Citrus Sinensis ID: 032655
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| 297839749 | 543 | cell division cycle family protein [Arab | 0.919 | 0.230 | 0.658 | 3e-46 | |
| 3834317 | 521 | Similar to CDC16 protein gb|U18291 (CDC1 | 0.919 | 0.239 | 0.651 | 4e-46 | |
| 18412102 | 543 | anaphase-promoting complex subunit 6 [Ar | 0.919 | 0.230 | 0.651 | 5e-46 | |
| 22324595 | 542 | anaphase promoting complex/cyclosome sub | 0.919 | 0.230 | 0.651 | 5e-46 | |
| 225461701 | 545 | PREDICTED: anaphase-promoting complex su | 0.919 | 0.229 | 0.651 | 9e-46 | |
| 356517052 | 545 | PREDICTED: anaphase-promoting complex su | 0.919 | 0.229 | 0.651 | 1e-45 | |
| 255565311 | 655 | cell division cycle, putative [Ricinus c | 0.919 | 0.190 | 0.645 | 1e-45 | |
| 356545461 | 547 | PREDICTED: anaphase-promoting complex su | 0.919 | 0.228 | 0.651 | 2e-45 | |
| 255578574 | 469 | cell division cycle, putative [Ricinus c | 0.919 | 0.266 | 0.638 | 3e-45 | |
| 224116978 | 542 | predicted protein [Populus trichocarpa] | 0.919 | 0.230 | 0.632 | 3e-44 |
| >gi|297839749|ref|XP_002887756.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] gi|297333597|gb|EFH64015.1| cell division cycle family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Score = 189 bits (481), Expect = 3e-46, Method: Compositional matrix adjust.
Identities = 102/155 (65%), Positives = 113/155 (72%), Gaps = 30/155 (19%)
Query: 1 MREEEIEKLRGLVRDCVSKHLYSSAIFFANEVAALTNDPADVYMQAQALFLGRHYRRPFH 60
MREEEIEK+RG+VRDCVSKHLYSSAIFFA++VAALTNDPAD+YMQAQALFLGRHYRR FH
Sbjct: 1 MREEEIEKIRGVVRDCVSKHLYSSAIFFADKVAALTNDPADIYMQAQALFLGRHYRRAFH 60
Query: 61 LLNSSKIVLRDLRFRYLAAKCLEELRSGTSVCRCSVMLRLLKM----------------- 103
LLN+SKIVLRDLRFRYLAAKCLEEL+ +C +ML K+
Sbjct: 61 LLNASKIVLRDLRFRYLAAKCLEELKEWD---QCLLMLGDAKVDEDGIVYDAKDGNVIDF 117
Query: 104 ----------ISSAICFLRGKAYEALGNCAQARLW 128
ISSAICFLRGKAY AL N +QAR W
Sbjct: 118 DKDGEDREINISSAICFLRGKAYGALQNRSQARQW 152
|
Source: Arabidopsis lyrata subsp. lyrata Species: Arabidopsis lyrata Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|3834317|gb|AAC83033.1| Similar to CDC16 protein gb|U18291 (CDC16Hs) from Homo sapiens [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18412102|ref|NP_565188.1| anaphase-promoting complex subunit 6 [Arabidopsis thaliana] gi|302595634|sp|B3DNN5.1|CDC16_ARATH RecName: Full=Anaphase-promoting complex subunit 6; AltName: Full=Cell division cycle protein 16 homolog; Short=CDC16 homolog; AltName: Full=Cyclosome subunit 6; AltName: Full=Protein NOMEGA gi|190016006|gb|ACE62891.1| At1g78770 [Arabidopsis thaliana] gi|332198027|gb|AEE36148.1| anaphase-promoting complex subunit 6 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|22324595|gb|AAM95623.1| anaphase promoting complex/cyclosome subunit [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225461701|ref|XP_002283201.1| PREDICTED: anaphase-promoting complex subunit 6 [Vitis vinifera] gi|302142883|emb|CBI20178.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356517052|ref|XP_003527204.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255565311|ref|XP_002523647.1| cell division cycle, putative [Ricinus communis] gi|223537099|gb|EEF38733.1| cell division cycle, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356545461|ref|XP_003541161.1| PREDICTED: anaphase-promoting complex subunit 6-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255578574|ref|XP_002530149.1| cell division cycle, putative [Ricinus communis] gi|223530348|gb|EEF32241.1| cell division cycle, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224116978|ref|XP_002331799.1| predicted protein [Populus trichocarpa] gi|222874495|gb|EEF11626.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| TAIR|locus:2037523 | 543 | APC6 "anaphase promoting compl | 0.786 | 0.197 | 0.745 | 8.6e-47 | |
| UNIPROTKB|Q13042 | 620 | CDC16 "Cell division cycle pro | 0.558 | 0.122 | 0.415 | 4.1e-13 | |
| UNIPROTKB|E1BPM5 | 620 | CDC16 "Uncharacterized protein | 0.558 | 0.122 | 0.428 | 1.9e-09 | |
| UNIPROTKB|F1P4A5 | 623 | CDC16 "Uncharacterized protein | 0.558 | 0.121 | 0.415 | 4.1e-09 | |
| UNIPROTKB|E2R5H6 | 620 | CDC16 "Uncharacterized protein | 0.558 | 0.122 | 0.415 | 5.2e-09 | |
| MGI|MGI:1917207 | 620 | Cdc16 "CDC16 cell division cyc | 0.558 | 0.122 | 0.428 | 8.5e-09 | |
| RGD|1305076 | 620 | Cdc16 "cell division cycle 16" | 0.558 | 0.122 | 0.428 | 8.5e-09 | |
| ZFIN|ZDB-GENE-051113-132 | 616 | cdc16 "cell division cycle 16 | 0.558 | 0.123 | 0.389 | 1.4e-08 | |
| UNIPROTKB|G4N150 | 664 | MGG_07440 "Anaphase-promoting | 0.544 | 0.111 | 0.391 | 6.4e-08 | |
| FB|FBgn0025781 | 719 | Cdc16 "Cell division cycle 16 | 0.426 | 0.080 | 0.372 | 2.2e-07 |
| TAIR|locus:2037523 APC6 "anaphase promoting complex 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 410 (149.4 bits), Expect = 8.6e-47, Sum P(2) = 8.6e-47
Identities = 82/110 (74%), Positives = 94/110 (85%)
Query: 1 MREEEIEKLRGLVRDCVSKHLYSSAIFFANEVAALTNDPADVYMQAQALFLGRHYRRPFH 60
MREEEIEK+RG+VRDCVSKHLYSSAIFFA++VAALTNDP+D+YMQAQALFLGRHYRR FH
Sbjct: 1 MREEEIEKIRGVVRDCVSKHLYSSAIFFADKVAALTNDPSDIYMQAQALFLGRHYRRAFH 60
Query: 61 LLNSSKIVLRDLRFRYLAAKCLEELRSGTSVCRCSVMLRLLKMISSAICF 110
LLN+SKIVLRDLRFRYLAAKCLEEL+ +C +ML K+ I +
Sbjct: 61 LLNASKIVLRDLRFRYLAAKCLEELKEWD---QCLLMLGDAKVDDDGIVY 107
|
|
| UNIPROTKB|Q13042 CDC16 "Cell division cycle protein 16 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BPM5 CDC16 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4A5 CDC16 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R5H6 CDC16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1917207 Cdc16 "CDC16 cell division cycle 16" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305076 Cdc16 "cell division cycle 16" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-051113-132 cdc16 "cell division cycle 16 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N150 MGG_07440 "Anaphase-promoting complex subunit cut9" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0025781 Cdc16 "Cell division cycle 16 ortholog" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| pfam12895 | 80 | pfam12895, Apc3, Anaphase-promoting complex, cyclo | 7e-12 |
| >gnl|CDD|221837 pfam12895, Apc3, Anaphase-promoting complex, cyclosome, subunit 3 | Back alignment and domain information |
|---|
Score = 56.9 bits (138), Expect = 7e-12
Identities = 26/67 (38%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
Query: 19 KHLYSSAIFFANEVAALTNDPADVYMQAQALFLGRHYRRPFHLLNSSKIVLRDLRFRYLA 78
