Citrus Sinensis ID: 032697

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MGGGDGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKSS
cccccccEEEHHHHHHccccccEEEEEccEEEEccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHccEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cccccccEEcHHHHHccEEccEEEEEEccEEEEcHHHccccccccHHHHHccccEcHHHHHHccccHHHHHHHHHHEEEEEcHHHccccccccccccccccccccccccHHHHEEHHHHHHHccHcEEEEEEEcc
MGGGDGKVFTLAEvsdhnnmkdcWLIINGKvydvtkfledhpggdevllsatgkdatddfedvghspsareMMDQYYVGeidvstipkkkeytppkqphynqdkTSEFIIRLLQFLVPLAILGLAVGIRIYTKSS
MGGGDGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLsatgkdatddfEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGiriytkss
MGGGDGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKSS
*******VFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVL**************************QYYVGEIDVS*********************SEFIIRLLQFLVPLAILGLAVGIRIYT***
*****GK***LAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEI******************************LLQFLVPLAILGLAVGIRIYTKSS
MGGGDGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKSS
*****GKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPK********QPHY****TSEFIIRLLQFLVPLAILGLAVGIRIYTKSS
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGGDGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAILGLAVGIRIYTKSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
O48845134 Cytochrome b5 isoform B O yes no 0.977 0.985 0.840 6e-63
P49098136 Cytochrome b5 OS=Nicotian N/A no 0.985 0.977 0.804 2e-61
P49099135 Cytochrome b5, seed isofo N/A no 0.985 0.985 0.796 2e-60
P49100137 Cytochrome b5 OS=Oryza sa yes no 0.992 0.978 0.761 1e-57
O04354132 Cytochrome b5 OS=Borago o N/A no 0.962 0.984 0.784 1e-57
P49097135 Cytochrome b5 OS=Cuscuta N/A no 0.985 0.985 0.725 1e-52
Q9ZWT2140 Cytochrome B5 isoform D O no no 0.977 0.942 0.679 1e-51
Q42342134 Cytochrome b5 isoform A O no no 0.970 0.977 0.679 2e-50
P40934134 Cytochrome b5 OS=Brassica N/A no 0.970 0.977 0.671 2e-49
Q9V4N3134 Cytochrome b5 OS=Drosophi yes no 0.874 0.880 0.429 1e-24
>sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 Back     alignment and function desciption
 Score =  238 bits (608), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 124/132 (93%)

Query: 3   GGDGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFED 62
           G + K+FTL+EVS+HN   DCW++INGKVY+VTKFLEDHPGGD+VLLS+TGKDATDDFED
Sbjct: 2   GDEAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFED 61

Query: 63  VGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAIL 122
           VGHS SAREMM+QYYVGEID +TIPKK +YTPPKQPHYNQDKTSEFII+LLQFLVPLAIL
Sbjct: 62  VGHSESAREMMEQYYVGEIDPTTIPKKVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAIL 121

Query: 123 GLAVGIRIYTKS 134
           GLAVGIRIYTKS
Sbjct: 122 GLAVGIRIYTKS 133
Membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.
Arabidopsis thaliana (taxid: 3702)
>sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 Back     alignment and function description
>sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 Back     alignment and function description
>sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 Back     alignment and function description
>sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 Back     alignment and function description
>sp|Q42342|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CYTB5-A PE=1 SV=2 Back     alignment and function description
>sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 Back     alignment and function description
>sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
50844675134 cytochrome b5 isoform Cb5-B [Vernicia fo 0.985 0.992 0.872 3e-62
449432422201 PREDICTED: cytochrome b5 isoform B-like 0.992 0.666 0.859 2e-61
15225731134 putative cytochrome b5 isoform 2 [Arabid 0.977 0.985 0.840 4e-61
255560157136 cytochrome B5 isoform 1, putative [Ricin 0.985 0.977 0.842 5e-61
297826713134 B5 #4 [Arabidopsis lyrata subsp. lyrata] 0.977 0.985 0.833 7e-61
50844677136 cytochrome b5 isoform Cb5-C [Vernicia fo 0.985 0.977 0.834 1e-60
449442375134 PREDICTED: cytochrome b5 isoform B-like 0.985 0.992 0.834 3e-60
296386139 cytochrome b5 [Nicotiana tabacum] 0.985 0.956 0.804 1e-59
1345882136 RecName: Full=Cytochrome b5 0.985 0.977 0.804 2e-59
225465441133 PREDICTED: cytochrome b5 [Vitis vinifera 0.977 0.992 0.818 4e-59
>gi|50844675|gb|AAT84459.1| cytochrome b5 isoform Cb5-B [Vernicia fordii] Back     alignment and taxonomy information
 Score =  242 bits (618), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 116/133 (87%), Positives = 122/133 (91%)

Query: 3   GGDGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFED 62
           GGD KVFTLA+VS HNN KDCWLII GKVYDVTKFL+DHPGGDEVLLSATGKDATDDFED
Sbjct: 2   GGDKKVFTLAQVSQHNNPKDCWLIIGGKVYDVTKFLDDHPGGDEVLLSATGKDATDDFED 61

Query: 63  VGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAIL 122
           VGHS SAREMMDQYYVGEID ST+PKK  Y PPKQPHYNQDKTSEFII+LLQFLVP AIL
Sbjct: 62  VGHSLSAREMMDQYYVGEIDPSTVPKKATYKPPKQPHYNQDKTSEFIIKLLQFLVPFAIL 121

Query: 123 GLAVGIRIYTKSS 135
           GLA GIR+YTKS+
Sbjct: 122 GLAFGIRLYTKST 134

Source: Vernicia fordii

Species: Vernicia fordii

Genus: Vernicia

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449432422|ref|XP_004133998.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus] gi|449526187|ref|XP_004170095.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15225731|ref|NP_180831.1| putative cytochrome b5 isoform 2 [Arabidopsis thaliana] gi|12229741|sp|O48845.1|CYB5B_ARATH RecName: Full=Cytochrome b5 isoform B; AltName: Full=Cytochrome b5 isoform 2 gi|2914701|gb|AAC04491.1| putative cytochrome b5 [Arabidopsis thaliana] gi|22136052|gb|AAM91608.1| putative cytochrome b5 [Arabidopsis thaliana] gi|23197754|gb|AAN15404.1| putative cytochrome b5 [Arabidopsis thaliana] gi|110743053|dbj|BAE99419.1| putative cytochrome b5 [Arabidopsis thaliana] gi|330253635|gb|AEC08729.1| putative cytochrome b5 isoform 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255560157|ref|XP_002521096.1| cytochrome B5 isoform 1, putative [Ricinus communis] gi|223539665|gb|EEF41247.1| cytochrome B5 isoform 1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297826713|ref|XP_002881239.1| B5 #4 [Arabidopsis lyrata subsp. lyrata] gi|297327078|gb|EFH57498.1| B5 #4 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|50844677|gb|AAT84460.1| cytochrome b5 isoform Cb5-C [Vernicia fordii] Back     alignment and taxonomy information
>gi|449442375|ref|XP_004138957.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus] gi|449525073|ref|XP_004169544.1| PREDICTED: cytochrome b5 isoform B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296386|emb|CAA50575.1| cytochrome b5 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|1345882|sp|P49098.1|CYB5_TOBAC RecName: Full=Cytochrome b5 Back     alignment and taxonomy information
>gi|225465441|ref|XP_002265677.1| PREDICTED: cytochrome b5 [Vitis vinifera] gi|147818083|emb|CAN78289.1| hypothetical protein VITISV_008139 [Vitis vinifera] gi|297744338|emb|CBI37308.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
TAIR|locus:2046417134 CB5-B "cytochrome B5 isoform B 0.977 0.985 0.840 4.5e-59
TAIR|locus:2156534140 CB5-D "cytochrome B5 isoform D 0.977 0.942 0.679 1.1e-48
TAIR|locus:2168666134 CB5-E "cytochrome B5 isoform E 0.955 0.962 0.689 4.2e-47
TAIR|locus:2039939132 CB5-C "AT2G46650" [Arabidopsis 0.881 0.901 0.471 9.1e-29
TAIR|locus:2028721135 CB5-A "cytochrome B5 isoform A 0.911 0.911 0.432 3.1e-28
UNIPROTKB|F1NSI3144 CYB5B "Uncharacterized protein 0.562 0.527 0.644 1.6e-24
UNIPROTKB|F1NXL2150 CYB5B "Uncharacterized protein 0.562 0.506 0.644 1.6e-24
ZFIN|ZDB-GENE-040426-2614153 cyb5b "cytochrome b5 type B" [ 0.874 0.771 0.484 3.3e-24
FB|FBgn0264294134 Cyt-b5 "Cytochrome b5" [Drosop 0.866 0.873 0.433 1.1e-23
MGI|MGI:1913677146 Cyb5b "cytochrome b5 type B" [ 0.651 0.602 0.516 2.9e-23
TAIR|locus:2046417 CB5-B "cytochrome B5 isoform B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 606 (218.4 bits), Expect = 4.5e-59, P = 4.5e-59
 Identities = 111/132 (84%), Positives = 124/132 (93%)

Query:     3 GGDGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFED 62
             G + K+FTL+EVS+HN   DCW++INGKVY+VTKFLEDHPGGD+VLLS+TGKDATDDFED
Sbjct:     2 GDEAKIFTLSEVSEHNQAHDCWIVINGKVYNVTKFLEDHPGGDDVLLSSTGKDATDDFED 61

Query:    63 VGHSPSAREMMDQYYVGEIDVSTIPKKKEYTPPKQPHYNQDKTSEFIIRLLQFLVPLAIL 122
             VGHS SAREMM+QYYVGEID +TIPKK +YTPPKQPHYNQDKTSEFII+LLQFLVPLAIL
Sbjct:    62 VGHSESAREMMEQYYVGEIDPTTIPKKVKYTPPKQPHYNQDKTSEFIIKLLQFLVPLAIL 121

Query:   123 GLAVGIRIYTKS 134
             GLAVGIRIYTKS
Sbjct:   122 GLAVGIRIYTKS 133
GO:0020037 "heme binding" evidence=IEA;ISS
GO:0005515 "protein binding" evidence=IPI
GO:0016126 "sterol biosynthetic process" evidence=RCA
GO:0019745 "pentacyclic triterpenoid biosynthetic process" evidence=RCA
GO:0043447 "alkane biosynthetic process" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
TAIR|locus:2156534 CB5-D "cytochrome B5 isoform D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168666 CB5-E "cytochrome B5 isoform E" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039939 CB5-C "AT2G46650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028721 CB5-A "cytochrome B5 isoform A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NSI3 CYB5B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXL2 CYB5B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2614 cyb5b "cytochrome b5 type B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0264294 Cyt-b5 "Cytochrome b5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1913677 Cyb5b "cytochrome b5 type B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O04354CYB5_BOROFNo assigned EC number0.78460.96290.9848N/Ano
P40934CYB5_BRAOBNo assigned EC number0.67170.97030.9776N/Ano
P49100CYB5_ORYSJNo assigned EC number0.76110.99250.9781yesno
Q9V4N3CYB5_DROMENo assigned EC number0.42970.87400.8805yesno
O43169CYB5B_HUMANNo assigned EC number0.42250.94070.8698yesno
P40312CYB5_YEASTNo assigned EC number0.36970.82960.9333yesno
O94391CYB51_SCHPONo assigned EC number0.36220.87400.9516yesno
Q5RDJ5CYB5B_PONABNo assigned EC number0.41540.94070.8698yesno
P49098CYB5_TOBACNo assigned EC number0.80450.98510.9779N/Ano
P49099CYB5S_TOBACNo assigned EC number0.79690.98510.9851N/Ano
P49097CYB5_CUSRENo assigned EC number0.72590.98510.9851N/Ano
O48845CYB5B_ARATHNo assigned EC number0.84090.97770.9850yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
pfam0017374 pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid 2e-37
PLN02252 888 PLN02252, PLN02252, nitrate reductase [NADPH] 2e-26
COG5274164 COG5274, CYB5, Cytochrome b involved in lipid meta 1e-24
PLN03198 526 PLN03198, PLN03198, delta6-acyl-lipid desaturase; 8e-16
PLN03199 485 PLN03199, PLN03199, delta6-acyl-lipid desaturase-l 3e-12
>gnl|CDD|201057 pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid binding domain Back     alignment and domain information 
 Score =  121 bits (307), Expect = 2e-37
 Identities = 47/74 (63%), Positives = 62/74 (83%)

Query: 9  FTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPS 68
          FTL EV  HN   DCW++INGKVYDVT+FL+DHPGG++V+LSA GKDAT+ FED  HS +
Sbjct: 1  FTLEEVKKHNKDGDCWIVINGKVYDVTRFLKDHPGGEDVILSAAGKDATEAFEDAIHSEA 60

Query: 69 AREMMDQYYVGEID 82
          AR+++++Y VGE+D
Sbjct: 61 ARKLLEKYRVGELD 74

This family includes heme binding domains from a diverse range of proteins. This family also includes proteins that bind to steroids. The family includes progesterone receptors. Many members of this subfamily are membrane anchored by an N-terminal transmembrane alpha helix. This family also includes a domain in some chitin synthases. There is no known ligand for this domain in the chitin synthases. Length = 74
>gnl|CDD|215141 PLN02252, PLN02252, nitrate reductase [NADPH] Back     alignment and domain information
>gnl|CDD|227599 COG5274, CYB5, Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] Back     alignment and domain information
>gnl|CDD|178739 PLN03198, PLN03198, delta6-acyl-lipid desaturase; Provisional Back     alignment and domain information
>gnl|CDD|178740 PLN03199, PLN03199, delta6-acyl-lipid desaturase-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
KOG0537124 consensus Cytochrome b5 [Energy production and con 99.97
PF0017376 Cyt-b5: Cytochrome b5-like Heme/Steroid binding do 99.91
KOG0536145 consensus Flavohemoprotein b5+b5R [Energy producti 99.89
PLN03199 485 delta6-acyl-lipid desaturase-like protein; Provisi 99.84
PLN03198 526 delta6-acyl-lipid desaturase; Provisional 99.84
COG5274164 CYB5 Cytochrome b involved in lipid metabolism [En 99.82
PLN02252 888 nitrate reductase [NADPH] 99.81
KOG4576167 consensus Sulfite oxidase, heme-binding component 99.63
KOG4232 430 consensus Delta 6-fatty acid desaturase/delta-8 sp 99.62
COG489281 Predicted heme/steroid binding protein [General fu 98.96
KOG1110183 consensus Putative steroid membrane receptor Hpr6. 97.67
KOG1108281 consensus Predicted heme/steroid binding protein [ 97.42
PF1490194 Jiv90: Cleavage inducing molecular chaperone 89.39
>KOG0537 consensus Cytochrome b5 [Energy production and conversion] Back     alignment and domain information 
Probab=99.97  E-value=3.2e-33  Score=197.91  Aligned_cols=86  Identities=58%  Similarity=1.062  Sum_probs=81.3

Q ss_pred             CCCccCHHHHhcccCCCCeEEEEcCEEeeccccccccCcchhHhhhhcCCCcchhhhhcCCChHHHHhhhhCeEEEecCC
Q 032697            5 DGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVS   84 (135)
Q Consensus         5 ~~~~~t~~ev~~h~~~~~~wvvi~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~l~~~~IG~l~~~   84 (135)
                      +.+.||++||++||+.++|||+|+|+|||||+|+++||||.++|+.+||+|+|+.|++.+||..|++||++|+||.+..+
T Consensus         3 ~~k~~~~~EV~kHn~~~d~Wvii~gkVYDvT~Fl~eHPGG~~vLl~~AGkDaT~~F~~~gHS~~A~~ml~~y~ig~~~~~   82 (124)
T KOG0537|consen    3 DLKYYTLSEVAKHNKKDDCWVIIHGKVYDVTSFLDEHPGGEDVLLEYAGKDATEAFEDVGHSKDAREMLEEYYIGEVPTT   82 (124)
T ss_pred             ccccccHHHHHhhcCCCCeEEEECCEEEeccchhhhCCChHHHHHHHhchhhHHhccccCCcHHHHHHhhhcccccccCC
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             CCCCCC
Q 032697           85 TIPKKK   90 (135)
Q Consensus        85 ~~~~~~   90 (135)
                      ..+...
T Consensus        83 ~~~~~~   88 (124)
T KOG0537|consen   83 ARPVVW   88 (124)
T ss_pred             Ccccee
Confidence            765543

>PF00173 Cyt-b5: Cytochrome b5-like Heme/Steroid binding domain This prints entry is a subset of the Pfam entry; InterPro: IPR001199 Cytochromes b5 are ubiquitous electron transport proteins found in animals, plants and yeasts [] Back     alignment and domain information
>KOG0536 consensus Flavohemoprotein b5+b5R [Energy production and conversion] Back     alignment and domain information
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional Back     alignment and domain information
>PLN03198 delta6-acyl-lipid desaturase; Provisional Back     alignment and domain information
>COG5274 CYB5 Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] Back     alignment and domain information
>PLN02252 nitrate reductase [NADPH] Back     alignment and domain information
>KOG4576 consensus Sulfite oxidase, heme-binding component [Energy production and conversion] Back     alignment and domain information
>KOG4232 consensus Delta 6-fatty acid desaturase/delta-8 sphingolipid desaturase [Lipid transport and metabolism] Back     alignment and domain information
>COG4892 Predicted heme/steroid binding protein [General function prediction only] Back     alignment and domain information
>KOG1110 consensus Putative steroid membrane receptor Hpr6 Back     alignment and domain information
>KOG1108 consensus Predicted heme/steroid binding protein [General function prediction only] Back     alignment and domain information
>PF14901 Jiv90: Cleavage inducing molecular chaperone Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
3ozz_B82 Structure Of A Cytochrome B5 Core-Swap Mutant Lengt 2e-23
3ner_A92 Structure Of Human Type B Cytochrome B5 Length = 92 2e-23
1b5m_A84 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 3e-23
3mus_A87 2a Resolution Structure Of Rat Type B Cytochrome B5 4e-23
1eue_A86 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 8e-23
2ibj_A88 Structure Of House Fly Cytochrome B5 Length = 88 8e-23
1awp_A92 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 2e-22
1icc_A87 Rat Outer Mitochondrial Membrane Cytochrome B5 Leng 3e-22
2i89_A93 Structure Of Septuple Mutant Of Rat Outer Mitochond 3e-22
1cyo_A93 Bovine Cytochrome B(5) Length = 93 5e-22
1hko_A104 Nmr Structure Of Bovine Cytochrome B5 Length = 104 5e-22
2i96_A108 Solution Structure Of The Oxidized Microsomal Human 5e-22
1lj0_A92 Structure Of Quintuple Mutant Of The Rat Outer Mito 1e-21
1ehb_A82 Crystal Structure Of Recombinant Trypsin-Solubilize 2e-21
2m33_A104 Solution Nmr Structure Of Full-length Oxidized Micr 2e-21
1do9_A94 Solution Structure Of Oxidized Microsomal Rabbit Cy 3e-21
1u9u_A82 Crystal Structure Of F58y Mutant Of Cytochrome B5 L 4e-21
1m20_A82 Crystal Structure Of F35y Mutant Of Trypsin-Solubil 4e-21
1blv_A94 Solution Structure Of Oxidized Rat Microsomal Cytoc 5e-21
1bfx_A99 The Solution Nmr Structure Of The B Form Of Oxidize 5e-21
1i87_A98 Solution Structure Of The Water-Soluble Fragment Of 5e-21
1u9m_A82 Crystal Structure Of F58w Mutant Of Cytochrome B5 L 6e-21
1aqa_A94 Solution Structure Of Reduced Microsomal Rat Cytoch 6e-21
1lr6_A82 Crystal Structure Of V45y Mutant Of Cytochrome B5 L 6e-21
1lqx_A82 Crystal Structure Of V45e Mutant Of Cytochrome B5 L 8e-21
1sh4_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 1e-20
1es1_A82 Crystal Structure Of Val61his Mutant Of Trypsin-Sol 1e-20
1j0q_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 1e-20
1i5u_A82 Solution Structure Of Cytochrome B5 Triple Mutant ( 1e-20
1ib7_A94 Solution Structure Of F35y Mutant Of Rat Ferro Cyto 1e-20
1m59_A82 Crystal Structure Of P40v Mutant Of Trypsin-Solubil 2e-20
1m2i_A82 Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME 2e-20
1jex_A94 Solution Structure Of A67v Mutant Of Rat Ferro Cyto 2e-20
1m2m_A82 Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cyt 5e-20
1f03_A82 Solution Structure Of Oxidized Bovine Microsomal Cy 6e-20
2oz0_A 511 Mechanistic And Structural Studies Of H373q Flavocy 1e-13
1szf_A 511 A198g:l230a Mutant Flavocytochrome B2 With Pyruvate 1e-13
1ldc_A 511 X-Ray Structure Of Two Complexes Of The Y143f Flavo 1e-13
1fcb_A 511 Molecular Structure Of Flavocytochrome B2 At 2.4 An 1e-13
1ltd_A 506 The 2.6 Angstroms Refined Structure Of The Escheric 1e-13
1sze_A 511 L230a Mutant Flavocytochrome B2 With Benzoylformate 1e-13
3ks0_A95 Crystal Structure Of The Heme Domain Of Flavocytoch 4e-13
1cxy_A90 Structure And Characterization Of Ectothiorhodospir 4e-12
3lf5_A88 Structure Of Human Nadh Cytochrome B5 Oxidoreductas 1e-10
1x3x_A82 Crystal Structure Of Cytochrome B5 From Ascaris Suu 2e-08
3hc2_A 466 Crystal Structure Of Chicken Sulfite Oxidase Mutant 1e-06
3r18_A 466 Chicken Sulfite Oxidase Double Mutant With Altered 2e-06
1sox_A 466 Sulfite Oxidase From Chicken Liver Length = 466 2e-06
3r19_A 466 Chicken Sulfite Oxidase Triple Mutant With Altered 2e-06
3hbp_A 466 Structure Of Recombinant Chicken Liver Sulfite Oxid 2e-06
3hbq_A 466 Structure Of Recombinant Chicken Liver Sulfite Oxid 2e-06
1mj4_A82 Crystal Structure Analysis Of The Cytochrome B5 Dom 5e-06
2keo_A112 Solution Nmr Structure Of Human Protein Hs00059, Cy 2e-04
>pdb|3OZZ|B Chain B, Structure Of A Cytochrome B5 Core-Swap Mutant Length = 82 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (258), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 44/75 (58%), Positives = 57/75 (76%)
Query: 7  KVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHS 66
          K +TL E+  HNN K  W+II+ KVYD+T+FL +HPGG+EVLL   G DAT+ FEDVGHS
Sbjct: 3  KYYTLEEIQKHNNAKSTWMIIHYKVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHS 62
Query: 67 PSAREMMDQYYVGEI 81
          P AREM+  + +GE+
Sbjct: 63 PDAREMLKTFIIGEL 77
>pdb|3NER|A Chain A, Structure Of Human Type B Cytochrome B5 Length = 92 Back     alignment and structure
>pdb|1B5M|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 84 Back     alignment and structure
>pdb|3MUS|A Chain A, 2a Resolution Structure Of Rat Type B Cytochrome B5 Length = 87 Back     alignment and structure
>pdb|1EUE|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 86 Back     alignment and structure
>pdb|2IBJ|A Chain A, Structure Of House Fly Cytochrome B5 Length = 88 Back     alignment and structure
>pdb|1AWP|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 92 Back     alignment and structure
>pdb|1ICC|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 87 Back     alignment and structure
>pdb|2I89|A Chain A, Structure Of Septuple Mutant Of Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 93 Back     alignment and structure
>pdb|1CYO|A Chain A, Bovine Cytochrome B(5) Length = 93 Back     alignment and structure
>pdb|1HKO|A Chain A, Nmr Structure Of Bovine Cytochrome B5 Length = 104 Back     alignment and structure
>pdb|2I96|A Chain A, Solution Structure Of The Oxidized Microsomal Human Cytochrome B5 Length = 108 Back     alignment and structure
>pdb|1LJ0|A Chain A, Structure Of Quintuple Mutant Of The Rat Outer Mitocondrial Cytochrome B5. Length = 92 Back     alignment and structure
>pdb|1EHB|A Chain A, Crystal Structure Of Recombinant Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|2M33|A Chain A, Solution Nmr Structure Of Full-length Oxidized Microsomal Rabbit Cytochrome B5 Length = 104 Back     alignment and structure
>pdb|1DO9|A Chain A, Solution Structure Of Oxidized Microsomal Rabbit Cytochrome B5. Factors Determining The Heterogeneous Binding Of The Heme Length = 94 Back     alignment and structure
>pdb|1U9U|A Chain A, Crystal Structure Of F58y Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1M20|A Chain A, Crystal Structure Of F35y Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1BLV|A Chain A, Solution Structure Of Oxidized Rat Microsomal Cytochrome B5 In The Presence Of 2 M Guanidinium Chloride: Monitoring The Early Steps In Protein Unfolding Length = 94 Back     alignment and structure
>pdb|1BFX|A Chain A, The Solution Nmr Structure Of The B Form Of Oxidized Rat Microsomal Cytochrome B5, Minimized Average Structure Length = 99 Back     alignment and structure
>pdb|1I87|A Chain A, Solution Structure Of The Water-Soluble Fragment Of Rat Hepatic Apocytochrome B5 Length = 98 Back     alignment and structure
>pdb|1U9M|A Chain A, Crystal Structure Of F58w Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1AQA|A Chain A, Solution Structure Of Reduced Microsomal Rat Cytochrome B5, Nmr, Minimized Average Structure Length = 94 Back     alignment and structure
>pdb|1LR6|A Chain A, Crystal Structure Of V45y Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1LQX|A Chain A, Crystal Structure Of V45e Mutant Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1SH4|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V45h Length = 82 Back     alignment and structure
>pdb|1ES1|A Chain A, Crystal Structure Of Val61his Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1J0Q|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V61h Length = 82 Back     alignment and structure
>pdb|1I5U|A Chain A, Solution Structure Of Cytochrome B5 Triple Mutant (E48aE56AD60A) Length = 82 Back     alignment and structure
>pdb|1M59|A Chain A, Crystal Structure Of P40v Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1M2I|A Chain A, Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME B5 Length = 82 Back     alignment and structure
>pdb|1JEX|A Chain A, Solution Structure Of A67v Mutant Of Rat Ferro Cytochrome B5 Length = 94 Back     alignment and structure
>pdb|1M2M|A Chain A, Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cytochrome B5 Length = 82 Back     alignment and structure
>pdb|1F03|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant (E44a, E48a, E56a, D60a) And Its Interaction With Cytochrome C Length = 82 Back     alignment and structure
>pdb|2OZ0|A Chain A, Mechanistic And Structural Studies Of H373q Flavocytochrome B2: Effects Of Mutating The Active Site Base Length = 511 Back     alignment and structure
>pdb|1SZF|A Chain A, A198g:l230a Mutant Flavocytochrome B2 With Pyruvate Bound Length = 511 Back     alignment and structure
>pdb|1LDC|A Chain A, X-Ray Structure Of Two Complexes Of The Y143f Flavocytochrome B2 Mutant Crystallized In The Presence Of Lactate Or Phenyl-Lactate Length = 511 Back     alignment and structure
>pdb|1FCB|A Chain A, Molecular Structure Of Flavocytochrome B2 At 2.4 Angstroms Resolution Length = 511 Back     alignment and structure
>pdb|1LTD|A Chain A, The 2.6 Angstroms Refined Structure Of The Escherichia Coli Recombinant Saccharomyces Cerevisiae Flavocytochrome B2-Sulphite Complex Length = 506 Back     alignment and structure
>pdb|1SZE|A Chain A, L230a Mutant Flavocytochrome B2 With Benzoylformate Length = 511 Back     alignment and structure
>pdb|3KS0|A Chain A, Crystal Structure Of The Heme Domain Of Flavocytochrome B2 In Complex With Fab B2b4 Length = 95 Back     alignment and structure
>pdb|1CXY|A Chain A, Structure And Characterization Of Ectothiorhodospira Vacuolata Cytochrome B558, A Prokaryotic Homologue Of Cytochrome B5 Length = 90 Back     alignment and structure
>pdb|3LF5|A Chain A, Structure Of Human Nadh Cytochrome B5 Oxidoreductase (Ncb5or) B5 Domain To 1.25a Resolution Length = 88 Back     alignment and structure
>pdb|1X3X|A Chain A, Crystal Structure Of Cytochrome B5 From Ascaris Suum Length = 82 Back     alignment and structure
>pdb|3HC2|A Chain A, Crystal Structure Of Chicken Sulfite Oxidase Mutant Tyr 322 Phe Length = 466 Back     alignment and structure
>pdb|3R18|A Chain A, Chicken Sulfite Oxidase Double Mutant With Altered Activity And Substrate Affinity Length = 466 Back     alignment and structure
>pdb|1SOX|A Chain A, Sulfite Oxidase From Chicken Liver Length = 466 Back     alignment and structure
>pdb|3R19|A Chain A, Chicken Sulfite Oxidase Triple Mutant With Altered Activity And Substrate Affinity Length = 466 Back     alignment and structure
>pdb|3HBP|A Chain A, The Crystal Structure Of C185s Mutant Of Recombinant Sulfite Oxidase With Bound Substrate, Sulfite, At The Active Site Length = 466 Back     alignment and structure
>pdb|3HBQ|A Chain A, Structure Of Recombinant Chicken Liver Sulfite Oxidase Mutant Cys 185 Ala Length = 466 Back     alignment and structure
>pdb|1MJ4|A Chain A, Crystal Structure Analysis Of The Cytochrome B5 Domain Of Human Sulfite Oxidase Length = 82 Back     alignment and structure
>pdb|2KEO|A Chain A, Solution Nmr Structure Of Human Protein Hs00059, Cytochrome-B5-Like Domain Of The Herc2 E3 Ligase. Northeast Structural Genomics Consortium (Nesg) Target Ht98a Length = 112 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1cyo_A93 Cytochrome B5; electron transport; HET: HEM; 1.50A 2e-45
3ner_A92 Cytochrome B5 type B; heme, electron transport; HE 2e-45
1hko_A104 Cytochrome B5; electron transfer protein, heme, el 4e-45
2ibj_A88 Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif 4e-45
3lf5_A88 Cytochrome B5 reductase 4; NCB5OR, electron transf 5e-43
1cxy_A90 Cytochrome B5; helix, beta-strand, electron transp 1e-41
2keo_A112 Probable E3 ubiquitin-protein ligase HERC2; protei 9e-41
1mj4_A82 Sulfite oxidase; cytochrome B5, heme, oxidoreducta 1e-36
1x3x_A82 Cytochrome B5; hemoprotein, porcine parasitic nama 1e-36
1kbi_A 511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 1e-27
1sox_A 466 Sulfite oxidase; oxidoreductase, sulfite oxidation 1e-16
>1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... Length = 93 Back     alignment and structure
 Score =  142 bits (359), Expect = 2e-45
 Identities = 44/85 (51%), Positives = 58/85 (68%)

Query: 7  KVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHS 66
          K +TL E+  HNN K  WLI++ KVYD+TKFLE+HPGG+EVL    G DAT++FEDVGHS
Sbjct: 5  KYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHS 64

Query: 67 PSAREMMDQYYVGEIDVSTIPKKKE 91
            ARE+   + +GE+      K  +
Sbjct: 65 TDARELSKTFIIGELHPDDRSKITK 89
>3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* Length = 92 Back     alignment and structure
>1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* Length = 104 Back     alignment and structure
>2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} Length = 88 Back     alignment and structure
>3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} Length = 88 Back     alignment and structure
>1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 Length = 90 Back     alignment and structure
>2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 Length = 82 Back     alignment and structure
>1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} Length = 82 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Length = 511 Back     alignment and structure
>1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* Length = 466 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
2ibj_A88 Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif 99.97
3ner_A92 Cytochrome B5 type B; heme, electron transport; HE 99.96
1cyo_A93 Cytochrome B5; electron transport; HET: HEM; 1.50A 99.96
1cxy_A90 Cytochrome B5; helix, beta-strand, electron transp 99.96
1hko_A104 Cytochrome B5; electron transfer protein, heme, el 99.96
3lf5_A88 Cytochrome B5 reductase 4; NCB5OR, electron transf 99.96
1x3x_A82 Cytochrome B5; hemoprotein, porcine parasitic nama 99.95
1mj4_A82 Sulfite oxidase; cytochrome B5, heme, oxidoreducta 99.94
2keo_A112 Probable E3 ubiquitin-protein ligase HERC2; protei 99.94
1sox_A 466 Sulfite oxidase; oxidoreductase, sulfite oxidation 99.87
1kbi_A 511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 99.85
1j03_A102 Putative steroid binding protein; alpha and beta, 99.75
>2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} Back     alignment and structure
Probab=99.97  E-value=5.9e-31  Score=175.34  Aligned_cols=85  Identities=56%  Similarity=0.920  Sum_probs=79.3

Q ss_pred             CCCCCCCccCHHHHhcccCCCCeEEEEcCEEeeccccccccCcchhHhhhhcCCCcchhhhhcCCChHHHHhhhhCeEEE
Q 032697            1 MGGGDGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGE   80 (135)
Q Consensus         1 m~~~~~~~~t~~ev~~h~~~~~~wvvi~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~l~~~~IG~   80 (135)
                      |++.+.+.||++||++|++.++|||+|+|+|||||+|+..||||..+|+.++|+|+|+.|..++||..|+++|++|+||+
T Consensus         1 m~~~~~~~~t~~ev~~h~~~~~~wv~i~g~VYDvT~f~~~HPGG~~~i~~~aG~DaT~~f~~~~Hs~~a~~~L~~~~IG~   80 (88)
T 2ibj_A            1 MSSEDVKYFTRAEVAKNNTKDKNWFIIHNNVYDVTAFLNEHPGGEEVLIEQAGKDATEHFEDVGHSSDAREMMKQYKVGE   80 (88)
T ss_dssp             --CCCCCEECHHHHHTSEETTEEEEEETTEEEECGGGTTTCTTCSHHHHTTTTEECHHHHHHHTCCHHHHHHHGGGEEEE
T ss_pred             CCCccCCccCHHHHHHhCCCCCEEEEECCEEEECCcchhhCcCHHHHHHHhCCCcchHHHHHcCCCHHHHHHHHcCceEE
Confidence            77878899999999999999999999999999999999999999999999999999999998889999999999999999


Q ss_pred             ecCCC
Q 032697           81 IDVST   85 (135)
Q Consensus        81 l~~~~   85 (135)
                      +.+++
T Consensus        81 l~~~~   85 (88)
T 2ibj_A           81 LVAEE   85 (88)
T ss_dssp             ECGGG
T ss_pred             eCccc
Confidence            97543
>3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} SCOP: d.120.1.1 PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* Back     alignment and structure
>1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... Back     alignment and structure
>1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 Back     alignment and structure
>1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* Back     alignment and structure
>3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} Back     alignment and structure
>1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} Back     alignment and structure
>1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 Back     alignment and structure
>2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1j03_A Putative steroid binding protein; alpha and beta, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.120.1.2 PDB: 1t0g_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1cyoa_88 d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [Ta 3e-34
d1euea_86 d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegic 3e-33
d1cxya_81 d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira 4e-33
d1mj4a_80 d.120.1.1 (A:) Sulfite oxidase, N-terminal domain 2e-30
d1soxa291 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal dom 4e-30
d1kbia297 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal 2e-29
d1t0ga_109 d.120.1.2 (A:) Putative steroid binding protein AT 6e-04
>d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} Length = 88 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cytochrome b5-like heme/steroid binding domain
superfamily: Cytochrome b5-like heme/steroid binding domain
family: Cytochrome b5
domain: Cytochrome b5
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  112 bits (281), Expect = 3e-34
 Identities = 44/82 (53%), Positives = 57/82 (69%)

Query: 7  KVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHS 66
          K +TL E+  HNN K  WLI++ KVYD+TKFLE+HPGG+EVL    G DAT++FEDVGHS
Sbjct: 5  KYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHS 64

Query: 67 PSAREMMDQYYVGEIDVSTIPK 88
            ARE+   + +GE+      K
Sbjct: 65 TDARELSKTFIIGELHPDDRSK 86
>d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} Length = 81 Back     information, alignment and structure
>d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 Back     information, alignment and structure
>d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure
>d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 109 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1cyoa_88 Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} 99.97
d1euea_86 Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 101 99.97
d1cxya_81 Cytochrome b558 {Ectothiorhodospira vacuolata [Tax 99.96
d1soxa291 Sulfite oxidase, N-terminal domain {Chicken (Gallu 99.96
d1kbia297 Flavocytochrome b2, N-terminal domain {Baker's yea 99.95
d1mj4a_80 Sulfite oxidase, N-terminal domain {Human (Homo sa 99.95
d1t0ga_109 Putative steroid binding protein AT2G24940 {Thale 98.77
>d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cytochrome b5-like heme/steroid binding domain
superfamily: Cytochrome b5-like heme/steroid binding domain
family: Cytochrome b5
domain: Cytochrome b5
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.97  E-value=2.9e-32  Score=180.19  Aligned_cols=82  Identities=52%  Similarity=0.901  Sum_probs=78.3

Q ss_pred             CCCccCHHHHhcccCCCCeEEEEcCEEeeccccccccCcchhHhhhhcCCCcchhhhhcCCChHHHHhhhhCeEEEecCC
Q 032697            5 DGKVFTLAEVSDHNNMKDCWLIINGKVYDVTKFLEDHPGGDEVLLSATGKDATDDFEDVGHSPSAREMMDQYYVGEIDVS   84 (135)
Q Consensus         5 ~~~~~t~~ev~~h~~~~~~wvvi~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~l~~~~IG~l~~~   84 (135)
                      ..+.||++||++|++.++|||+|+|+|||||+|+..||||.++|+.++|+|+|+.|+.++||..|+++|++|+||+|.++
T Consensus         3 ~~k~yt~~Ev~~H~~~~d~Wvii~g~VYDvT~f~~~HPGG~~~i~~~aG~D~T~~F~~~~hs~~a~~~l~~~~IG~l~~~   82 (88)
T d1cyoa_           3 AVKYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPD   82 (88)
T ss_dssp             SCCEECHHHHTTCEETTEEEEEETTEEEECTTTTTTCTTCSHHHHHHTTSBCHHHHHHTTCCHHHHHHHTTTEEEEECGG
T ss_pred             ccccccHHHHHhhCCCCCeEEEECCEEEecchhhcccCCchHHHHHHcCCchHHHHHHHCCCHHHHHHHHcCccEEECcc
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999865


Q ss_pred             CC
Q 032697           85 TI   86 (135)
Q Consensus        85 ~~   86 (135)
                      +.
T Consensus        83 ~~   84 (88)
T d1cyoa_          83 DR   84 (88)
T ss_dssp             GG
T ss_pred             cc
Confidence            54
>d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} Back     information, alignment and structure
>d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure