Citrus Sinensis ID: 032515
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 139 | ||||||
| 225461646 | 153 | PREDICTED: ubiquitin-conjugating enzyme | 1.0 | 0.908 | 0.908 | 5e-72 | |
| 116787013 | 153 | unknown [Picea sitchensis] gi|116791120| | 1.0 | 0.908 | 0.901 | 1e-71 | |
| 359807381 | 153 | uncharacterized protein LOC100805631 [Gl | 1.0 | 0.908 | 0.901 | 1e-71 | |
| 224121530 | 153 | predicted protein [Populus trichocarpa] | 1.0 | 0.908 | 0.901 | 1e-71 | |
| 224114826 | 153 | predicted protein [Populus trichocarpa] | 1.0 | 0.908 | 0.901 | 2e-71 | |
| 18412149 | 153 | ubiquitin-conjugating enzyme E2 35 [Arab | 1.0 | 0.908 | 0.895 | 3e-71 | |
| 18394416 | 153 | ubiquitin-conjugating enzyme E2 36 [Arab | 1.0 | 0.908 | 0.895 | 4e-71 | |
| 192910876 | 153 | ubiquitin-conjugating enzyme 1 [Elaeis g | 1.0 | 0.908 | 0.895 | 7e-71 | |
| 388496952 | 153 | unknown [Lotus japonicus] | 1.0 | 0.908 | 0.888 | 9e-71 | |
| 388496308 | 153 | unknown [Lotus japonicus] gi|418730406|g | 1.0 | 0.908 | 0.888 | 1e-70 |
| >gi|225461646|ref|XP_002285421.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 isoform 1 [Vitis vinifera] gi|255564766|ref|XP_002523377.1| Ubiquitin-conjugating enzyme E2 N, putative [Ricinus communis] gi|449438927|ref|XP_004137239.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Cucumis sativus] gi|449483162|ref|XP_004156510.1| PREDICTED: ubiquitin-conjugating enzyme E2 35-like [Cucumis sativus] gi|223537327|gb|EEF38956.1| Ubiquitin-conjugating enzyme E2 N, putative [Ricinus communis] gi|258456188|gb|ACV72277.1| ubiquitin-conjugating enzyme 13 [Citrus sinensis] gi|298352995|gb|ADI76991.1| putative ubiquitin-conjugating enzyme [Cucumis sativus] gi|298352997|gb|ADI76992.1| putative ubiquitin-conjugating enzyme [Cucumis sativus] gi|302142905|emb|CBI20200.3| unnamed protein product [Vitis vinifera] gi|317159577|gb|ADV04063.1| protein binding/ubiquitin-protein ligase 2 [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
Score = 275 bits (703), Expect = 5e-72, Method: Compositional matrix adjust.
Identities = 139/153 (90%), Positives = 139/153 (90%), Gaps = 14/153 (9%)
Query: 1 MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL 60
MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL
Sbjct: 1 MANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFL 60
Query: 61 PEEYPMAAPK--------------LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 106
PEEYPMAAPK LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD
Sbjct: 61 PEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPD 120
Query: 107 DPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 139
DPLSENIAKHWKTNEAEAVETAKEWTRLYASGA
Sbjct: 121 DPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 153
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|116787013|gb|ABK24341.1| unknown [Picea sitchensis] gi|116791120|gb|ABK25864.1| unknown [Picea sitchensis] gi|224287055|gb|ACN41228.1| unknown [Picea sitchensis] | Back alignment and taxonomy information |
|---|
| >gi|359807381|ref|NP_001241639.1| uncharacterized protein LOC100805631 [Glycine max] gi|297839753|ref|XP_002887758.1| ubiquitin-conjugating enzyme 1 [Arabidopsis lyrata subsp. lyrata] gi|71040675|gb|AAZ20286.1| ubiquitin-conjugating enzyme 1 [Arachis hypogaea] gi|217075352|gb|ACJ86036.1| unknown [Medicago truncatula] gi|255628881|gb|ACU14785.1| unknown [Glycine max] gi|255641415|gb|ACU20984.1| unknown [Glycine max] gi|297333599|gb|EFH64017.1| ubiquitin-conjugating enzyme 1 [Arabidopsis lyrata subsp. lyrata] gi|378464294|gb|AFC01194.1| ubiquitin-conjugating enzyme [Ammopiptanthus mongolicus] gi|388491284|gb|AFK33708.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224121530|ref|XP_002330723.1| predicted protein [Populus trichocarpa] gi|118482721|gb|ABK93279.1| unknown [Populus trichocarpa] gi|118483536|gb|ABK93666.1| unknown [Populus trichocarpa] gi|118484632|gb|ABK94188.1| unknown [Populus trichocarpa] gi|118484964|gb|ABK94347.1| unknown [Populus trichocarpa] gi|222872499|gb|EEF09630.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224114826|ref|XP_002316867.1| predicted protein [Populus trichocarpa] gi|118484002|gb|ABK93888.1| unknown [Populus trichocarpa] gi|118487650|gb|ABK95650.1| unknown [Populus trichocarpa] gi|222859932|gb|EEE97479.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|18412149|ref|NP_565192.1| ubiquitin-conjugating enzyme E2 35 [Arabidopsis thaliana] gi|75332036|sp|Q94A97.1|UBC35_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 35; AltName: Full=Ubiquitin carrier protein 35 gi|15146240|gb|AAK83603.1| At1g78870/F9K20_8 [Arabidopsis thaliana] gi|21553986|gb|AAM63067.1| E2, ubiquitin-conjugating enzyme, putative [Arabidopsis thaliana] gi|23308287|gb|AAN18113.1| At1g78870/F9K20_8 [Arabidopsis thaliana] gi|66354478|gb|AAY44874.1| ubiquitinating enzyme [Arabidopsis thaliana] gi|332198044|gb|AEE36165.1| ubiquitin-conjugating enzyme E2 35 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18394416|ref|NP_564011.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] gi|225446595|ref|XP_002280480.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 isoform 1 [Vitis vinifera] gi|297850090|ref|XP_002892926.1| hypothetical protein ARALYDRAFT_889082 [Arabidopsis lyrata subsp. lyrata] gi|75334547|sp|Q9FZ48.1|UBC36_ARATH RecName: Full=Ubiquitin-conjugating enzyme E2 36; AltName: Full=Ubiquitin carrier protein 36 gi|9802775|gb|AAF99844.1|AC051629_11 Putative ubiquitin-conjugating enzyme E2 [Arabidopsis thaliana] gi|15450413|gb|AAK96500.1| At1g16890/F17F16.16 [Arabidopsis thaliana] gi|16974499|gb|AAL31253.1| At1g16890/F17F16.16 [Arabidopsis thaliana] gi|21555312|gb|AAM63831.1| E2, ubiquitin-conjugating enzyme, putative [Arabidopsis thaliana] gi|66354480|gb|AAY44875.1| ubiquitinating enzyme [Arabidopsis thaliana] gi|297338768|gb|EFH69185.1| hypothetical protein ARALYDRAFT_889082 [Arabidopsis lyrata subsp. lyrata] gi|302143419|emb|CBI21980.3| unnamed protein product [Vitis vinifera] gi|332191395|gb|AEE29516.1| ubiquitin-conjugating enzyme E2 36 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|192910876|gb|ACF06546.1| ubiquitin-conjugating enzyme 1 [Elaeis guineensis] | Back alignment and taxonomy information |
|---|
| >gi|388496952|gb|AFK36542.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|388496308|gb|AFK36220.1| unknown [Lotus japonicus] gi|418730406|gb|AFX66994.1| ubiquitin-conjugating enzyme E2 36 [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 139 | ||||||
| UNIPROTKB|Q0P5K3 | 152 | UBE2N "Ubiquitin-conjugating e | 0.956 | 0.875 | 0.727 | 1.7e-52 | |
| UNIPROTKB|P61088 | 152 | UBE2N "Ubiquitin-conjugating e | 0.956 | 0.875 | 0.727 | 1.7e-52 | |
| UNIPROTKB|F1SQ14 | 152 | LOC100519842 "Uncharacterized | 0.956 | 0.875 | 0.727 | 1.7e-52 | |
| UNIPROTKB|Q5R7J6 | 152 | UBE2N "Ubiquitin-conjugating e | 0.956 | 0.875 | 0.727 | 1.7e-52 | |
| MGI|MGI:1934835 | 152 | Ube2n "ubiquitin-conjugating e | 0.956 | 0.875 | 0.727 | 1.7e-52 | |
| ZFIN|ZDB-GENE-040426-2873 | 154 | ube2na "ubiquitin-conjugating | 0.956 | 0.863 | 0.727 | 2.1e-52 | |
| UNIPROTKB|Q4R4I1 | 152 | UBE2N "Ubiquitin-conjugating e | 0.956 | 0.875 | 0.721 | 3.5e-52 | |
| RGD|621096 | 152 | Ube2n "ubiquitin-conjugating e | 0.956 | 0.875 | 0.721 | 4.4e-52 | |
| UNIPROTKB|J9P4S8 | 152 | LOC611801 "Uncharacterized pro | 0.956 | 0.875 | 0.727 | 5.6e-52 | |