+ Y +AIF A ++ ALT D Y+ AQ FL Y+R + LL K+ RYL
Sbjct: 2 QGNYENAIFLAEKLLALTPSNEDAYLLAQCYFLQGQYKRAYELLRKLKLDNS-SGCRYLL 60
Query: 79 AKCLEEL 85
A+CL +L
Sbjct: 61 AQCLLKL 67
|
Apc3, otherwise known as Cdc27, is one of the subunits of the anaphase-promoting complex or cyclosome. The anaphase-promoting complex is a multiprotein subunit E3 ubiquitin ligase complex that controls segregation of chromosomes and exit from mitosis in eukaryotes. The protein members of this family contain TPR repeats just as those of Apc7 do, and it appears that these TPR units bind the C-termini of the APC co-activators CDH1 and CDC20. Length = 80 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.89 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 99.61 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.33 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.28 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.26 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.25 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 99.24 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 99.23 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 99.23 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.21 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 99.17 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.16 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.11 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.09 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.08 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.08 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 99.04 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.04 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.04 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.03 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.01 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.99 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 98.97 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 98.97 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.96 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 98.93 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.92 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 98.91 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 98.91 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 98.9 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 98.89 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.89 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.88 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.87 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.86 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 98.82 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.82 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 98.81 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 98.8 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.8 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.79 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 98.76 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.75 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 98.74 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.74 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.72 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.7 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.69 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.68 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.66 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.65 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 98.61 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.58 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.58 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.57 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 98.54 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.54 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.53 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 98.5 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.47 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.47 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 98.45 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.45 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.44 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.44 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.41 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.4 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.4 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 98.38 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.37 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 98.37 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.36 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.33 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.33 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.31 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 98.26 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.25 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 98.24 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.22 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 98.22 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 98.21 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.21 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.21 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.2 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.18 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 98.17 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 98.14 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.13 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.13 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 98.13 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.13 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 98.12 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 98.12 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.11 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 98.1 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 98.1 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.09 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.08 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 98.06 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 98.05 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 98.04 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.04 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.04 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.03 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 98.03 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 98.01 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 97.99 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 97.99 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 97.95 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 97.94 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 97.91 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.9 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 97.88 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.86 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 97.85 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.85 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.83 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 97.83 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 97.83 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 97.81 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.81 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 97.8 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 97.77 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.76 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 97.73 | |
| PF04049 | 142 | APC8: Anaphase promoting complex subunit 8 / Cdc23 | 97.7 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 97.69 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 97.69 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 97.68 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 97.68 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 97.61 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 97.59 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.58 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 97.58 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 97.58 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 97.54 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 97.5 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.48 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 97.48 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.47 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.45 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 97.45 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 97.45 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 97.44 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.37 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 97.37 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 97.35 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.34 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.34 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.34 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 97.33 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.32 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.3 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.24 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.21 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.16 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 97.16 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.15 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 97.13 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.12 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 97.11 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 97.11 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 97.11 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 97.1 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 97.04 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 97.03 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.01 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 97.0 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.97 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 96.95 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 96.92 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 96.9 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 96.89 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 96.89 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 96.78 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 96.78 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 96.74 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 96.7 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 96.7 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 96.68 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 96.67 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 96.64 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 96.63 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 96.62 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 96.61 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 96.57 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 96.54 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 96.5 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 96.48 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 96.38 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 96.36 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 96.3 | |
| PF10516 | 38 | SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat | 96.12 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 96.09 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 96.06 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 96.0 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 96.0 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 95.99 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 95.97 | |
| PF12968 | 144 | DUF3856: Domain of Unknown Function (DUF3856); Int | 95.87 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 95.86 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 95.77 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 95.75 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 95.71 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 95.63 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 95.35 | |
| PF12862 | 94 | Apc5: Anaphase-promoting complex subunit 5 | 95.14 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 95.07 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 94.99 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 94.95 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 94.9 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 94.86 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 94.69 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 94.68 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 94.36 | |
| KOG0551 | 390 | consensus Hsp90 co-chaperone CNS1 (contains TPR re | 94.33 | |
| PF04781 | 111 | DUF627: Protein of unknown function (DUF627); Inte | 94.29 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 93.91 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 93.68 | |
| PF15015 | 569 | NYD-SP12_N: Spermatogenesis-associated, N-terminal | 93.5 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 93.45 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 93.32 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 93.27 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 93.0 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 92.95 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 92.63 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 92.61 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 92.56 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 92.53 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 92.52 | |
| PF07720 | 36 | TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 | 92.47 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 92.41 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 92.36 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 92.27 | |
| PF12739 | 414 | TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex | 92.27 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 92.02 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 91.81 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 91.79 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 91.6 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 91.42 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 91.39 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 91.38 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 91.34 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 91.18 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 91.14 | |
| COG2912 | 269 | Uncharacterized conserved protein [Function unknow | 90.98 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 90.93 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 90.87 | |
| PF04212 | 69 | MIT: MIT (microtubule interacting and transport) d | 90.68 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 90.45 | |
| PF14853 | 53 | Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe | 90.41 | |
| cd02682 | 75 | MIT_AAA_Arch MIT: domain contained within Microtub | 90.33 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 90.27 | |
| KOG4507 | 886 | consensus Uncharacterized conserved protein, conta | 89.8 | |
| PF10255 | 404 | Paf67: RNA polymerase I-associated factor PAF67; I | 89.37 | |
| PF14561 | 90 | TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S | 89.36 | |
| KOG4279 | 1226 | consensus Serine/threonine protein kinase [Signal | 89.13 | |
| KOG1550 | 552 | consensus Extracellular protein SEL-1 and related | 88.87 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 88.76 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 88.28 | |
| PF07721 | 26 | TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 | 88.24 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 87.87 | |
| PRK15180 | 831 | Vi polysaccharide biosynthesis protein TviD; Provi | 87.86 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 87.64 | |
| PF13374 | 42 | TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT | 86.9 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 86.17 | |
| cd02679 | 79 | MIT_spastin MIT: domain contained within Microtubu | 85.99 | |
| PF10579 | 80 | Rapsyn_N: Rapsyn N-terminal myristoylation and lin | 85.68 | |
| COG0790 | 292 | FOG: TPR repeat, SEL1 subfamily [General function | 85.49 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 84.99 | |
| smart00671 | 36 | SEL1 Sel1-like repeats. These represent a subfamil | 84.86 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 84.68 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 84.41 | |
| PF09613 | 160 | HrpB1_HrpK: Bacterial type III secretion protein ( | 84.28 | |
| PF08238 | 39 | Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r | 84.28 | |
| cd02681 | 76 | MIT_calpain7_1 MIT: domain contained within Microt | 83.65 | |
| cd02683 | 77 | MIT_1 MIT: domain contained within Microtubule Int | 83.59 | |
| COG3629 | 280 | DnrI DNA-binding transcriptional activator of the | 83.47 | |
| PF11846 | 193 | DUF3366: Domain of unknown function (DUF3366); Int | 83.04 | |
| PF10037 | 429 | MRP-S27: Mitochondrial 28S ribosomal protein S27; | 83.0 | |
| PF14863 | 141 | Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB | 82.78 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 82.62 | |
| PF07079 | 549 | DUF1347: Protein of unknown function (DUF1347); In | 81.56 | |
| smart00745 | 77 | MIT Microtubule Interacting and Trafficking molecu | 81.25 | |
| TIGR02561 | 153 | HrpB1_HrpK type III secretion protein HrpB1/HrpK. | 80.99 | |
| PF02151 | 36 | UVR: UvrB/uvrC motif; InterPro: IPR001943 During t | 80.91 | |
| KOG3364 | 149 | consensus Membrane protein involved in organellar | 80.83 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 80.52 | |
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 80.06 |
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.89 E-value=1.1e-23 Score=171.47 Aligned_cols=129 Identities=44% Similarity=0.669 Sum_probs=117.1
Q ss_pred HHHHHHHHHHHHHcCChhhHHHHHHHHhccCCChHHHHHHHHHHhccCChHHHHHHHhcCcccccCcchHHHHHHHHHHc
Q 032655 6 IEKLRGLVRDCVSKHLYSSAIFFANEVAALTNDPADVYMQAQALFLGRHYRRPFHLLNSSKIVLRDLRFRYLAAKCLEEL 85 (136)
Q Consensus 6 ~~~lr~~i~~~l~~~~~~~Alf~aekl~~~~~~~~~~~~la~~l~~~g~~~~A~~~l~~~~l~~~~~~~~~l~a~c~~~l 85 (136)
+++.|+++++++++++|.+|+|||||+..++.+|.|+|++||||+..|+|+||.+++...++...+..|+|+++.|+.++
T Consensus 16 ~~~~~~~~r~~l~q~~y~~a~f~adkV~~l~~dp~d~~~~aq~l~~~~~y~ra~~lit~~~le~~d~~cryL~~~~l~~l 95 (611)
T KOG1173|consen 16 LEKYRRLVRDALMQHRYKTALFWADKVAGLTNDPADIYWLAQVLYLGRQYERAAHLITTYKLEKRDIACRYLAAKCLVKL 95 (611)
T ss_pred HHHHHHHHHHHHHHHhhhHHHHHHHHHHhccCChHHHHHHHHHHHhhhHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHH
Confidence 57788888999999999999999999999999999999999999999999999999999998889999999999999999
Q ss_pred cChhhhhhhhh-------------------hhhc------ccchHhHHHHHHHHHHHHcCChHHHHHHHHHhhc
Q 032655 86 RSGTSVCRCSV-------------------MLRL------LKMISSAICFLRGKAYEALGNCAQARLWLVSCDE 134 (136)
Q Consensus 86 ~~~~ea~~~~~-------------------~~~~------~~~~~a~i~~l~G~~~~~~~~~~~A~~~y~~AL~ 134 (136)
++|++|.+-.+ ++.+ ++..+|+||+++|++|..++|+++|..+|++||.
T Consensus 96 k~~~~al~vl~~~~~~~~~f~yy~~~~~~~l~~n~~~~~~~~~~essic~lRgk~y~al~n~~~ar~~Y~~Al~ 169 (611)
T KOG1173|consen 96 KEWDQALLVLGRGHVETNPFSYYEKDAANTLELNSAGEDLMINLESSICYLRGKVYVALDNREEARDKYKEALL 169 (611)
T ss_pred HHHHHHHHHhcccchhhcchhhcchhhhceeccCcccccccccchhceeeeeeehhhhhccHHHHHHHHHHHHh
Confidence 99999964221 0111 3567999999999999999999999999999985
|
|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF04049 APC8: Anaphase promoting complex subunit 8 / Cdc23 ; InterPro: IPR007192 The anaphase-promoting complex is composed of eight protein subunits, including BimE (APC1), CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8) | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12862 Apc5: Anaphase-promoting complex subunit 5 | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >COG2912 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A | Back alignment and domain information |
|---|
| >cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] | Back alignment and domain information |
|---|
| >PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B | Back alignment and domain information |
|---|
| >KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane | Back alignment and domain information |
|---|
| >COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00671 SEL1 Sel1-like repeats | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia | Back alignment and domain information |
|---|
| >PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] | Back alignment and domain information |
|---|
| >cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules | Back alignment and domain information |
|---|
| >COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length | Back alignment and domain information |
|---|
| >smart00745 MIT Microtubule Interacting and Trafficking molecule domain | Back alignment and domain information |
|---|
| >TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK | Back alignment and domain information |
|---|
| >PF02151 UVR: UvrB/uvrC motif; InterPro: IPR001943 During the process of Escherichia coli nucleotide excision repair, DNA damage recognition and processing are achieved by the action of the uvrA, uvrB, and uvrC gene products [] | Back alignment and domain information |
|---|
| >KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 1e-24 |
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 | Back alignment and structure |
|---|
Score = 96.8 bits (241), Expect = 1e-24
Identities = 35/144 (24%), Positives = 53/144 (36%), Gaps = 16/144 (11%)
Query: 2 REEEIEKLRGLVRDCVSKHLYSSAIFFANEVAALTNDPADVYMQAQALFLGRHYRRPFHL 61
+ LR D + + Y A F +V +T +P D + AQ Y R L
Sbjct: 80 SLSREDYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCL 139
Query: 62 LNSSKIVLRDLRFRYLAAKCLEEL----------------RSGTSVCRCSVMLRLLKMIS 105
L + R RYLAA CL +L R +M +
Sbjct: 140 LTKEDLYNRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLE 199
Query: 106 SAICFLRGKAYEALGNCAQARLWL 129
+++C+LRG+ Y L N +A+
Sbjct: 200 ASMCYLRGQVYTNLSNFDRAKECY 223
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.59 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.58 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.57 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.56 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.54 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.52 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.5 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.49 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.49 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.48 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.48 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 99.48 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.47 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.47 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.46 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.44 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.44 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.44 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.43 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.43 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.43 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.43 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.41 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.41 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 99.41 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.41 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.41 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.4 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.39 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 99.38 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.37 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.37 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.37 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.36 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.35 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.35 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.34 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.34 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.33 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.33 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.33 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.33 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.33 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.32 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.32 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.32 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 99.31 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.3 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.3 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.3 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.3 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.3 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.29 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.29 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.29 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.29 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.28 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.28 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.28 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.28 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.28 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.27 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.27 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.27 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 99.26 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 99.26 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.26 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 99.25 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.25 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.25 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 99.25 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.24 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.24 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.24 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.24 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.23 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.23 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.22 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 99.22 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.22 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.22 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.21 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.21 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.21 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.21 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 99.2 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.2 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.19 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.19 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.19 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.19 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 99.19 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.18 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 99.18 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.17 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 99.17 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 99.17 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 99.17 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.16 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.16 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 99.15 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.15 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.13 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.13 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 99.12 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.12 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.11 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 99.11 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 99.11 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.11 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.11 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.1 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 99.09 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 99.09 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.09 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 99.09 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 99.09 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 99.09 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 99.09 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 99.09 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.08 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.08 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 99.07 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 99.07 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 99.06 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 99.06 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 99.06 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 99.06 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 99.05 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 99.05 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 99.03 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 99.01 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 99.01 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 99.01 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 99.0 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 99.0 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.98 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.97 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.96 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 98.96 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.94 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 98.93 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 98.92 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.92 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 98.9 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.89 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 98.88 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 98.88 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.88 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.86 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 98.85 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.85 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 98.85 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.84 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.83 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.82 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.81 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 98.81 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.8 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 98.79 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 98.78 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 98.76 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.74 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 98.72 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.69 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 98.68 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.66 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 98.65 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 98.62 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 98.62 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 98.6 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.6 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 98.59 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.58 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.56 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.54 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.54 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.54 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 98.52 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.46 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.41 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 98.4 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 98.37 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 98.36 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.35 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.34 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.32 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 98.32 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.3 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 98.28 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.28 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 98.23 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 98.22 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.2 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 98.19 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 98.13 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 98.05 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.05 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 98.03 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 98.02 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.99 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 97.99 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 97.97 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 97.89 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 97.81 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 97.8 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 97.65 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 97.54 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 97.49 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 97.35 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 97.29 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 97.26 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 97.21 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 96.97 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 96.9 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 96.53 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 96.48 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 96.47 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 96.34 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 95.76 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 95.52 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 95.48 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 95.4 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 95.25 | |
| 3ffl_A | 167 | Anaphase-promoting complex subunit 7; tetratricope | 93.86 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 93.75 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 93.16 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 93.02 | |
| 4gq2_M | 950 | Nucleoporin NUP120; beta propeller alpha helical, | 92.96 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 92.52 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 92.42 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 92.15 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 91.81 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 91.68 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 90.63 | |
| 1wy6_A | 172 | Hypothetical protein ST1625; helical repeat protei | 90.6 | |
| 2pm7_A | 399 | Protein WEB1, protein transport protein SEC31; bet | 90.16 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 89.89 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 89.49 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 88.84 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 88.33 | |
| 2uwj_G | 115 | Type III export protein PSCG; virulence, chaperone | 86.0 | |
| 2p58_C | 116 | Putative type III secretion protein YSCG; type III | 85.79 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 85.79 | |
| 3kae_A | 242 | CDC27, possible protein of nuclear scaffold; tetra | 85.52 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 85.51 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 84.94 | |
| 4gns_B | 754 | Protein CSD3, chitin biosynthesis protein CHS6; FN | 84.26 | |
| 2w2u_A | 83 | Hypothetical P60 katanin; hydrolase transport comp | 82.45 | |
| 1zbp_A | 273 | Hypothetical protein VPA1032; alpha-beta protein, | 82.05 | |
| 4a5x_A | 86 | MITD1, MIT domain-containing protein 1; protein tr | 80.68 |
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
Probab=99.59 E-value=3e-15 Score=104.33 Aligned_cols=124 Identities=10% Similarity=0.017 Sum_probs=103.4
Q ss_pred HHHHHHHHHHHHHcCChhhHHHHHHHHhccCC-ChHHHHHHHHHHhccCChHHHHHHHhcC-cccccCcchHHHHHHHHH
Q 032655 6 IEKLRGLVRDCVSKHLYSSAIFFANEVAALTN-DPADVYMQAQALFLGRHYRRPFHLLNSS-KIVLRDLRFRYLAAKCLE 83 (136)
Q Consensus 6 ~~~lr~~i~~~l~~~~~~~Alf~aekl~~~~~-~~~~~~~la~~l~~~g~~~~A~~~l~~~-~l~~~~~~~~~l~a~c~~ 83 (136)
++.+...+.+.+..+.. .++++.++| +++.++.+|.+++..|+|.+|+..+++. .++|.++..++.+|.|+.
T Consensus 8 ~~~~~~~l~~~~~~~~~------l~~al~l~p~~~~~~~~lg~~~~~~g~~~eA~~~~~~al~~~P~~~~~~~~lg~~~~ 81 (151)
T 3gyz_A 8 NESISTAVIDAINSGAT------LKDINAIPDDMMDDIYSYAYDFYNKGRIEEAEVFFRFLCIYDFYNVDYIMGLAAIYQ 81 (151)
T ss_dssp -CHHHHHHHHHHHTSCC------TGGGCCSCHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHCCCC------HHHHhCCCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHH
Confidence 34555666666666643 567788888 7889999999999999999999999765 447789999999999999
Q ss_pred HccChhhhhhhhhhhhcccchHhHHHHHHHHHHHHcCChHHHHHHHHHhhcc
Q 032655 84 ELRSGTSVCRCSVMLRLLKMISSAICFLRGKAYEALGNCAQARLWLVSCDEF 135 (136)
Q Consensus 84 ~l~~~~ea~~~~~~~~~~~~~~a~i~~l~G~~~~~~~~~~~A~~~y~~AL~~ 135 (136)
.+|+|++|++.....+.-.|....+++.+|.+|..+|++++|+.+|++|+++
T Consensus 82 ~~g~~~~Ai~~~~~al~l~P~~~~~~~~lg~~~~~lg~~~eA~~~~~~al~l 133 (151)
T 3gyz_A 82 IKEQFQQAADLYAVAFALGKNDYTPVFHTGQCQLRLKAPLKAKECFELVIQH 133 (151)
T ss_dssp HTTCHHHHHHHHHHHHHHSSSCCHHHHHHHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred HHccHHHHHHHHHHHHhhCCCCcHHHHHHHHHHHHcCCHHHHHHHHHHHHHh
Confidence 9999999998776554444556678899999999999999999999999875
|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 | Back alignment and structure |
|---|
| >2pm7_A Protein WEB1, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm6_A 3mzl_B | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* | Back alignment and structure |
|---|
| >4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 | Back alignment and structure |
|---|
| >4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.51 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.47 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.46 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.39 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.37 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.35 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.34 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.33 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.32 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.32 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.31 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.29 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.27 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.26 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.2 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.19 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 99.14 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 99.11 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 99.07 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.02 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 99.0 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 99.0 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.96 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.94 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 98.92 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.91 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 98.9 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.88 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 98.83 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.81 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.8 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.8 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 98.71 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 98.7 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.65 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.57 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.53 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 98.51 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 98.49 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 98.37 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 98.35 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 98.28 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.28 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 97.77 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.62 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 97.48 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.47 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 97.42 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 97.39 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 97.37 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 97.28 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 96.96 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 96.85 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 95.75 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 93.91 | |
| d2cfua2 | 505 | Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI | 85.88 | |
| d1qsaa1 | 450 | 70 KDa soluble lytic transglycosylase (SLT70), sup | 85.84 | |
| d2crba1 | 83 | Nuclear receptor binding factor 2, NRBF2, N-termin | 83.1 | |
| d1wfda_ | 93 | Hypothetical protein 1500032H18Rik {Mouse (Mus mus | 81.91 |
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: Tetratricopeptide repeat (TPR) domain: O-GlcNAc transferase p110 subunit, OGT species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.51 E-value=1.2e-13 Score=101.91 Aligned_cols=124 Identities=13% Similarity=-0.090 Sum_probs=91.9
Q ss_pred HHHHHHHcCChhhHHHHHHHHhccCC-ChHHHHHHHHHHhccCChHHHHHHHhcCc-ccccCcchHHHHHHHHHHccChh
Q 032655 12 LVRDCVSKHLYSSAIFFANEVAALTN-DPADVYMQAQALFLGRHYRRPFHLLNSSK-IVLRDLRFRYLAAKCLEELRSGT 89 (136)
Q Consensus 12 ~i~~~l~~~~~~~Alf~aekl~~~~~-~~~~~~~la~~l~~~g~~~~A~~~l~~~~-l~~~~~~~~~l~a~c~~~l~~~~ 89 (136)
+..-+...++++.|+-+.++++.++| +++.++.+|.++...|++.+|+..++... ..+.+....+.+|.++.++|+++
T Consensus 243 l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~ 322 (388)
T d1w3ba_ 243 LACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIE 322 (388)
T ss_dssp HHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHH
T ss_pred HHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchhhhHHHHHHHHCCCHH
Confidence 33445566777777777777777777 56677777777777777777777665432 24456667777777777777777
Q ss_pred hhhhhhhhhhcccchHhHHHHHHHHHHHHcCChHHHHHHHHHhhcc
Q 032655 90 SVCRCSVMLRLLKMISSAICFLRGKAYEALGNCAQARLWLVSCDEF 135 (136)
Q Consensus 90 ea~~~~~~~~~~~~~~a~i~~l~G~~~~~~~~~~~A~~~y~~AL~~ 135 (136)
+|++.....+...|..+.+++.+|.+|..+|++++|+.+|++||++
T Consensus 323 ~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l 368 (388)
T d1w3ba_ 323 EAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI 368 (388)
T ss_dssp HHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT
T ss_pred HHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh
Confidence 7776555444445666778899999999999999999999999975
|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|