRK06508, PRK06508, acyl carrier protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
KOG1748131 consensus Acyl carrier protein/NADH-ubiquinone oxi 99.87
PRK0711779 acyl carrier protein; Validated 99.85
PRK0582884 acyl carrier protein; Validated 99.84
PRK0535082 acyl carrier protein; Provisional 99.82
CHL0012482 acpP acyl carrier protein; Validated 99.81
PRK0588391 acyl carrier protein; Validated 99.81
PTZ00171148 acyl carrier protein; Provisional 99.8
PRK0763986 acyl carrier protein; Provisional 99.8
PRK0817282 putative acyl carrier protein IacP; Validated 99.8
PRK1244980 acyl carrier protein; Provisional 99.8
TIGR0051777 acyl_carrier acyl carrier protein. S (Ser) at posi 99.75
PRK0650893 acyl carrier protein; Provisional 99.74
COG023680 AcpP Acyl carrier protein [Lipid metabolism / Seco 99.73
PRK0918489 acyl carrier protein; Provisional 99.71
PRK0708183 acyl carrier protein; Provisional 99.68
PRK0098278 acpP acyl carrier protein; Provisional 99.67
PF0055067 PP-binding: Phosphopantetheine attachment site; In 99.61
PRK0508778 D-alanine--poly(phosphoribitol) ligase subunit 2; 99.59
PF1457396 PP-binding_2: Acyl-carrier; PDB: 3CE7_A. 99.38
TIGR0168873 dltC D-alanine--poly(phosphoribitol) ligase, subun 99.35
smart0082386 PKS_PP Phosphopantetheine attachment site. Phospho 98.91
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.81
PRK06060705 acyl-CoA synthetase; Validated 98.58
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 98.57
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.56
PRK12467 3956 peptide synthase; Provisional 98.47
PRK056914334 peptide synthase; Validated 98.33
PRK12467 3956 peptide synthase; Provisional 98.3
PRK05691 4334 peptide synthase; Validated 98.26
PRK123165163 peptide synthase; Provisional 98.26
PRK12316 5163 peptide synthase; Provisional 98.24
COG343374 Aryl carrier domain [Secondary metabolites biosynt 98.04
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 97.98
PF07377111 DUF1493: Protein of unknown function (DUF1493); In 97.35
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 96.74
PF10501112 Ribosomal_L50: Ribosomal subunit 39S; InterPro: IP 95.8
TIGR02372 386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 95.26
KOG2452 881 consensus Formyltetrahydrofolate dehydrogenase [Nu 93.65
KOG1178 1032 consensus Non-ribosomal peptide synthetase/alpha-a 92.11
PF0876654 DEK_C: DEK C terminal domain; InterPro: IPR014876 84.24
>KOG1748 consensus Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit [Energy production and conversion; Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=99.87  E-value=2.6e-23  Score=151.14  Aligned_cols=82  Identities=52%  Similarity=0.723  Sum_probs=78.4

Q ss_pred             cCChHHHHHHHHHHHHHHhCCCCCCCCCCCCCcc-ccCCChHHHHHHHHHHHHHhCCccChhhhccCCCHHHHHHHHHHH
Q 032506           55 CAAKPETVDKVCQIVKKQLALPADTTVTGESKFA-ALGADSLDTVEIVMGLEEEFGISVEEESAQTISTVQDAADLIEKL  133 (139)
Q Consensus        55 ~~~~~ei~~~V~~Il~e~l~i~~~~~I~~dt~l~-dLGlDSLd~veLv~~LEeeFgI~i~~~~l~~~~TV~dl~~~I~~~  133 (139)
                      |.+++++.++|..+++.+..++++ .++++++|. |||+||||.||++|+|||||||+||+++.+++.|++++++||+++
T Consensus        48 ~l~k~~v~~RVl~VVk~~dki~~~-k~~~~s~f~~DLGlDSLD~VEiVMAlEEEFgiEIpd~dAdki~t~~da~~yI~~~  126 (131)
T KOG1748|consen   48 CLAKKEVVDRVLDVVKKFDKIDPS-KLTTDSDFFKDLGLDSLDTVEIVMALEEEFGIEIPDEDADKIKTVRDAADYIADK  126 (131)
T ss_pred             hhhHHHHHHHHHHHHHHhhcCCcc-ccchhhHHHHhcCCcccccchhhhhhHHHhCCccCcchhhhhCCHHHHHHHHHhc
Confidence            899999999999999999999996 899999998 999999999999999999999999999999999999999999988