| ZFIN|ZDB-GENE-040426-1291 | 154 | ube2nb "ubiquitin-conjugating | 0.956 | 0.863 | 0.721 | 5.6e-52 |
| UNIPROTKB|Q0P5K3 UBE2N "Ubiquitin-conjugating enzyme E2 N" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 544 (196.6 bits), Expect = 1.7e-52, P = 1.7e-52
Identities = 107/147 (72%), Positives = 119/147 (80%)
Query: 4 SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE 63
+ LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP SP+EGG FKLELFLPEE
Sbjct: 2 AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE 61
Query: 64 YPMAAPK--------------LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL 109
YPMAAPK LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct: 62 YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL 121
Query: 110 SENIAKHWKTNEAEAVETAKEWTRLYA 136
+ ++A+ WKTNEA+A+ETA+ WTRLYA
Sbjct: 122 ANDVAEQWKTNEAQAIETARAWTRLYA 148
|
|
| UNIPROTKB|P61088 UBE2N "Ubiquitin-conjugating enzyme E2 N" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SQ14 LOC100519842 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R7J6 UBE2N "Ubiquitin-conjugating enzyme E2 N" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1934835 Ube2n "ubiquitin-conjugating enzyme E2N" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2873 ube2na "ubiquitin-conjugating enzyme E2Na" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R4I1 UBE2N "Ubiquitin-conjugating enzyme E2 N" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| RGD|621096 Ube2n "ubiquitin-conjugating enzyme E2N" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P4S8 LOC611801 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1291 ube2nb "ubiquitin-conjugating enzyme E2Nb" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00018730001 | SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (141 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 139 | |||
| PTZ00390 | 152 | PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; | 3e-66 | |
| COG5078 | 153 | COG5078, COG5078, Ubiquitin-protein ligase [Posttr | 6e-55 | |
| pfam00179 | 139 | pfam00179, UQ_con, Ubiquitin-conjugating enzyme | 2e-52 | |
| cd00195 | 141 | cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca | 3e-49 | |
| smart00212 | 145 | smart00212, UBCc, Ubiquitin-conjugating enzyme E2, | 2e-46 | |
| PLN00172 | 147 | PLN00172, PLN00172, ubiquitin conjugating enzyme; | 2e-35 |
| >gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
Score = 197 bits (503), Expect = 3e-66
Identities = 85/145 (58%), Positives = 103/145 (71%), Gaps = 14/145 (9%)
Query: 6 LPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYP 65
+ +RI KETQ L ++P PGI A P N R+F +++ GP +PYEGG +KLELFLPE+YP
Sbjct: 3 ISKRIEKETQNLANDPPPGIKAEPDPGNYRHFKILMEGPDGTPYEGGYYKLELFLPEQYP 62
Query: 66 MAAPK--------------LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSE 111
M PK LGRICLDILKDKWSPALQIRTVLLSIQALLSAP PDDPL
Sbjct: 63 MEPPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPEPDDPLDT 122
Query: 112 NIAKHWKTNEAEAVETAKEWTRLYA 136
++A H+K N A+A + A+EW + YA
Sbjct: 123 SVADHFKNNRADAEKVAREWNQKYA 147
|
Length = 152 |
| >gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
| >gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >gnl|CDD|177768 PLN00172, PLN00172, ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 139 | |||
| COG5078 | 153 | Ubiquitin-protein ligase [Posttranslational modifi | 100.0 | |
| KOG0417 | 148 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| PTZ00390 | 152 | ubiquitin-conjugating enzyme; Provisional | 100.0 | |
| PLN00172 | 147 | ubiquitin conjugating enzyme; Provisional | 100.0 | |
| KOG0419 | 152 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| KOG0425 | 171 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| KOG0424 | 158 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| KOG0418 | 200 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| KOG0426 | 165 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| cd00195 | 141 | UBCc Ubiquitin-conjugating enzyme E2, catalytic (U | 100.0 | |
| PF00179 | 140 | UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP | 100.0 | |
| smart00212 | 145 | UBCc Ubiquitin-conjugating enzyme E2, catalytic do | 100.0 | |
| KOG0421 | 175 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| KOG0422 | 153 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| KOG0416 | 189 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| KOG0420 | 184 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| KOG0423 | 223 | consensus Ubiquitin-protein ligase [Posttranslatio | 100.0 | |
| KOG0894 | 244 | consensus Ubiquitin-protein ligase [Posttranslatio | 99.97 | |
| KOG0427 | 161 | consensus Ubiquitin conjugating enzyme [Posttransl | 99.95 | |
| KOG0428 | 314 | consensus Non-canonical ubiquitin conjugating enzy | 99.9 | |
| KOG0429 | 258 | consensus Ubiquitin-conjugating enzyme-related pro | 99.9 | |
| KOG0895 | 1101 | consensus Ubiquitin-conjugating enzyme [Posttransl | 99.69 | |
| KOG0895 | 1101 | consensus Ubiquitin-conjugating enzyme [Posttransl | 99.58 | |
| KOG0896 | 138 | consensus Ubiquitin-conjugating enzyme E2 [Posttra | 99.09 | |
| KOG0897 | 122 | consensus Predicted ubiquitin-conjugating enzyme [ | 98.66 | |
| PF14461 | 133 | Prok-E2_B: Prokaryotic E2 family B | 98.29 | |
| PF05743 | 121 | UEV: UEV domain; InterPro: IPR008883 The N-termina | 97.78 | |
| PF08694 | 161 | UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 | 97.64 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 97.11 | |
| PF05773 | 113 | RWD: RWD domain; InterPro: IPR006575 The RWD eukar | 97.02 | |
| KOG3357 | 167 | consensus Uncharacterized conserved protein [Funct | 96.8 | |
| PF14462 | 122 | Prok-E2_E: Prokaryotic E2 family E | 96.57 | |
| smart00591 | 107 | RWD domain in RING finger and WD repeat containing | 96.55 | |
| PF09765 | 291 | WD-3: WD-repeat region; InterPro: IPR019162 This e | 90.76 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 88.78 | |
| KOG4018 | 215 | consensus Uncharacterized conserved protein, conta | 88.22 | |
| PF14457 | 162 | Prok-E2_A: Prokaryotic E2 family A | 81.72 |
| >COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.2e-50 Score=277.57 Aligned_cols=137 Identities=45% Similarity=0.919 Sum_probs=133.1
Q ss_pred CCCCchHHHHHHHHHHHhcCCCCCeEEeeCCC-CccEEEEEEeCCCCCCCCCcEEEEEEEcCCCCCCCCCC---------
Q 032515 1 MANSNLPRRIIKETQRLLSEPAPGISASPSED-NMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPK--------- 70 (139)
Q Consensus 1 ms~~~~~~Rl~~E~~~l~~~~~~g~~~~~~~~-~~~~w~~~i~Gp~~t~y~gg~f~~~i~fp~~YP~~pP~--------- 70 (139)
|++..+.+||++|++.|++++++++++.+.++ |+++|+++|.||++|||+||+|++.|.||++||++||+
T Consensus 1 ~~s~~a~~RL~kE~~~l~~~~~~~~~a~p~~d~~l~~w~~~i~GP~dtpYegg~f~~~l~fP~~YP~~PPkv~F~t~i~H 80 (153)
T COG5078 1 MSSPSALKRLLKELKKLQKDPPPGISAGPVDDDNLFHWEATITGPPDTPYEGGIFKLTLEFPEDYPFKPPKVRFTTKIFH 80 (153)
T ss_pred CCchhHHHHHHHHHHHHhcCCCCceEEEECCCCcceeEEEEEECCCCCCcCCCEEEEEEECCCCCCCCCCeeeeccCCcC
Confidence 66666999999999999999999999999887 99999999999999999999999999999999999999
Q ss_pred -----CCceecccCCCCCCccccHHHHHHHHHHHhcCCCCCCcccHHHHHHHHhCHHHHHHHHHHHHHHHcC
Q 032515 71 -----LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 137 (139)
Q Consensus 71 -----~G~vcl~~l~~~W~p~~~~~~il~~i~~ll~~p~~~~p~n~~aa~~~~~~~~~f~~~a~~~~~k~a~ 137 (139)
+|+|||++|++.|+|.+++++||.+|+++|.+||+++|+|.|||.+|++|+++|.++||+++++||.
T Consensus 81 PNV~~~G~vCLdIL~~~WsP~~~l~sILlsl~slL~~PN~~~Pln~daa~~~~~d~~~y~~~vr~~~~~~~~ 152 (153)
T COG5078 81 PNVDPSGNVCLDILKDRWSPVYTLETILLSLQSLLLSPNPDSPLNTEAATLYREDKEEYEKKVREWVKKYAE 152 (153)
T ss_pred CCcCCCCCChhHHHhCCCCccccHHHHHHHHHHHHcCCCCCCCCChHHHHHHHhCHHHHHHHHHHHHHHhcc
Confidence 7999999999999999999999999999999999999999999999999999999999999999986
|
|
| >KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00390 ubiquitin-conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN00172 ubiquitin conjugating enzyme; Provisional | Back alignment and domain information |
|---|
| >KOG0419 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0425 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0424 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0426 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain | Back alignment and domain information |
|---|
| >PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] | Back alignment and domain information |
|---|
| >smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues | Back alignment and domain information |
|---|
| >KOG0421 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0422 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0416 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0420 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0423 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0894 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0427 consensus Ubiquitin conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0428 consensus Non-canonical ubiquitin conjugating enzyme 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0429 consensus Ubiquitin-conjugating enzyme-related protein Ft1, involved in programmed cell death [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0896 consensus Ubiquitin-conjugating enzyme E2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0897 consensus Predicted ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14461 Prok-E2_B: Prokaryotic E2 family B | Back alignment and domain information |
|---|
| >PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) | Back alignment and domain information |
|---|
| >PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG3357 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14462 Prok-E2_E: Prokaryotic E2 family E | Back alignment and domain information |
|---|
| >smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain | Back alignment and domain information |
|---|
| >PF09765 WD-3: WD-repeat region; InterPro: IPR019162 This entry represents a region of approximately 100 residues containing three WD repeats and six cysteine residues- possibly as three cysteine-bridges associated with FancL | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4018 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >PF14457 Prok-E2_A: Prokaryotic E2 family A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 139 | ||||
| 2c2v_B | 154 | Crystal Structure Of The Chip-Ubc13-Uev1a Complex L | 2e-58 | ||
| 3hct_B | 155 | Crystal Structure Of Traf6 In Complex With Ubc13 In | 3e-58 | ||
| 1j7d_B | 152 | Crystal Structure Of Hmms2-Hubc13 Length = 152 | 3e-58 | ||
| 4epo_B | 155 | Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE | 3e-58 | ||
| 3von_C | 148 | Crystalstructure Of The Ubiquitin Protease Length = | 5e-58 | ||
| 1jat_A | 155 | Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng | 3e-48 | ||
| 1jbb_A | 153 | Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 | 3e-48 | ||
| 4fh1_A | 153 | S. Cerevisiae Ubc13-N79a Length = 153 | 4e-47 | ||
| 2gmi_A | 152 | Mms2UBC13~UBIQUITIN Length = 152 | 5e-47 | ||
| 2r0j_A | 149 | Crystal Structure Of The Putative Ubiquitin Conjuga | 3e-46 | ||
| 3e95_A | 151 | Crystal Structure Of The Plasmodium Falciparum Ubiq | 4e-46 | ||
| 2ayv_A | 166 | Crystal Structure Of A Putative Ubiquitin-Conjugati | 5e-30 | ||
| 4gpr_A | 151 | Crystal Structure Of Ehubc5, A Ubiquitin Conjugatin | 8e-30 | ||
| 4ii2_C | 163 | Crystal Structure Of Ubiquitin Activating Enzyme 1 | 3e-29 | ||
| 2c4o_B | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 4e-29 | ||
| 1ur6_A | 147 | Nmr Based Structural Model Of The Ubch5b-Cnot4 Comp | 4e-29 | ||
| 1z2u_A | 150 | The 1.1a Crystallographic Structure Of Ubiquitin- C | 4e-29 | ||
| 3tgd_A | 152 | Crystal Structure Of The Human Ubiquitin-Conjugatin | 4e-29 | ||
| 3eb6_B | 149 | Structure Of The Ciap2 Ring Domain Bound To Ubch5b | 4e-29 | ||
| 2esk_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wil | 5e-29 | ||
| 1qcq_A | 148 | Ubiquitin Conjugating Enzyme Length = 148 | 5e-29 | ||
| 2oxq_A | 152 | Structure Of The Ubch5 :chip U-Box Complex Length = | 6e-29 | ||
| 3l1y_A | 157 | Crystal Structure Of Human Ubc4 E2 Conjugating Enzy | 7e-29 | ||
| 3l1z_A | 157 | Crystal Structure Of The U-Box Domain Of Human E4b | 7e-29 | ||
| 3rpg_A | 149 | Bmi1RING1B-Ubch5c Complex Structure Length = 149 | 1e-28 | ||
| 1x23_A | 155 | Crystal Structure Of Ubch5c Length = 155 | 1e-28 | ||
| 2esq_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 1e-28 | ||
| 2fuh_A | 146 | Solution Structure Of The Ubch5cUB NON-Covalent Com | 1e-28 | ||
| 2esp_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 2e-28 | ||
| 2eso_A | 149 | Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Muta | 2e-28 | ||
| 4ddg_A | 399 | Crystal Structure Of Human Otub1UBCH5B~UBUB Length | 2e-28 | ||
| 3jvz_A | 146 | E2~ubiquitin-Hect Length = 146 | 5e-28 | ||
| 3a33_A | 150 | Ubch5b~ubiquitin Conjugate Length = 150 | 8e-28 | ||
| 3bzh_A | 194 | Crystal Structure Of Human Ubiquitin-Conjugating En | 9e-28 | ||
| 2c4o_A | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 1e-27 | ||
| 1y6l_A | 149 | Human Ubiquitin Conjugating Enzyme E2e2 Length = 14 | 1e-27 | ||
| 3ugb_A | 147 | Ubch5c~ubiquitin Conjugate Length = 147 | 3e-27 | ||
| 2yho_B | 149 | The Idol-Ube2d Complex Mediates Sterol-Dependent De | 3e-27 | ||
| 3oj4_A | 153 | Crystal Structure Of The A20 Znf4, Ubiquitin And Ub | 3e-27 | ||
| 2c4p_A | 165 | Crystal Structure Of Human Ubiquitin-Conjugating En | 3e-27 | ||
| 4auq_A | 147 | Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 | 3e-27 | ||
| 2pwq_A | 216 | Crystal Structure Of A Putative Ubiquitin Conjugati | 6e-27 | ||
| 1yh2_A | 169 | Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 | 1e-26 | ||
| 1fxt_A | 149 | Structure Of A Conjugating Enzyme-Ubiquitin Thioles | 2e-25 | ||
| 1tte_A | 215 | The Structure Of A Class Ii Ubiquitin-Conjugating E | 3e-25 | ||
| 4ap4_B | 153 | Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le | 4e-25 | ||
| 1ayz_A | 169 | Crystal Structure Of The Saccharomyces Cerevisiae U | 2e-23 | ||
| 1jas_A | 152 | Hsubc2b Length = 152 | 4e-23 | ||
| 2f4z_A | 193 | Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtw | 8e-23 | ||
| 1z3d_A | 157 | Protein Crystal Growth Improvement Leading To The 2 | 2e-22 | ||
| 1q34_A | 163 | Crystal Structures Of Two Ubc (E2) Enzymes Of The U | 2e-22 | ||
| 2aak_A | 152 | Ubiquitin Conjugating Enzyme From Arabidopsis Thali | 1e-21 | ||
| 1zdn_A | 158 | Ubiquitin-Conjugating Enzyme E2s Length = 158 | 1e-18 | ||
| 2e2c_A | 156 | E2-C, An Ubiquitin Conjugating Enzyme Required For | 3e-17 | ||
| 2bep_A | 159 | Crystal Structure Of Ubiquitin Conjugating Enzyme E | 3e-17 | ||
| 3e46_A | 253 | Crystal Structure Of Ubiquitin-Conjugating Enzyme E | 3e-17 | ||
| 3k9p_A | 217 | The Crystal Structure Of E2-25k And Ubiquitin Compl | 4e-17 | ||
| 3k9o_A | 201 | The Crystal Structure Of E2-25k And Ubb+1 Complex L | 4e-17 | ||
| 1yla_A | 202 | Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington | 4e-17 | ||
| 1i7k_A | 179 | Crystal Structure Of Human Mitotic-Specific Ubiquit | 6e-17 | ||
| 2ucz_A | 165 | Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomy | 4e-16 | ||
| 2onu_A | 152 | Plasmodium Falciparum Ubiquitin Conjugating Enzyme | 2e-15 | ||
| 2awf_A | 172 | Structure Of Human Ubiquitin-Conjugating Enzyme E2 | 6e-14 | ||
| 3fsh_A | 168 | Crystal Structure Of The Ubiquitin Conjugating Enzy | 1e-13 | ||
| 2kly_A | 167 | Solution Structure Of Human Ubiquitin Conjugating E | 1e-13 | ||
| 2cyx_A | 170 | Structure Of Human Ubiquitin-Conjugating Enzyme E2 | 1e-13 | ||
| 3h8k_A | 164 | Crystal Structure Of Ube2g2 Complxed With The G2br | 2e-13 | ||
| 1pzv_A | 164 | Crystal Structures Of Two Ubc (E2) Enzymes Of The U | 1e-12 | ||
| 2z5d_A | 179 | Human Ubiquitin-Conjugating Enzyme E2 H Length = 17 | 4e-12 | ||
| 1c4z_D | 154 | Structure Of E6ap: Insights Into Ubiquitination Pat | 2e-11 | ||
| 3sqv_C | 156 | Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin L | 2e-11 | ||
| 2grp_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-Y87a Length | 3e-11 | ||
| 2grn_A | 161 | Crystal Structure Of Human Rangap1-Ubc9 Length = 16 | 3e-11 | ||
| 1u9a_A | 160 | Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 16 | 3e-11 | ||
| 2gro_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-N85q Length | 3e-11 | ||
| 2o25_C | 160 | Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed Wi | 4e-11 | ||
| 1kps_A | 159 | Structural Basis For E2-Mediated Sumo Conjugation R | 4e-11 | ||
| 3a4s_A | 163 | The Crystal Structure Of The Sld2:ubc9 Complex Leng | 4e-11 | ||
| 1z5s_A | 158 | Crystal Structure Of A Complex Between Ubc9, Sumo-1 | 4e-11 | ||
| 3o2u_A | 190 | S. Cerevisiae Ubc12 Length = 190 | 2e-10 | ||
| 2grr_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-D127s Lengt | 2e-10 | ||
| 2grq_A | 161 | Crystal Structure Of Human Rangap1-Ubc9-D127a Lengt | 3e-10 | ||
| 1y8x_A | 160 | Structural Basis For Recruitment Of Ubc12 By An E2- | 4e-10 | ||
| 3rz3_A | 183 | Human Cdc34 E2 In Complex With Cc0651 Inhibitor Len | 4e-10 | ||
| 3rcz_B | 163 | Rad60 Sld2 Ubc9 Complex Length = 163 | 5e-10 | ||
| 3uio_A | 158 | Complex Between Human Rangap1-Sumo2, Ubc9 And The I | 6e-10 | ||
| 2f4w_A | 187 | Human Ubiquitin-Conjugating Enzyme E2 J2 Length = 1 | 7e-10 | ||
| 2ob4_A | 180 | Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 1 | 7e-10 | ||
| 2uyz_A | 158 | Non-Covalent Complex Between Ubc9 And Sumo1 Length | 8e-10 | ||
| 2fo3_A | 125 | Plasmodium Vivax Ubiquitin Conjugating Enzyme E2 Le | 1e-09 | ||
| 1yf9_A | 171 | Structural Analysis Of Leishmania Major Ubiquitin C | 1e-09 | ||
| 3ong_B | 159 | Crystal Structure Of Uba2ufd-ubc9: Insights Into E1 | 2e-09 | ||
| 2gjd_A | 157 | Distinct Functional Domains Of Ubc9 Dictate Cell Su | 2e-09 | ||
| 1wzv_A | 155 | Crystal Structure Of Ubch8 Length = 155 | 6e-09 | ||
| 2kjh_A | 152 | Nmr Based Structural Model Of The Ubch8-Ubiquitin C | 6e-09 | ||
| 2nvu_C | 180 | Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C1 | 9e-09 | ||
| 2y9o_A | 172 | Pex4p-Pex22p Mutant I Structure Length = 172 | 9e-09 | ||
| 2y9m_A | 172 | Pex4p-Pex22p Structure Length = 172 | 1e-08 | ||
| 2h2y_A | 136 | Crystal Structure Of Ubiquitin Conjugating Enzyme E | 1e-08 | ||
| 2y9p_A | 172 | Pex4p-Pex22p Mutant Ii Structure Length = 172 | 1e-08 | ||
| 2a7l_A | 136 | Structure Of The Human Hypothetical Ubiquitin-Conju | 4e-08 | ||
| 1yrv_A | 169 | Novel Ubiquitin-Conjugating Enzyme Length = 169 | 5e-07 | ||
| 3ceg_A | 323 | Crystal Structure Of The Ubc Domain Of Baculoviral | 1e-06 | ||
| 3fn1_B | 167 | E2-Ring Expansion Of The Nedd8 Cascade Confers Spec | 1e-06 | ||
| 2edi_A | 173 | Solution Structure Of The Uq_con Domain From Human | 1e-06 |
| >pdb|2C2V|B Chain B, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 154 | Back alignment and structure |
|
| >pdb|3HCT|B Chain B, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 155 | Back alignment and structure |
| >pdb|1J7D|B Chain B, Crystal Structure Of Hmms2-Hubc13 Length = 152 | Back alignment and structure |
| >pdb|4EPO|B Chain B, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 155 | Back alignment and structure |
| >pdb|3VON|C Chain C, Crystalstructure Of The Ubiquitin Protease Length = 148 | Back alignment and structure |
| >pdb|1JAT|A Chain A, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 155 | Back alignment and structure |
| >pdb|1JBB|A Chain A, Ubiquitin Conjugating Enzyme, Ubc13 Length = 153 | Back alignment and structure |
| >pdb|4FH1|A Chain A, S. Cerevisiae Ubc13-N79a Length = 153 | Back alignment and structure |
| >pdb|2GMI|A Chain A, Mms2UBC13~UBIQUITIN Length = 152 | Back alignment and structure |
| >pdb|2R0J|A Chain A, Crystal Structure Of The Putative Ubiquitin Conjugating Enzyme, Pfe1350c, From Plasmodium Falciparum Length = 149 | Back alignment and structure |
| >pdb|3E95|A Chain A, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 151 | Back alignment and structure |
| >pdb|2AYV|A Chain A, Crystal Structure Of A Putative Ubiquitin-Conjugating Enzyme E2 From Toxoplasma Gondii Length = 166 | Back alignment and structure |
| >pdb|4GPR|A Chain A, Crystal Structure Of Ehubc5, A Ubiquitin Conjugating Enzyme From Entamoeba Histolytica Length = 151 | Back alignment and structure |
| >pdb|4II2|C Chain C, Crystal Structure Of Ubiquitin Activating Enzyme 1 (uba1) In Complex With The Ub E2 Ubc4, Ubiquitin, And Atp/mg Length = 163 | Back alignment and structure |
| >pdb|2C4O|B Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 | Back alignment and structure |
| >pdb|1UR6|A Chain A, Nmr Based Structural Model Of The Ubch5b-Cnot4 Complex Length = 147 | Back alignment and structure |
| >pdb|1Z2U|A Chain A, The 1.1a Crystallographic Structure Of Ubiquitin- Conjugating Enzyme (Ubc-2) From Caenorhabditis Elegans: Functional And Evolutionary Significance Length = 150 | Back alignment and structure |
| >pdb|3TGD|A Chain A, Crystal Structure Of The Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Length = 152 | Back alignment and structure |
| >pdb|3EB6|B Chain B, Structure Of The Ciap2 Ring Domain Bound To Ubch5b Length = 149 | Back alignment and structure |
| >pdb|2ESK|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b, Wild-Type Length = 149 | Back alignment and structure |
| >pdb|1QCQ|A Chain A, Ubiquitin Conjugating Enzyme Length = 148 | Back alignment and structure |
| >pdb|2OXQ|A Chain A, Structure Of The Ubch5 :chip U-Box Complex Length = 152 | Back alignment and structure |
| >pdb|3L1Y|A Chain A, Crystal Structure Of Human Ubc4 E2 Conjugating Enzyme Length = 157 | Back alignment and structure |
| >pdb|3L1Z|A Chain A, Crystal Structure Of The U-Box Domain Of Human E4b Ubiquitin Ligase In Complex With Ubch5c E2 Ubiquitin Conjugating Enzyme Length = 157 | Back alignment and structure |
| >pdb|3RPG|A Chain A, Bmi1RING1B-Ubch5c Complex Structure Length = 149 | Back alignment and structure |
| >pdb|1X23|A Chain A, Crystal Structure Of Ubch5c Length = 155 | Back alignment and structure |
| >pdb|2ESQ|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ser94gly Length = 149 | Back alignment and structure |
| >pdb|2FUH|A Chain A, Solution Structure Of The Ubch5cUB NON-Covalent Complex Length = 146 | Back alignment and structure |
| >pdb|2ESP|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile88ala Length = 149 | Back alignment and structure |
| >pdb|2ESO|A Chain A, Human Ubiquitin-Conjugating Enzyme (E2) Ubch5b Mutant Ile37ala Length = 149 | Back alignment and structure |
| >pdb|4DDG|A Chain A, Crystal Structure Of Human Otub1UBCH5B~UBUB Length = 399 | Back alignment and structure |
| >pdb|3JVZ|A Chain A, E2~ubiquitin-Hect Length = 146 | Back alignment and structure |
| >pdb|3A33|A Chain A, Ubch5b~ubiquitin Conjugate Length = 150 | Back alignment and structure |
| >pdb|3BZH|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme E2 E1 Length = 194 | Back alignment and structure |
| >pdb|2C4O|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b Length = 165 | Back alignment and structure |
| >pdb|1Y6L|A Chain A, Human Ubiquitin Conjugating Enzyme E2e2 Length = 149 | Back alignment and structure |
| >pdb|3UGB|A Chain A, Ubch5c~ubiquitin Conjugate Length = 147 | Back alignment and structure |
| >pdb|2YHO|B Chain B, The Idol-Ube2d Complex Mediates Sterol-Dependent Degradation Of The Ldl Receptor Length = 149 | Back alignment and structure |
| >pdb|3OJ4|A Chain A, Crystal Structure Of The A20 Znf4, Ubiquitin And Ubch5a Complex Length = 153 | Back alignment and structure |
| >pdb|2C4P|A Chain A, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5a Length = 165 | Back alignment and structure |
| >pdb|4AUQ|A Chain A, Structure Of Birc7-Ubch5b-Ub Complex. Length = 147 | Back alignment and structure |
| >pdb|2PWQ|A Chain A, Crystal Structure Of A Putative Ubiquitin Conjugating Enzyme From Plasmodium Yoelii Length = 216 | Back alignment and structure |
| >pdb|1YH2|A Chain A, Ubiquitin-Conjugating Enzyme Hspc150 Length = 169 | Back alignment and structure |
| >pdb|1FXT|A Chain A, Structure Of A Conjugating Enzyme-Ubiquitin Thiolester Complex Length = 149 | Back alignment and structure |
| >pdb|1TTE|A Chain A, The Structure Of A Class Ii Ubiquitin-Conjugating Enzyme, Ubc1 Length = 215 | Back alignment and structure |
| >pdb|4AP4|B Chain B, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 153 | Back alignment and structure |
| >pdb|1AYZ|A Chain A, Crystal Structure Of The Saccharomyces Cerevisiae Ubiquitin- Conjugating Enzyme Rad6 (Ubc2) At 2.6a Resolution Length = 169 | Back alignment and structure |
| >pdb|1JAS|A Chain A, Hsubc2b Length = 152 | Back alignment and structure |
| >pdb|2F4Z|A Chain A, Toxoplasma Gondii Ubiquitin Conjugating Enzyme Tgtwinscan_2721- E2 Domain Length = 193 | Back alignment and structure |
| >pdb|1Z3D|A Chain A, Protein Crystal Growth Improvement Leading To The 2.5a Crystallographic Structure Of Ubiquitin-Conjugating Enzyme (Ubc-1) From Caenorhabditis Elegans Length = 157 | Back alignment and structure |
| >pdb|1Q34|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 163 | Back alignment and structure |
| >pdb|2AAK|A Chain A, Ubiquitin Conjugating Enzyme From Arabidopsis Thaliana Length = 152 | Back alignment and structure |
| >pdb|1ZDN|A Chain A, Ubiquitin-Conjugating Enzyme E2s Length = 158 | Back alignment and structure |
| >pdb|2E2C|A Chain A, E2-C, An Ubiquitin Conjugating Enzyme Required For The Destruction Of Mitotic Cyclins Length = 156 | Back alignment and structure |
| >pdb|2BEP|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2-25k Length = 159 | Back alignment and structure |
| >pdb|3E46|A Chain A, Crystal Structure Of Ubiquitin-Conjugating Enzyme E2-25kda (Huntington Interacting Protein 2) M172a Mutant Length = 253 | Back alignment and structure |
| >pdb|3K9P|A Chain A, The Crystal Structure Of E2-25k And Ubiquitin Complex Length = 217 | Back alignment and structure |
| >pdb|3K9O|A Chain A, The Crystal Structure Of E2-25k And Ubb+1 Complex Length = 201 | Back alignment and structure |
| >pdb|1YLA|A Chain A, Ubiquitin-Conjugating Enzyme E2-25 Kda (Huntington Interacting Protein 2) Length = 202 | Back alignment and structure |
| >pdb|1I7K|A Chain A, Crystal Structure Of Human Mitotic-Specific Ubiquitin- Conjugating Enzyme, Ubch10 Length = 179 | Back alignment and structure |
| >pdb|2UCZ|A Chain A, Ubiquitin Conjugating Enzyme (Ubc7) From Saccharomyces Cerevisiae Length = 165 | Back alignment and structure |
| >pdb|2ONU|A Chain A, Plasmodium Falciparum Ubiquitin Conjugating Enzyme Pf10_0330, Putative Homologue Of Human Ube2h Length = 152 | Back alignment and structure |
| >pdb|2AWF|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G1 Length = 172 | Back alignment and structure |
| >pdb|3FSH|A Chain A, Crystal Structure Of The Ubiquitin Conjugating Enzyme Ube2g2 Bound To The G2br Domain Of Ubiquitin Ligase Gp78 Length = 168 | Back alignment and structure |
| >pdb|2KLY|A Chain A, Solution Structure Of Human Ubiquitin Conjugating Enzyme Ube2g2 Length = 167 | Back alignment and structure |
| >pdb|2CYX|A Chain A, Structure Of Human Ubiquitin-Conjugating Enzyme E2 G2 (Ube2g2UBC7) Length = 170 | Back alignment and structure |
| >pdb|3H8K|A Chain A, Crystal Structure Of Ube2g2 Complxed With The G2br Domain Of Gp78 At 1.8-A Resolution Length = 164 | Back alignment and structure |
| >pdb|1PZV|A Chain A, Crystal Structures Of Two Ubc (E2) Enzymes Of The Ubiquitin- Conjugating System In Caenorhabditis Elegans Length = 164 | Back alignment and structure |
| >pdb|2Z5D|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 H Length = 179 | Back alignment and structure |
| >pdb|1C4Z|D Chain D, Structure Of E6ap: Insights Into Ubiquitination Pathway Length = 154 | Back alignment and structure |
| >pdb|3SQV|C Chain C, Crystal Structure Of E. Coli O157:h7 E3 Ubiquitin Ligase, Nlel, With A Human E2, Ubch7 Length = 156 | Back alignment and structure |
| >pdb|2GRP|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-Y87a Length = 161 | Back alignment and structure |
| >pdb|2GRN|A Chain A, Crystal Structure Of Human Rangap1-Ubc9 Length = 161 | Back alignment and structure |
| >pdb|1U9A|A Chain A, Human Ubiquitin-Conjugating Enzyme Ubc9 Length = 160 | Back alignment and structure |
| >pdb|2GRO|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-N85q Length = 161 | Back alignment and structure |
| >pdb|2O25|C Chain C, Ubiquitin-Conjugating Enzyme E2-25 Kda Complexed With Sumo-1- Conjugating Enzyme Ubc9 Length = 160 | Back alignment and structure |
| >pdb|1KPS|A Chain A, Structural Basis For E2-Mediated Sumo Conjugation Revealed By A Complex Between Ubiquitin Conjugating Enzyme Ubc9 And Rangap1 Length = 159 | Back alignment and structure |
| >pdb|3A4S|A Chain A, The Crystal Structure Of The Sld2:ubc9 Complex Length = 163 | Back alignment and structure |
| >pdb|1Z5S|A Chain A, Crystal Structure Of A Complex Between Ubc9, Sumo-1, Rangap1 And Nup358RANBP2 Length = 158 | Back alignment and structure |
| >pdb|3O2U|A Chain A, S. Cerevisiae Ubc12 Length = 190 | Back alignment and structure |
| >pdb|2GRR|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127s Length = 161 | Back alignment and structure |
| >pdb|2GRQ|A Chain A, Crystal Structure Of Human Rangap1-Ubc9-D127a Length = 161 | Back alignment and structure |
| >pdb|1Y8X|A Chain A, Structural Basis For Recruitment Of Ubc12 By An E2-Binding Domain In Nedd8's E1 Length = 160 | Back alignment and structure |
| >pdb|3RZ3|A Chain A, Human Cdc34 E2 In Complex With Cc0651 Inhibitor Length = 183 | Back alignment and structure |
| >pdb|3RCZ|B Chain B, Rad60 Sld2 Ubc9 Complex Length = 163 | Back alignment and structure |
| >pdb|3UIO|A Chain A, Complex Between Human Rangap1-Sumo2, Ubc9 And The Ir1 Domain From Ranbp2 Containing Ir2 Motif Ii Length = 158 | Back alignment and structure |
| >pdb|2F4W|A Chain A, Human Ubiquitin-Conjugating Enzyme E2 J2 Length = 187 | Back alignment and structure |
| >pdb|2OB4|A Chain A, Human Ubiquitin-Conjugating Enzyme Cdc34 Length = 180 | Back alignment and structure |
| >pdb|2UYZ|A Chain A, Non-Covalent Complex Between Ubc9 And Sumo1 Length = 158 | Back alignment and structure |
| >pdb|2FO3|A Chain A, Plasmodium Vivax Ubiquitin Conjugating Enzyme E2 Length = 125 | Back alignment and structure |
| >pdb|1YF9|A Chain A, Structural Analysis Of Leishmania Major Ubiquitin Conjugating Enzyme E2 Length = 171 | Back alignment and structure |
| >pdb|3ONG|B Chain B, Crystal Structure Of Uba2ufd-ubc9: Insights Into E1-e2 Interactions In Sumo Pathways Length = 159 | Back alignment and structure |
| >pdb|2GJD|A Chain A, Distinct Functional Domains Of Ubc9 Dictate Cell Survival And Resistance To Genotoxic Stress Length = 157 | Back alignment and structure |
| >pdb|1WZV|A Chain A, Crystal Structure Of Ubch8 Length = 155 | Back alignment and structure |
| >pdb|2KJH|A Chain A, Nmr Based Structural Model Of The Ubch8-Ubiquitin Complex Length = 152 | Back alignment and structure |
| >pdb|2NVU|C Chain C, Structure Of Appbp1-Uba3~nedd8-Nedd8-Mgatp-Ubc12(C111a), A Trapped Ubiquitin-Like Protein Activation Complex Length = 180 | Back alignment and structure |
| >pdb|2Y9O|A Chain A, Pex4p-Pex22p Mutant I Structure Length = 172 | Back alignment and structure |
| >pdb|2Y9M|A Chain A, Pex4p-Pex22p Structure Length = 172 | Back alignment and structure |
| >pdb|2H2Y|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2 From Plasmodium Falciparum Length = 136 | Back alignment and structure |
| >pdb|2Y9P|A Chain A, Pex4p-Pex22p Mutant Ii Structure Length = 172 | Back alignment and structure |
| >pdb|2A7L|A Chain A, Structure Of The Human Hypothetical Ubiquitin-Conjugating Enzyme, Loc55284 Length = 136 | Back alignment and structure |
| >pdb|1YRV|A Chain A, Novel Ubiquitin-Conjugating Enzyme Length = 169 | Back alignment and structure |
| >pdb|3CEG|A Chain A, Crystal Structure Of The Ubc Domain Of Baculoviral Iap Repeat- Containing Protein 6 Length = 323 | Back alignment and structure |
| >pdb|3FN1|B Chain B, E2-Ring Expansion Of The Nedd8 Cascade Confers Specificity To Cullin Modification Length = 167 | Back alignment and structure |
| >pdb|2EDI|A Chain A, Solution Structure Of The Uq_con Domain From Human Nedd8- Conjugating Enzyme Nce2 Length = 173 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 139 | |||
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 2e-79 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 4e-78 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 9e-78 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 3e-76 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 7e-75 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 1e-74 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 2e-74 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 5e-74 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 9e-74 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 3e-73 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 3e-72 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 8e-72 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 2e-71 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 2e-71 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 3e-70 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 8e-69 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 2e-68 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 4e-68 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 7e-68 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 1e-64 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 1e-64 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 3e-63 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 2e-62 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 4e-62 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 4e-61 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 3e-60 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 7e-60 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 8e-60 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 1e-59 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 1e-59 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 4e-59 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 5e-59 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 6e-59 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 4e-57 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 9e-57 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 3e-56 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 8e-56 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 5e-55 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 3e-54 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 4e-52 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 1e-51 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 6e-50 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 6e-49 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 2e-48 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 8e-46 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 1e-44 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 1e-43 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 1e-41 | |
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 2e-37 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 3e-27 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-07 |
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 | Back alignment and structure |
|---|
Score = 230 bits (589), Expect = 2e-79
Identities = 106/151 (70%), Positives = 120/151 (79%), Gaps = 14/151 (9%)
Query: 2 ANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLP 61
++ LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP SP+EGG FKLELFLP
Sbjct: 2 GSAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLP 61
Query: 62 EEYPMAAPKL--------------GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 107
EEYPMAAPK+ GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD
Sbjct: 62 EEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDD 121
Query: 108 PLSENIAKHWKTNEAEAVETAKEWTRLYASG 138
PL+ ++A+ WKTNEA+A+ETA+ WTRLYA
Sbjct: 122 PLANDVAEQWKTNEAQAIETARAWTRLYAMN 152
|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 | Back alignment and structure |
|---|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 | Back alignment and structure |
|---|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Length = 186 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 139 | |||
| 4gpr_A | 151 | Ubiquitin-conjugating enzyme family protein; ubiqu | 100.0 | |
| 2c2v_B | 154 | Ubiquitin-conjugating enzyme E2 N; chaperone, heat | 100.0 | |
| 2aak_A | 152 | UBC1, ubiquitin conjugating enzyme; ubiquitin conj | 100.0 | |
| 1ayz_A | 169 | UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin | 100.0 | |
| 1z2u_A | 150 | Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro | 100.0 | |
| 1zdn_A | 158 | Ubiquitin-conjugating enzyme E2S; structural genom | 100.0 | |
| 2ayv_A | 166 | Ubiquitin-conjugating enzyme E2; structural genomi | 100.0 | |
| 2bep_A | 159 | Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 | 100.0 | |
| 2c4o_A | 165 | Ubiquitin-conjugating enzyme E2 D2; thioesterifica | 100.0 | |
| 2r0j_A | 149 | Ubiquitin carrier protein; ubiquitin conjugating, | 100.0 | |
| 1yh2_A | 169 | HSPC150 protein similar to ubiquitin-conjugating e | 100.0 | |
| 1jat_A | 155 | Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig | 100.0 | |
| 2e2c_A | 156 | Ubiquitin conjugating enzyme; ubiquitin conjugatio | 100.0 | |
| 1fxt_A | 149 | Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM | 100.0 | |
| 2ucz_A | 165 | UBC7, ubiquitin conjugating enzyme; ubiquitin conj | 100.0 | |
| 2f4z_A | 193 | Tgtwinscan_2721 - E2 domain; ubiquitin conjugating | 100.0 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 100.0 | |
| 2gjd_A | 157 | Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT | 100.0 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 100.0 | |
| 3h8k_A | 164 | Ubiquitin-conjugating enzyme E2 G2; alpha beta, al | 100.0 | |
| 3rcz_B | 163 | SUMO-conjugating enzyme UBC9; SUMO-like domain, pr | 100.0 | |
| 3bzh_A | 194 | Ubiquitin-conjugating enzyme E2 E1; structural gen | 100.0 | |
| 2grr_A | 161 | Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj | 100.0 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 100.0 | |
| 1i7k_A | 179 | Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A | 100.0 | |
| 1wzv_A | 155 | Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A | 100.0 | |
| 3rz3_A | 183 | Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj | 100.0 | |
| 3fn1_B | 167 | NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin | 100.0 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 100.0 | |
| 1yrv_A | 169 | Ubiquitin-conjugating ligase MGC351130; structural | 100.0 | |
| 2y9m_A | 172 | Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra | 100.0 | |
| 2onu_A | 152 | Ubiquitin-conjugating enzyme, putative; UBC, plasm | 100.0 | |
| 2z5d_A | 179 | Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig | 100.0 | |
| 2awf_A | 172 | Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co | 100.0 | |
| 1c4z_D | 154 | UBCH7, ubiquitin conjugating enzyme E2; bilobal st | 100.0 | |
| 1yf9_A | 171 | Ubiquitin carrier protein 4; SGPP, structural geno | 100.0 | |
| 4ddg_A | 399 | Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI | 100.0 | |
| 1y8x_A | 160 | Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju | 100.0 | |
| 2nvu_C | 180 | NEDD8-conjugating enzyme UBC12; multifunction macr | 100.0 | |
| 3o2u_A | 190 | NEDD8-conjugating enzyme UBC12; E2 conjugase, liga | 100.0 | |
| 4ds2_A | 167 | Ubiquitin-conjugating enzyme E2, putative; structu | 100.0 | |
| 3ceg_A | 323 | Baculoviral IAP repeat-containing protein 6; apopt | 100.0 | |
| 2q0v_A | 156 | Ubiquitin-conjugating enzyme E2, putative; malaria | 100.0 | |
| 1jat_B | 138 | Ubiquitin-conjugating enzyme variant MMS2; UEV, li | 100.0 | |
| 2fo3_A | 125 | Ubiquitin-conjugating enzyme; SGC, UBC, structural | 100.0 | |
| 2f4w_A | 187 | Ubiquitin-conjugating enzyme E2, J2; endoplasmic r | 100.0 | |
| 2a4d_A | 160 | Ubiquitin-conjugating enzyme E2 variant 1; alterna | 100.0 | |
| 2h2y_A | 136 | Ubiquitin-conjugating enzyme; structural genomics, | 100.0 | |
| 2a7l_A | 136 | Hypothetical ubiquitin-conjugating enzyme LOC55284 | 100.0 | |
| 2hlw_A | 170 | Ubiquitin-conjugating enzyme E2 variant 1; ubiquit | 100.0 | |
| 1zuo_A | 186 | Hypothetical protein LOC92912; ligase, ubiquitin-c | 100.0 | |
| 2z6o_A | 172 | UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p | 99.86 | |
| 3r3q_A | 162 | Suppressor protein STP22 of temperature-sensitive | 99.6 | |
| 3kpa_A | 168 | Probable ubiquitin fold modifier conjugating ENZY; | 99.48 | |
| 3obq_A | 146 | Tumor susceptibility gene 101 protein; protein tra | 99.15 | |
| 2day_A | 128 | Ring finger protein 25; ligase, metal-binding, UB1 | 96.94 | |
| 2ebm_A | 128 | RWD domain-containing protein 1; alpha+beta sandwi | 96.73 | |
| 2yz0_A | 138 | Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- | 96.53 | |
| 3zqs_A | 186 | E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A | 95.94 | |
| 1ukx_A | 137 | GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple | 95.32 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 93.88 | |
| 2ebk_A | 128 | RWD domain-containing protein 3; alpha+beta sandwi | 93.4 | |
| 2daw_A | 154 | RWD domain containing protein 2; alpha+beta sandwi | 92.17 | |
| 2dax_A | 152 | Protein C21ORF6; RWD domain, alpha+beta sandwich f | 88.39 |
| >4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-48 Score=273.16 Aligned_cols=137 Identities=45% Similarity=0.831 Sum_probs=132.9
Q ss_pred CCCchHHHHHHHHHHHhcCCCCCeEEeeCCCCccEEEEEEeCCCCCCCCCcEEEEEEEcCCCCCCCCCC-----------
Q 032515 2 ANSNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPK----------- 70 (139)
Q Consensus 2 s~~~~~~Rl~~E~~~l~~~~~~g~~~~~~~~~~~~w~~~i~Gp~~t~y~gg~f~~~i~fp~~YP~~pP~----------- 70 (139)
|+..|.+||++|+++|+++++.|+++.+.++|+++|+++|.||++|||+||+|+|+|.||++||++||+
T Consensus 1 sa~~a~~RL~kEl~~l~~~~~~~i~~~p~~~nl~~w~~~i~Gp~~tpyegg~f~~~i~fp~~YP~~pP~v~f~t~i~HPn 80 (151)
T 4gpr_A 1 SAAMAMRRIQKELREIQQDPPCNCSAGPVGDDIFHWTATITGPDDSPYQGGLFFLDVHFPVDYPFKAPRVTFMTKVYHPN 80 (151)
T ss_dssp -CHHHHHHHHHHHHHHHHSCCTTEEEEESSSCTTEEEEEEECCSSSTTTTCEEEEEEECCTTTTSSCCEEEESSCCCBTT
T ss_pred CchHHHHHHHHHHHHHHhCCCCCEEEEEcCCCceEEEEEEeCCCCCCcCCCEEEEEEECCCCCCCCcceeEEecCcccce
Confidence 456789999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ---CCceecccCCCCCCccccHHHHHHHHHHHhcCCCCCCcccHHHHHHHHhCHHHHHHHHHHHHHHHcCC
Q 032515 71 ---LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASG 138 (139)
Q Consensus 71 ---~G~vcl~~l~~~W~p~~~~~~il~~i~~ll~~p~~~~p~n~~aa~~~~~~~~~f~~~a~~~~~k~a~~ 138 (139)
+|+||+++|.++|+|++|+.+||.+|+++|.+||+++|+|.+||++|++|+++|.++||+||++||++
T Consensus 81 v~~~G~iCl~iL~~~W~p~~~i~~vl~~i~~ll~~p~~~~p~n~~aa~~~~~d~~~f~~~ar~~~~~ya~p 151 (151)
T 4gpr_A 81 INKNGVICLDILKDQWSPALTLSRVLLSISSLLTDPNPSDPLDPEVANVLRANKKQFEDTAREWTRMYARP 151 (151)
T ss_dssp BCTTCBBCCGGGTTTCCTTCCHHHHHHHHHHHHHCCCTTSCSSHHHHHHHHHCHHHHHHHHHHHHHHHCCC
T ss_pred ECCCCEEEcccccCCCCCCCcHHHHHHHHHHHhcCCCCCCchhHHHHHHHHHCHHHHHHHHHHHHHHhcCC
Confidence 89999999999999999999999999999999999999999999999999999999999999999986
|
| >2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A | Back alignment and structure |
|---|
| >1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... | Back alignment and structure |
|---|
| >1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A | Back alignment and structure |
|---|
| >2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A | Back alignment and structure |
|---|
| >2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A | Back alignment and structure |
|---|
| >1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F | Back alignment and structure |
|---|
| >2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A | Back alignment and structure |
|---|
| >2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A | Back alignment and structure |
|---|
| >3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A | Back alignment and structure |
|---|
| >2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A | Back alignment and structure |
|---|
| >3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A | Back alignment and structure |
|---|
| >3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A | Back alignment and structure |
|---|
| >2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A | Back alignment and structure |
|---|
| >1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C | Back alignment and structure |
|---|
| >1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A | Back alignment and structure |
|---|
| >1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C | Back alignment and structure |
|---|
| >4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C | Back alignment and structure |
|---|
| >1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B | Back alignment and structure |
|---|
| >2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A | Back alignment and structure |
|---|
| >2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 | Back alignment and structure |
|---|
| >2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A | Back alignment and structure |
|---|
| >2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A | Back alignment and structure |
|---|
| >3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* | Back alignment and structure |
|---|
| >3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 | Back alignment and structure |
|---|
| >3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A | Back alignment and structure |
|---|
| >2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A | Back alignment and structure |
|---|
| >2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 | Back alignment and structure |
|---|
| >2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 139 | ||||
| d1j7db_ | 149 | d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {H | 2e-41 | |
| d1jata_ | 152 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 6e-39 | |
| d1y6la_ | 148 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H | 4e-38 | |
| d1z2ua1 | 147 | d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U | 8e-38 | |
| d2f4za1 | 161 | d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca | 3e-35 | |
| d1ayza_ | 153 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 3e-35 | |
| d1fzya_ | 149 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 7e-35 | |
| d2bepa1 | 154 | d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2 | 3e-34 | |
| d2uyza1 | 156 | d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U | 1e-33 | |
| d2e2ca_ | 156 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C | 3e-33 | |
| d1z3da1 | 149 | d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, U | 3e-33 | |
| d1zdna1 | 151 | d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, U | 1e-32 | |
| d1pzva_ | 161 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N | 2e-32 | |
| d1yh2a1 | 154 | d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, U | 2e-32 | |
| d1wzva1 | 150 | d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, U | 7e-32 | |
| d1y8xa1 | 157 | d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, | 7e-32 | |
| d1i7ka_ | 146 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H | 1e-31 | |
| d2a7la1 | 117 | d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 | 3e-31 | |
| d2fo3a1 | 109 | d.20.1.1 (A:9-117) Putative ubiquitin-conjugating | 1e-30 | |
| d1c4zd_ | 144 | d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {H | 1e-30 | |
| d1yrva1 | 148 | d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, U | 4e-30 | |
| d2ucza_ | 164 | d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B | 6e-30 | |
| d2f4wa1 | 157 | d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, | 1e-28 | |
| d1yf9a1 | 158 | d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, | 4e-28 | |
| d2z5da1 | 152 | d.20.1.1 (A:23-174) Ubiquitin conjugating enzyme, | 4e-28 | |
| d2awfa1 | 125 | d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U | 2e-25 | |
| d2a4da1 | 139 | d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, | 8e-24 | |
| d1s1qa_ | 141 | d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG10 | 3e-22 | |
| d1jatb_ | 136 | d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B | 3e-22 | |
| d1zuoa1 | 162 | d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme | 2e-17 | |
| d1uzxa_ | 152 | d.20.1.2 (A:) Vacuolar protein sorting-associated | 7e-17 |
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: UBC-related domain: Ubiquitin conjugating enzyme, UBC species: Human (Homo sapiens), ubc13 [TaxId: 9606]
Score = 132 bits (334), Expect = 2e-41
Identities = 106/147 (72%), Positives = 119/147 (80%), Gaps = 14/147 (9%)
Query: 4 SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEE 63
+ LPRRIIKETQRLL+EP PGI A P E N RYF+V+I GP SP+EGG FKLELFLPEE
Sbjct: 1 AGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEE 60
Query: 64 YPMAAPKL--------------GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL 109
YPMAAPK+ GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL
Sbjct: 61 YPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPL 120
Query: 110 SENIAKHWKTNEAEAVETAKEWTRLYA 136
+ ++A+ WKTNEA+A+ETA+ WTRLYA
Sbjct: 121 ANDVAEQWKTNEAQAIETARAWTRLYA 147
|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 | Back information, alignment and structure |
|---|
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 | Back information, alignment and structure |
|---|
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Length = 149 | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Length = 154 | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Length = 149 | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Length = 151 | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Length = 157 | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Length = 148 | Back information, alignment and structure |
|---|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Length = 164 | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Length = 158 | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 | Back information, alignment and structure |
|---|
| >d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 152 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 139 | |||
| d1y6la_ | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1j7db_ | 149 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1z2ua1 | 147 | Ubiquitin conjugating enzyme, UBC {Caenorhabditis | 100.0 | |
| d2bepa1 | 154 | Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain | 100.0 | |
| d1jata_ | 152 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 100.0 | |
| d1z3da1 | 149 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 100.0 | |
| d1ayza_ | 153 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 100.0 | |
| d2uyza1 | 156 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1yh2a1 | 154 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1zdna1 | 151 | Ubiquitin conjugating enzyme, UBC {Human(Homo sapi | 100.0 | |
| d2ucza_ | 164 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 100.0 | |
| d1fzya_ | 149 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 100.0 | |
| d2f4za1 | 161 | Hypothetical protein Tgtwinscan_2721, E2 domain {T | 100.0 | |
| d1i7ka_ | 146 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d2e2ca_ | 156 | Ubiquitin conjugating enzyme, UBC {Clam (Spisula s | 100.0 | |
| d1yrva1 | 148 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1wzva1 | 150 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1pzva_ | 161 | Ubiquitin conjugating enzyme, UBC {Nematode (Caeno | 100.0 | |
| d1c4zd_ | 144 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1y8xa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1yf9a1 | 158 | Ubiquitin conjugating enzyme, UBC {Leishmania majo | 100.0 | |
| d2z5da1 | 152 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d2f4wa1 | 157 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d2a7la1 | 117 | Ubiquitin-protein ligase W (E2 W) {Human (Homo sap | 100.0 | |
| d2fo3a1 | 109 | Putative ubiquitin-conjugating enzyme, E2 domain { | 100.0 | |
| d2awfa1 | 125 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 100.0 | |
| d1zuoa1 | 162 | Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom | 99.97 | |
| d1jatb_ | 136 | Ubiquitin conjugating enzyme, UBC {Baker's yeast ( | 99.97 | |
| d2a4da1 | 139 | Ubiquitin conjugating enzyme, UBC {Human (Homo sap | 99.97 | |
| d1s1qa_ | 141 | Tumor susceptibility gene 101 (TSG101) {Human (Hom | 99.72 | |
| d1uzxa_ | 152 | Vacuolar protein sorting-associated {Baker's yeast | 99.57 | |
| d2in1a1 | 162 | Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie | 97.55 | |
| d2daya1 | 115 | E3 ubiquitin-protein ligase RNF25 {Human (Homo sap | 96.91 | |
| d1ukxa_ | 137 | EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu | 95.18 | |
| d2daxa1 | 140 | Uncharacterized protein C21orf6 {Human (Homo sapie | 91.65 | |
| d2dawa1 | 141 | RWD domain-containing protein 2 {Human (Homo sapie | 86.07 |
| >d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: UBC-like superfamily: UBC-like family: UBC-related domain: Ubiquitin conjugating enzyme, UBC species: Human (Homo sapiens), ubch8 [TaxId: 9606]
Probab=100.00 E-value=1.2e-46 Score=260.87 Aligned_cols=134 Identities=49% Similarity=0.817 Sum_probs=130.9
Q ss_pred CchHHHHHHHHHHHhcCCCCCeEEeeCCCCccEEEEEEeCCCCCCCCCcEEEEEEEcCCCCCCCCCC-------------
Q 032515 4 SNLPRRIIKETQRLLSEPAPGISASPSEDNMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPK------------- 70 (139)
Q Consensus 4 ~~~~~Rl~~E~~~l~~~~~~g~~~~~~~~~~~~w~~~i~Gp~~t~y~gg~f~~~i~fp~~YP~~pP~------------- 70 (139)
+++.|||++|+++|+++++.|+++.+.++|++.|+++|.||++|||+||+|+|.|.||++||++||+
T Consensus 1 s~~~kRi~~E~~~l~~~~~~gi~~~~~~~n~~~w~~~i~gp~~t~y~gg~f~~~i~~p~~YP~~pP~v~f~t~i~HPnv~ 80 (148)
T d1y6la_ 1 STSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNIN 80 (148)
T ss_dssp CHHHHHHHHHHHHHHHSCCTTEEEEESSSCTTEEEEEEECCTTSTTTTCEEEEEEECCTTTTSSCCEEEESSCCCBTTBC
T ss_pred ChHHHHHHHHHHHHhhCCCCCEEEEECCcccceeceEEECCCCCCcCCCeEEEEEecCcccCCCCcEEEEeCCCcCceEC
Confidence 3678999999999999999999999999999999999999999999999999999999999999999
Q ss_pred -CCceecccCCCCCCccccHHHHHHHHHHHhcCCCCCCcccHHHHHHHHhCHHHHHHHHHHHHHHHcC
Q 032515 71 -LGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYAS 137 (139)
Q Consensus 71 -~G~vcl~~l~~~W~p~~~~~~il~~i~~ll~~p~~~~p~n~~aa~~~~~~~~~f~~~a~~~~~k~a~ 137 (139)
+|.|||+++.++|+|++|+.+||.+|+.+|.+|++++|+|.+|+++|++|+++|.++||+|++|||.
T Consensus 81 ~~G~iCl~~l~~~W~p~~~l~~il~~i~~ll~~p~~~~p~n~~aa~~~~~d~~~f~~~ar~~~~k~A~ 148 (148)
T d1y6la_ 81 SQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT 148 (148)
T ss_dssp TTCBBCCGGGTTTCCTTCCHHHHHHHHHHHHHSCCTTSCSSHHHHHHHHHCHHHHHHHHHHHHHHHCC
T ss_pred CCCeEEEEecCCcCCCcEeHHHHHHHHHHHHhCCCCcccccHHHHHHHHHCHHHHHHHHHHHHHHhCC
Confidence 8999999999999999999999999999999999999999999999999999999999999999984
|
| >d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} | Back information, alignment and structure |
|---|
| >d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} | Back information, alignment and structure |
|---|
| >d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|