Q ss_pred             Hhhh
Q 032506          134 IETK  137 (139)
Q Consensus       134 ~~~k  137 (139)
                      ...+
T Consensus       127 ~d~k  130 (131)
T KOG1748|consen  127 PDVK  130 (131)
T ss_pred             cccc
Confidence            7654

>PRK07117 acyl carrier protein; Validated Back     alignment and domain information
>PRK05828 acyl carrier protein; Validated Back     alignment and domain information
>PRK05350 acyl carrier protein; Provisional Back     alignment and domain information
>CHL00124 acpP acyl carrier protein; Validated Back     alignment and domain information
>PRK05883 acyl carrier protein; Validated Back     alignment and domain information
>PTZ00171 acyl carrier protein; Provisional Back     alignment and domain information
>PRK07639 acyl carrier protein; Provisional Back     alignment and domain information
>PRK08172 putative acyl carrier protein IacP; Validated Back     alignment and domain information
>PRK12449 acyl carrier protein; Provisional Back     alignment and domain information
>TIGR00517 acyl_carrier acyl carrier protein Back     alignment and domain information
>PRK06508 acyl carrier protein; Provisional Back     alignment and domain information
>COG0236 AcpP Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09184 acyl carrier protein; Provisional Back     alignment and domain information
>PRK07081 acyl carrier protein; Provisional Back     alignment and domain information
>PRK00982 acpP acyl carrier protein; Provisional Back     alignment and domain information
>PF00550 PP-binding: Phosphopantetheine attachment site; InterPro: IPR006163 Phosphopantetheine (or pantetheine 4' phosphate) is the prosthetic group of acyl carrier proteins (ACP) in some multienzyme complexes where it serves as a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups [] Back     alignment and domain information
>PRK05087 D-alanine--poly(phosphoribitol) ligase subunit 2; Validated Back     alignment and domain information
>PF14573 PP-binding_2: Acyl-carrier; PDB: 3CE7_A Back     alignment and domain information
>TIGR01688 dltC D-alanine--poly(phosphoribitol) ligase, subunit 2 Back     alignment and domain information
>smart00823 PKS_PP Phosphopantetheine attachment site Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PF07377 DUF1493: Protein of unknown function (DUF1493); InterPro: IPR010862 This family consists of several bacterial proteins of around 115 residues in length Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PF10501 Ribosomal_L50: Ribosomal subunit 39S; InterPro: IPR018305 This entry represents the L50 protein from the mitochondrial 39S ribosomal subunit Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>KOG2452 consensus Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1178 consensus Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF08766 DEK_C: DEK C terminal domain; InterPro: IPR014876 DEK is a chromatin associated protein that is linked with cancers and autoimmune disease Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
2ava_A82 Solution Structure Of Stearoyl-Acyl Carrier Protein 1e-18
2xz0_D82 The Structure Of The 2:1 (Partially Occupied) Compl 5e-18
3gzl_A81 Crystal Structure Of Holo Pfacp Disulfide-Linked Di 1e-07
2fq0_A79 Solution Structure Of Major Conformation Of Holo-Ac 1e-07
2l3v_A79 Nmr Structure Of Acyl Carrier Protein From Brucella 5e-07
3ejb_A97 Crystal Structure Of P450bioi In Complex With Tetra 1e-05
1l0h_A78 Crystal Structure Of Butyryl-Acp From E.Coli Length 2e-05
1t8k_A77 Crystal Structure Of Apo Acyl Carrier Protein From 2e-05
2k92_A77 Structural Modification Of Acyl Carrier Protein By 2e-05
1x3o_A80 Crystal Structure Of The Acyl Carrier Protein From 2e-05
1l0i_A78 Crystal Structure Of Butyryl-Acp I62m Mutant Length 4e-05
4dxe_H101 2.52 Angstrom Resolution Crystal Structure Of The A 9e-05
2l0q_A80 Nmr Solution Structure Of Vibrio Harveyi Acyl Carri 1e-04
2qnw_A82 Toxoplasma Gondii Apicoplast-Targeted Acyl Carrier 8e-04
>pdb|2AVA|A Chain A, Solution Structure Of Stearoyl-Acyl Carrier Protein Length = 82 Back     alignment and structure 
Iteration: 1

 Score = 88.2 bits (217), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 57/82 (69%)
Query: 57  AKPETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLXXXXXXXXXXXS 116
           AK ET+DKV  IVK++LAL AD  VT +S+F+ LGADSLDTVEIVM L            
Sbjct: 1   AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDK 60
Query: 117 AQTISTVQDAADLIEKLIETKS 138
           AQ IST+Q AAD+IE L+E K+
Sbjct: 61  AQDISTIQQAADVIEGLLEKKA 82
>pdb|2XZ0|D Chain D, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. Length = 82 Back     alignment and structure
>pdb|3GZL|A Chain A, Crystal Structure Of Holo Pfacp Disulfide-Linked Dimer Length = 81 Back     alignment and structure
>pdb|2FQ0|A Chain A, Solution Structure Of Major Conformation Of Holo-Acyl Carrier Protein From Malaria Parasite Plasmodium Falciparum Length = 79 Back     alignment and structure
>pdb|2L3V|A Chain A, Nmr Structure Of Acyl Carrier Protein From Brucella Melitensis Length = 79 Back     alignment and structure
>pdb|3EJB|A Chain A, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 97 Back     alignment and structure
>pdb|1L0H|A Chain A, Crystal Structure Of Butyryl-Acp From E.Coli Length = 78 Back     alignment and structure
>pdb|1T8K|A Chain A, Crystal Structure Of Apo Acyl Carrier Protein From E. Coli Length = 77 Back     alignment and structure
>pdb|2K92|A Chain A, Structural Modification Of Acyl Carrier Protein By Butyryl Group Length = 77 Back     alignment and structure
>pdb|1X3O|A Chain A, Crystal Structure Of The Acyl Carrier Protein From Thermus Thermophilus Hb8 Length = 80 Back     alignment and structure
>pdb|1L0I|A Chain A, Crystal Structure Of Butyryl-Acp I62m Mutant Length = 78 Back     alignment and structure
>pdb|4DXE|H Chain H, 2.52 Angstrom Resolution Crystal Structure Of The Acyl-Carrier-Protein Synthase (Acps)-Acyl Carrier Protein (Acp) Protein-Protein Complex From Staphylococcus Aureus Subsp. Aureus Col Length = 101 Back     alignment and structure
>pdb|2L0Q|A Chain A, Nmr Solution Structure Of Vibrio Harveyi Acyl Carrier Protein (Acp) Length = 80 Back     alignment and structure
>pdb|2QNW|A Chain A, Toxoplasma Gondii Apicoplast-Targeted Acyl Carrier Protein Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 2e-32
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 3e-27
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 3e-22
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 4e-22
1x3o_A80 Acyl carrier protein; structural genomics, riken s 4e-22
2kw2_A101 Specialized acyl carrier protein; structural genom 5e-22
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 5e-22
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 7e-22
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 9e-22
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 1e-21
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 2e-21
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 2e-21
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 3e-21
2l4b_A88 Acyl carrier protein; infectious disease, human gr 4e-21
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 5e-21
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 1e-20
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 4e-20
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 9e-20
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 6e-18
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 4e-17
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 5e-13
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 9e-13
2lte_A103 Specialized acyl carrier protein; APO protein, tra 2e-12
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 8e-12
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 5e-11
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 1e-10
2lki_A105 Putative uncharacterized protein; helical bundle, 1e-08
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 8e-07
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 9e-07
2amw_A83 Hypothetical protein NE2163; all helical protein, 4e-06
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 3e-05
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 7e-05
2l22_A 212 Mupirocin didomain acyl carrier protein; biosynthe 9e-05
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 2e-04
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 9e-05
2l9f_A102 CALE8, meacp; transferase, acyl carrier protein; N 5e-04
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Length = 82 Back     alignment and structure
 Score =  108 bits (272), Expect = 2e-32
 Identities = 55/82 (67%), Positives = 68/82 (82%)

Query: 57  AKPETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLEEEFGISVEEES 116
           AK ET+DKV  IVK++LAL AD  VT +S+F+ LGADSLDTVEIVM LEEEFGI+V+E+ 
Sbjct: 1   AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDK 60

Query: 117 AQTISTVQDAADLIEKLIETKS 138
           AQ IST+Q AAD+IE L+E K+
Sbjct: 61  AQDISTIQQAADVIEGLLEKKA 82
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Length = 100 Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Length = 78 Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Length = 101 Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Length = 80 Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Length = 101 Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Length = 97 Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Length = 77 Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} PDB: 3gzl_A* 2fq0_A* 2fq2_A* Length = 81 Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Length = 82 Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Length = 79 Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Length = 84 Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Length = 81 Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Length = 88 Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Length = 82 Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Length = 113 Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Length = 115 Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Length = 107 Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Length = 81 Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Length = 105 Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Length = 103 Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Length = 95 Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Length = 83 Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Length = 86 Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Length = 105 Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Length = 89 Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Length = 92 Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Length = 80 Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Length = 91 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Length = 88 Back     alignment and structure
>2l9f_A CALE8, meacp; transferase, acyl carrier protein; NMR {Micromonospora echinospora} Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 99.82
2l9f_A102 CALE8, meacp; transferase, acyl carrier protein; N 99.81
2kjs_A87 Putative acyl carrier protein; alpha, ACP, PNS, st 99.8
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 99.79
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 99.79
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 99.78
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 99.78
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 99.78
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 99.77
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 99.77
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 99.77
2l4b_A88 Acyl carrier protein; infectious disease, human gr 99.77
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 99.77
2lte_A103 Specialized acyl carrier protein; APO protein, tra 99.63
1x3o_A80 Acyl carrier protein; structural genomics, riken s 99.76
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 99.76
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 99.76
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 99.75
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 99.75
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 99.75
2lki_A105 Putative uncharacterized protein; helical bundle, 99.75
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 99.74
2kw2_A101 Specialized acyl carrier protein; structural genom 99.74
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 99.74
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 99.73
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 99.71
2amw_A83 Hypothetical protein NE2163; all helical protein, 99.69
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 99.68
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 99.68
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 99.67
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 99.63
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 99.63
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 99.58
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 99.56
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 99.53
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 99.48
2ju1_A95 Erythronolide synthase; carrier protein domain, mo 99.48
4i4d_A93 Peptide synthetase NRPS type II-PCP; structural ge 99.47
2l22_A 212 Mupirocin didomain acyl carrier protein; biosynthe 99.45
1dny_A91 Non-ribosomal peptide synthetase peptidyl carrier 99.43
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 99.38
2cq8_A110 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH 99.17
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 99.01
2jgp_A 520 Tyrocidine synthetase 3; multifunctional enzyme, a 98.8
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 98.75
2fq1_A287 Isochorismatase; ENTB, NRPS, multi-domain, ACP, hy 98.53
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 98.45
4f6l_B 508 AUSA reductase domain protein; thioester reductase 98.45
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 98.43
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 97.51
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 90.5
1dd4_C40 50S ribosomal protein L7/L12; dimer formation, fle 83.55
>2l9f_A CALE8, meacp; transferase, acyl carrier protein; NMR {Micromonospora echinospora} Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} SCOP: a.28.1.0 PDB: 3gzl_A* 2fq0_A* 2fq2_A* Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Back     alignment and structure
>2ju1_A Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A Back     alignment and structure
>4i4d_A Peptide synthetase NRPS type II-PCP; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MLY; 2.10A {Streptomyces verticillus} Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>2cq8_A 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2jgp_A Tyrocidine synthetase 3; multifunctional enzyme, antibiotic biosynthesis, condensatio domain, peptide bond formation, ligase; 1.85A {Brevibacillus brevis} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>2fq1_A Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrolase; 2.30A {Escherichia coli} Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1dd4_C 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; HET: TBR; 2.40A {Thermotoga maritima} SCOP: a.108.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d1f80d_74 a.28.1.1 (D:) Acyl carrier protein {Bacillus subti 1e-18
d1t8ka_77 a.28.1.1 (A:) Acyl carrier protein {Escherichia co 3e-17
d1dv5a_80 a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactob 1e-12
d1vkua_85 a.28.1.1 (A:) Acyl carrier protein {Thermotoga mar 4e-12
d1klpa_115 a.28.1.1 (A:) Acyl carrier protein {Mycobacterium 6e-12
d1or5a_82 a.28.1.1 (A:) Frenolicin polyketide synthase acyl 1e-11
d2af8a_86 a.28.1.1 (A:) Actinorhodin polyketide synthase acy 2e-08
d1nq4a_95 a.28.1.1 (A:) Oxytetracycline polyketide synthase 7e-08
d2jq4a183 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Ag 6e-07
d2pnga176 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP d 8e-05
d2ri9a1 475 a.102.2.1 (A:1036-1510) Class I alpha-1;2-mannosid 0.002
d1hcua_ 488 a.102.2.1 (A:) Class I alpha-1;2-mannosidase, cata 0.002
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Length = 74 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Bacillus subtilis [TaxId: 1423]

 Score = 72.5 bits (178), Expect = 1e-18
 Identities = 27/72 (37%), Positives = 44/72 (61%)

Query: 60  ETVDKVCQIVKKQLALPADTTVTGESKFAALGADSLDTVEIVMGLEEEFGISVEEESAQT 119
           +T+++V +I+  +L +         S    LGAD LD VE+VM LE+EF + + +E A+ 
Sbjct: 3   DTLERVTKIIVDRLGVDEADVKLEASFKEDLGADXLDVVELVMELEDEFDMEISDEDAEK 62

Query: 120 ISTVQDAADLIE 131
           I+TV DA + I+
Sbjct: 63  IATVGDAVNYIQ 74
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Length = 77 Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Length = 80 Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Length = 85 Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Length = 115 Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Length = 82 Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Length = 86 Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Length = 95 Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Length = 83 Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 76 Back     information, alignment and structure
>d2ri9a1 a.102.2.1 (A:1036-1510) Class I alpha-1;2-mannosidase, catalytic domain {Fungus (Penicillium citrinum) [TaxId: 5077]} Length = 475 Back     information, alignment and structure
>d1hcua_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Trichoderma reesei [TaxId: 51453]} Length = 488 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d1t8ka_77 Acyl carrier protein {Escherichia coli [TaxId: 562 99.82
d1vkua_85 Acyl carrier protein {Thermotoga maritima [TaxId: 99.8
d1f80d_74 Acyl carrier protein {Bacillus subtilis [TaxId: 14 99.78
d1klpa_115 Acyl carrier protein {Mycobacterium tuberculosis [ 99.73
d2af8a_86 Actinorhodin polyketide synthase acyl carrier prot 99.69
d1nq4a_95 Oxytetracycline polyketide synthase acyl carrier { 99.69
d1dv5a_80 apo-D-alanyl carrier protein {Lactobacillus casei 99.68
d2jq4a183 Hypothetical protein Atu2571 {Agrobacterium tumefa 99.66
d1or5a_82 Frenolicin polyketide synthase acyl carrier protei 99.57
d2gdwa176 Peptidyl carrier protein (PCP), thioester domain { 99.48
d2pnga176 Type I fatty acid synthase ACP domain {Rat (Rattus 99.33
d2gyc3147 Ribosomal protein L7/12, oligomerisation (N-termin 91.56
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Escherichia coli [TaxId: 562]

Probab=99.82  E-value=1e-20  Score=123.74  Aligned_cols=74  Identities=45%  Similarity=0.641  Sum_probs=70.5

Q ss_pred             HHHHHHHHHHHHHhCCCCCCCCCCCCCcc-ccCCChHHHHHHHHHHHHHhCCccChhhhccCCCHHHHHHHHHHHH
Q 032506           60 ETVDKVCQIVKKQLALPADTTVTGESKFA-ALGADSLDTVEIVMGLEEEFGISVEEESAQTISTVQDAADLIEKLI  134 (139)
Q Consensus        60 ei~~~V~~Il~e~l~i~~~~~I~~dt~l~-dLGlDSLd~veLv~~LEeeFgI~i~~~~l~~~~TV~dl~~~I~~~~  134 (139)
                      +|.++|++++++.++++++ +|+++++|. |||||||+.+||+..||++|||+||++++.++.||+++++||.+++
T Consensus         2 ~I~~~v~~iia~~l~i~~~-~i~~~~~l~~dLg~DSl~~~el~~~iE~~f~i~i~~~~~~~~~Tv~dlv~~i~~~~   76 (77)
T d1t8ka_           2 TIEERVKKIIGEQLGVKQE-EVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQ   76 (77)
T ss_dssp             CHHHHHHHHHHHHHTCCGG-GCCTTCBTTTTTCCCHHHHHHHHHHHHHHHTCCCCHHHHTTCCBHHHHHHHHHHTC
T ss_pred             cHHHHHHHHHHHHHCCCHH-HcCCCCcchhccccchhHHHHHHHHHHHHhCCCCCHHHHHhCCCHHHHHHHHHHcc
Confidence            5789999999999999985 999999997 8999999999999999999999999999999999999999998875
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Back     information, alignment and structure
>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gyc31 a.108.1.1 (3:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure