Citrus Sinensis ID: 032698

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MGVSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAVSFRLRFQFSPTKEATN
cccHHHHHHHHHHHHHHHHHHHHccccccEEcHHHHHHHHHcccEEEEcccHHHHHccccccccEEcccccccccccccccHHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHccccEEEEEccccccccc
ccHHHHHHHHHHHHHHHHHHHHcccccccEccHHHHHHHHHcccEEEEEccHHHHHcccccccEEEEccEEccccccccccHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEcccHHccc
MGVSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLEsgygyldvrtaeefKEGHVDAakifnipymfntpegrvknpdFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAVSFRLrfqfsptkeatn
MGVSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMfntpegrvknPDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAVSFRLrfqfsptkeatn
MGVSRNWVTflrglfllllICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAVSFRLRFQFSPTKEATN
****RNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAVSFRLRFQF********
****RNWVTFLRGLFLLLLICRSSGA*VITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAVSFRLRFQFSPT*****
MGVSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAVSFRLRFQFSPTKEATN
*GVSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAVSFRLRFQFSPT*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVSRNWVTFLRGLFLLLLICRSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAVSFRLRFQFSPTKEATN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
Q9FKW8136 Thiosulfate sulfurtransfe yes no 0.725 0.720 0.602 2e-29
F4IPI4156 Rhodanese-like domain-con no no 0.8 0.692 0.5 1e-28
Q8RUD6169 Rhodanese-like domain-con no no 0.651 0.520 0.555 2e-21
Q39129120 Thiosulfate sulfurtransfe no no 0.644 0.725 0.516 8e-19
P27626183 Senescence-associated pro N/A no 0.644 0.475 0.460 2e-18
Q38853182 Rhodanese-like domain-con no no 0.644 0.478 0.460 5e-18
O48529234 Rhodanese-like domain-con no no 0.651 0.376 0.293 0.0001
>sp|Q9FKW8|STR18_ARATH Thiosulfate sulfurtransferase 18 OS=Arabidopsis thaliana GN=STR18 PE=1 SV=1 Back     alignment and function desciption
 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (77%)

Query: 27  EVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLK 86
           EV++VDV  AK LL+SG+ YLDVRT +EF+ GH +AAKI NIPYM NTP+GRVKN +FL+
Sbjct: 13  EVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLE 72

Query: 87  KVRSLCKEEDRLVVGCQSGARSLHATADLLGAVSFRLR 124
           +V SL    D ++VGCQSGARSL AT +L+ A   ++R
Sbjct: 73  QVSSLLNPADDILVGCQSGARSLKATTELVAAGYKKVR 110
Catalyzes the transfer of a sulfur ion from a donor to cyanide or to other thiol compounds. Substrate preference is thiosulfate > 3-mercaptopyruvate.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 8EC: .EC: 1EC: .EC: 1
>sp|F4IPI4|STR17_ARATH Rhodanese-like domain-containing protein 17 OS=Arabidopsis thaliana GN=STR17 PE=2 SV=1 Back     alignment and function description
>sp|Q8RUD6|STR19_ARATH Rhodanese-like domain-containing protein 19, mitochondrial OS=Arabidopsis thaliana GN=STR19 PE=2 SV=1 Back     alignment and function description
>sp|Q39129|STR16_ARATH Thiosulfate sulfurtransferase 16, chloroplastic OS=Arabidopsis thaliana GN=STR16 PE=1 SV=2 Back     alignment and function description
>sp|P27626|DIN1_RAPSA Senescence-associated protein DIN1 OS=Raphanus sativus GN=DIN1 PE=2 SV=1 Back     alignment and function description
>sp|Q38853|STR15_ARATH Rhodanese-like domain-containing protein 15, chloroplastic OS=Arabidopsis thaliana GN=STR15 PE=2 SV=1 Back     alignment and function description
>sp|O48529|STR9_ARATH Rhodanese-like domain-containing protein 9, chloroplastic OS=Arabidopsis thaliana GN=STR9 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
224133664134 predicted protein [Populus trichocarpa] 0.718 0.723 0.752 1e-37
255577542 577 zinc finger protein, putative [Ricinus c 0.740 0.173 0.76 4e-37
356559276157 PREDICTED: senescence-associated protein 0.703 0.605 0.715 6e-35
356496631149 PREDICTED: thiosulfate sulfurtransferase 0.785 0.711 0.636 3e-34
358248854149 uncharacterized protein LOC100803436 pre 0.785 0.711 0.645 3e-33
357518001131 Thiosulfate sulfurtransferase [Medicago 0.711 0.732 0.677 4e-32
351722436158 uncharacterized protein LOC100305809 [Gl 0.703 0.601 0.673 5e-32
357483815145 Thiosulfate sulfurtransferase [Medicago 0.859 0.8 0.589 1e-31
388521019150 unknown [Lotus japonicus] 0.866 0.78 0.601 8e-31
388515829152 unknown [Lotus japonicus] 0.711 0.631 0.666 8e-31
>gi|224133664|ref|XP_002327650.1| predicted protein [Populus trichocarpa] gi|222836735|gb|EEE75128.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 86/97 (88%)

Query: 22  RSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKN 81
           +S+GAEV+TVDV+A K LLESGY YLDVRT EE+ +GHVD  KIFNIPY+FNTPEGRVKN
Sbjct: 6   KSTGAEVVTVDVKATKGLLESGYTYLDVRTVEEYNKGHVDGEKIFNIPYLFNTPEGRVKN 65

Query: 82  PDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGA 118
           P+FLK+V  +CKEED+L+VGCQSG RSL+ATADLL A
Sbjct: 66  PNFLKEVSGVCKEEDKLLVGCQSGVRSLYATADLLSA 102

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255577542|ref|XP_002529649.1| zinc finger protein, putative [Ricinus communis] gi|223530875|gb|EEF32736.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356559276|ref|XP_003547926.1| PREDICTED: senescence-associated protein DIN1-like [Glycine max] Back     alignment and taxonomy information
>gi|356496631|ref|XP_003517169.1| PREDICTED: thiosulfate sulfurtransferase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|358248854|ref|NP_001240207.1| uncharacterized protein LOC100803436 precursor [Glycine max] gi|255638114|gb|ACU19371.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357518001|ref|XP_003629289.1| Thiosulfate sulfurtransferase [Medicago truncatula] gi|355523311|gb|AET03765.1| Thiosulfate sulfurtransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|351722436|ref|NP_001236988.1| uncharacterized protein LOC100305809 [Glycine max] gi|255626667|gb|ACU13678.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357483815|ref|XP_003612194.1| Thiosulfate sulfurtransferase [Medicago truncatula] gi|355513529|gb|AES95152.1| Thiosulfate sulfurtransferase [Medicago truncatula] gi|388513883|gb|AFK45003.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388521019|gb|AFK48571.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388515829|gb|AFK45976.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
TAIR|locus:2156882138 STR18 "AT5G66170" [Arabidopsis 0.696 0.681 0.638 8.2e-28
TAIR|locus:2827795156 AT2G17850 "AT2G17850" [Arabido 0.703 0.608 0.568 3.2e-26
TAIR|locus:505006261169 AT2G21045 [Arabidopsis thalian 0.651 0.520 0.555 1.9e-21
UNIPROTKB|B2C7Y6185 NRIP1 "Chloroplast N receptor- 0.644 0.470 0.505 2.2e-18
TAIR|locus:2156937120 STR16 "AT5G66040" [Arabidopsis 0.644 0.725 0.516 4.6e-18
TAIR|locus:2128038182 SEN1 "AT4G35770" [Arabidopsis 0.644 0.478 0.471 1.2e-17
TAIR|locus:2059999234 AT2G42220 "AT2G42220" [Arabido 0.318 0.183 0.409 4.9e-06
TAIR|locus:2156882 STR18 "AT5G66170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 311 (114.5 bits), Expect = 8.2e-28, P = 8.2e-28
 Identities = 60/94 (63%), Positives = 75/94 (79%)

Query:    27 EVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLK 86
             EV++VDV  AK LL+SG+ YLDVRT +EF+ GH +AAKI NIPYM NTP+GRVKN +FL+
Sbjct:    13 EVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLE 72

Query:    87 KVRSLCKEEDRLVVGCQSGARSLHATADLLGAVS 120
             +V SL    D ++VGCQSGARSL AT +L+ AVS
Sbjct:    73 QVSSLLNPADDILVGCQSGARSLKATTELVAAVS 106
GO:0007568 "aging" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0004792 "thiosulfate sulfurtransferase activity" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
TAIR|locus:2827795 AT2G17850 "AT2G17850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006261 AT2G21045 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B2C7Y6 NRIP1 "Chloroplast N receptor-interacting protein 1" [Nicotiana benthamiana (taxid:4100)] Back     alignment and assigned GO terms
TAIR|locus:2156937 STR16 "AT5G66040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128038 SEN1 "AT4G35770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059999 AT2G42220 "AT2G42220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FKW8STR18_ARATH2, ., 8, ., 1, ., 10.60200.72590.7205yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.8.1.10.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
PLN02160136 PLN02160, PLN02160, thiosulfate sulfurtransferase 4e-41
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 2e-09
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 1e-08
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 1e-08
cd01522117 cd01522, RHOD_1, Member of the Rhodanese Homology 6e-07
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 1e-05
cd01519106 cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom 2e-04
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 2e-04
cd01449118 cd01449, TST_Repeat_2, Thiosulfate sulfurtransfera 3e-04
PRK07411390 PRK07411, PRK07411, hypothetical protein; Validate 4e-04
>gnl|CDD|177819 PLN02160, PLN02160, thiosulfate sulfurtransferase Back     alignment and domain information 
 Score =  133 bits (335), Expect = 4e-41
 Identities = 59/98 (60%), Positives = 76/98 (77%)

Query: 27  EVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLK 86
           EV++VDV  AK LL+SG+ YLDVRT +EF+ GH +AAKI NIPYM NTP+GRVKN +FL+
Sbjct: 13  EVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLE 72

Query: 87  KVRSLCKEEDRLVVGCQSGARSLHATADLLGAVSFRLR 124
           +V SL    D ++VGCQSGARSL AT +L+ A   ++R
Sbjct: 73  QVSSLLNPADDILVGCQSGARSLKATTELVAAGYKKVR 110

Length = 136
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|238780 cd01522, RHOD_1, Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238726 cd01449, TST_Repeat_2, Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.86
PLN02160136 thiosulfate sulfurtransferase 99.84
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.84
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.84
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.84
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.83
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.82
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.82
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.81
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.81
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.81
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.8
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.8
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.8
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.78
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.78
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.77
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.76
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.76
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.76
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.75
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.75
PRK01415247 hypothetical protein; Validated 99.74
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.74
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.73
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.72
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.71
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 99.71
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.71
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.71
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.71
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.7
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.7
PRK05320257 rhodanese superfamily protein; Provisional 99.69
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.69
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.69
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.68
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.66
PLN02723 320 3-mercaptopyruvate sulfurtransferase 99.66
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.66
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.65
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.64
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.64
PRK07411390 hypothetical protein; Validated 99.62
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.6
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.6
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.6
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.59
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.59
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.58
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.54
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.51
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.51
COG1054308 Predicted sulfurtransferase [General function pred 99.44
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.44
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 99.01
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 98.93
KOG1529 286 consensus Mercaptopyruvate sulfurtransferase/thios 98.74
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.47
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 98.43
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 98.34
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 98.14
COG2603 334 Predicted ATPase [General function prediction only 97.79
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 97.06
PLN02727 986 NAD kinase 96.94
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 96.68
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 96.18
COG3453130 Uncharacterized protein conserved in bacteria [Fun 96.03
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 95.35
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 95.23
KOG1093725 consensus Predicted protein kinase (contains TBC a 93.92
PTZ00242166 protein tyrosine phosphatase; Provisional 92.21
PRK12361 547 hypothetical protein; Provisional 91.55
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 90.81
PTZ00393241 protein tyrosine phosphatase; Provisional 82.34
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.86  E-value=2.6e-21  Score=129.29  Aligned_cols=110  Identities=39%  Similarity=0.593  Sum_probs=97.6

Q ss_pred             hhhcCCCcceeCHHHHHHHhhCC-CeEEecCChHHHhcCCCCCCceeCeeccccCCCCCCCChHHHHHHHhh-ccCCCcE
Q 032698           21 CRSSGAEVITVDVRAAKNLLESG-YGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSL-CKEEDRL   98 (135)
Q Consensus        21 ~~~~~~~~~~is~~el~~~l~~~-~~iIDvR~~~e~~~ghIpgA~~~nip~~~~~~~~~~~~~~~~~~~~~~-~~~~~~v   98 (135)
                      +..+......++.++++.+++.+ .++||||+|+||.+||+|.+  +|||+........+.+++|.+.++.. .+.++.|
T Consensus        15 ~~~~~~~~~sv~~~qvk~L~~~~~~~llDVRepeEfk~gh~~~s--iNiPy~~~~~~~~l~~~eF~kqvg~~kp~~d~ei   92 (136)
T KOG1530|consen   15 FSKKASNPQSVSVEQVKNLLQHPDVVLLDVREPEEFKQGHIPAS--INIPYMSRPGAGALKNPEFLKQVGSSKPPHDKEI   92 (136)
T ss_pred             hhhccCCcEEEEHHHHHHHhcCCCEEEEeecCHHHhhccCCcce--EeccccccccccccCCHHHHHHhcccCCCCCCcE
Confidence            34455667889999999999986 89999999999999999999  99999877777888899999999887 5667799


Q ss_pred             EEEcCCCcchHHHHHHHHHhCCCceEeecCCCccc
Q 032698           99 VVGCQSGARSLHATADLLGAVSFRLRFQFSPTKEA  133 (135)
Q Consensus        99 vlyC~~G~~a~~~~~~l~~~gG~~~~~~~~~~~~~  133 (135)
                      |++|.+|.|+-.+...+... ||+++-+|+|+|-|
T Consensus        93 If~C~SG~Rs~~A~~~l~s~-Gyknv~ny~Gs~~~  126 (136)
T KOG1530|consen   93 IFGCASGVRSLKATKILVSA-GYKNVGNYPGSYLA  126 (136)
T ss_pred             EEEeccCcchhHHHHHHHHc-CcccccccCccHHH
Confidence            99999999999999988775 99999999999854

>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1tq1_A129 Solution Structure Of At5g66040, A Putative Protein 7e-19
>pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana Length = 129 Back     alignment and structure 
Iteration: 1

 Score = 89.0 bits (219), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/89 (50%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
Query: 30  TVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVR 89
           +V V  A +LL +G+ YLDVRT EEF +GH  A    N+PYM     G  KN DFL++V 
Sbjct: 19  SVSVTVAHDLLLAGHRYLDVRTPEEFSQGH--ACGAINVPYMNRGASGMSKNTDFLEQVS 76
Query: 90  SLCKEEDRLVVGCQSGARSLHATADLLGA 118
           S   + D ++VGCQSG RS+ AT DLL A
Sbjct: 77  SHFGQSDNIIVGCQSGGRSIKATTDLLHA 105

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1tq1_A129 AT5G66040, senescence-associated family protein; C 4e-27
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 5e-13
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 1e-12
1vee_A134 Proline-rich protein family; hypothetical protein, 9e-11
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 9e-11
3foj_A100 Uncharacterized protein; protein SSP1007, structur 1e-10
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 1e-10
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 2e-10
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 3e-10
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 3e-10
2jtq_A85 Phage shock protein E; solution structure rhodanes 8e-10
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 9e-10
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 2e-09
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 8e-09
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 2e-08
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 6e-08
3r2u_A466 Metallo-beta-lactamase family protein; structural 2e-07
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 4e-07
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 4e-07
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 6e-06
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 1e-05
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 2e-05
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 2e-04
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 6e-06
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 9e-06
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 3e-05
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 5e-05
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 8e-05
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 9e-05
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 2e-04
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 4e-04
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
 Score = 96.7 bits (241), Expect = 4e-27
 Identities = 45/89 (50%), Positives = 57/89 (64%), Gaps = 2/89 (2%)

Query: 30  TVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVR 89
           +V V  A +LL +G+ YLDVRT EEF +GH   A   N+PYM     G  KN DFL++V 
Sbjct: 19  SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAI--NVPYMNRGASGMSKNTDFLEQVS 76

Query: 90  SLCKEEDRLVVGCQSGARSLHATADLLGA 118
           S   + D ++VGCQSG RS+ AT DLL A
Sbjct: 77  SHFGQSDNIIVGCQSGGRSIKATTDLLHA 105
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Length = 423 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Length = 271 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Length = 285 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Length = 318 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.88
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.88
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.88
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.87
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.87
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.87
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.86
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.86
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.84
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.83
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.83
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.83
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.82
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.82
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.82
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.82
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.81
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.81
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.78
1vee_A134 Proline-rich protein family; hypothetical protein, 99.77
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.77
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.77
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.77
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.76
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.76
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.75
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.74
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.74
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.74
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.73
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.73
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.73
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.73
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.73
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.73
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.72
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.72
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.72
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.71
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 99.71
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.7
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 99.7
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.69
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 99.69
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.69
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.69
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.68
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.67
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.67
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.67
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.66
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.66
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.65
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.64
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 99.62
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.62
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.57
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.55
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.54
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.53
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.52
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.52
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.47
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.3
2f46_A156 Hypothetical protein; structural genomics, joint c 98.38
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 97.33
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 96.65
1xri_A151 AT1G05000; structural genomics, protein structure 96.62
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 96.43
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 96.35
1ywf_A 296 Phosphotyrosine protein phosphatase PTPB; four str 95.91
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 95.66
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 95.63
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 95.59
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 95.48
2hcm_A164 Dual specificity protein phosphatase; structural g 95.43
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 95.41
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 95.28
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 94.75
2oud_A177 Dual specificity protein phosphatase 10; A central 94.74
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 94.62
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 94.52
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 94.26
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 93.81
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 93.74
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 93.73
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 93.19
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 92.98
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 92.48
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 92.39
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 92.09
2q05_A195 Late protein H1, dual specificity protein phosphat 91.51
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 91.26
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 89.72
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 89.57
3emu_A161 Leucine rich repeat and phosphatase domain contain 89.51
1v8c_A168 MOAD related protein; riken structural genomics/pr 89.27
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 89.01
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 88.91
3cm3_A176 Late protein H1, dual specificity protein phosphat 88.55
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 86.46
2hxp_A155 Dual specificity protein phosphatase 9; human phos 83.5
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
Probab=99.88  E-value=9.5e-23  Score=133.04  Aligned_cols=92  Identities=22%  Similarity=0.291  Sum_probs=81.1

Q ss_pred             CcceeCHHHHHHHhhC-CCeEEecCChHHHhcCCCCCCceeCeeccccCCCCCCCChHHHHHHHhhccCCCcEEEEcCCC
Q 032698           27 EVITVDVRAAKNLLES-GYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQSG  105 (135)
Q Consensus        27 ~~~~is~~el~~~l~~-~~~iIDvR~~~e~~~ghIpgA~~~nip~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvlyC~~G  105 (135)
                      ..+.|+++++.+.+++ +.+|||||++.||..||||||  +|+|+.           ++...+.++ +++++||+||.+|
T Consensus         3 ~~~~i~~~~l~~~~~~~~~~liDvR~~~e~~~ghIpgA--~~ip~~-----------~l~~~~~~l-~~~~~ivvyc~~g   68 (108)
T 1gmx_A            3 QFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQA--FHLTND-----------TLGAFMRDN-DFDTPVMVMCYHG   68 (108)
T ss_dssp             SCEEECHHHHHHHHHTTCCEEEECSCHHHHHHCEETTC--EECCHH-----------HHHHHHHHS-CTTSCEEEECSSS
T ss_pred             cccccCHHHHHHHHhCCCCEEEEcCCHHHHHhCCCccC--EeCCHH-----------HHHHHHHhc-CCCCCEEEEcCCC
Confidence            4678999999999987 579999999999999999999  999985           676666665 8999999999999


Q ss_pred             cchHHHHHHHHHhCCCceEeecCCCccc
Q 032698          106 ARSLHATADLLGAVSFRLRFQFSPTKEA  133 (135)
Q Consensus       106 ~~a~~~~~~l~~~gG~~~~~~~~~~~~~  133 (135)
                      .++..+++.|.+. ||++++.|.||+++
T Consensus        69 ~rs~~a~~~L~~~-G~~~v~~l~GG~~~   95 (108)
T 1gmx_A           69 NSSKGAAQYLLQQ-GYDVVYSIDGGFEA   95 (108)
T ss_dssp             SHHHHHHHHHHHH-TCSSEEEETTHHHH
T ss_pred             chHHHHHHHHHHc-CCceEEEecCCHHH
Confidence            9999999988776 99999999998764
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 3e-14
d1yt8a4130 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase 0.001
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 0.001
d1s0aa_ 429 c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxonona 0.001
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 0.002
d1hzma_154 c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat 0.003
d1e0ca2136 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte 0.003
d1c25a_161 c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 0.004
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 62.6 bits (151), Expect = 3e-14
 Identities = 43/86 (50%), Positives = 55/86 (63%), Gaps = 2/86 (2%)

Query: 30  TVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVR 89
           +V V  A +LL +G+ YLDVRT EEF +GH   A   N+PYM     G  KN DFL++V 
Sbjct: 9   SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAI--NVPYMNRGASGMSKNTDFLEQVS 66

Query: 90  SLCKEEDRLVVGCQSGARSLHATADL 115
           S   + D ++VGCQSG RS+ AT DL
Sbjct: 67  SHFGQSDNIIVGCQSGGRSIKATTDL 92
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Length = 429 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.88
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.88
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.85
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.84
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.84
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.84
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.82
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.81
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.81
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.79
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.79
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.77
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.75
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.73
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.71
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.68
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.64
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.6
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.57
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.46
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 96.73
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 93.82
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 92.96
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 91.44
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 89.02
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 87.62
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 85.25
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 83.49
d1c4oa2 174 Nucleotide excision repair enzyme UvrB {Thermus th 82.67
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Sulfurtransferase GlpE
species: Escherichia coli [TaxId: 562]

Probab=99.88  E-value=3.3e-23  Score=134.13  Aligned_cols=93  Identities=22%  Similarity=0.286  Sum_probs=83.2

Q ss_pred             CCcceeCHHHHHHHhhC-CCeEEecCChHHHhcCCCCCCceeCeeccccCCCCCCCChHHHHHHHhhccCCCcEEEEcCC
Q 032698           26 AEVITVDVRAAKNLLES-GYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQS  104 (135)
Q Consensus        26 ~~~~~is~~el~~~l~~-~~~iIDvR~~~e~~~ghIpgA~~~nip~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvlyC~~  104 (135)
                      ..++.||++|+.+.+++ +.+|||+|++.||..||||||  +|+|..           ++...+.++ +++++||+||.+
T Consensus         2 ~~~~~Is~~e~~~~l~~~~~~liDvR~~~e~~~ghI~gA--~~ip~~-----------~l~~~~~~~-~~~~~ivv~c~~   67 (108)
T d1gmxa_           2 DQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQA--FHLTND-----------TLGAFMRDN-DFDTPVMVMCYH   67 (108)
T ss_dssp             CSCEEECHHHHHHHHHTTCCEEEECSCHHHHHHCEETTC--EECCHH-----------HHHHHHHHS-CTTSCEEEECSS
T ss_pred             CCCCEeCHHHHHHHHHCCCeEEEECCCHHHHHhcCCCCc--ccccch-----------hHHHHhhhc-cccCcccccCCC
Confidence            34678999999999987 589999999999999999999  999985           777777666 899999999999


Q ss_pred             CcchHHHHHHHHHhCCCceEeecCCCccc
Q 032698          105 GARSLHATADLLGAVSFRLRFQFSPTKEA  133 (135)
Q Consensus       105 G~~a~~~~~~l~~~gG~~~~~~~~~~~~~  133 (135)
                      |.++..++.+|.+. ||+++|.|.||.++
T Consensus        68 g~rs~~~a~~L~~~-G~~~v~~l~GG~~~   95 (108)
T d1gmxa_          68 GNSSKGAAQYLLQQ-GYDVVYSIDGGFEA   95 (108)
T ss_dssp             SSHHHHHHHHHHHH-TCSSEEEETTHHHH
T ss_pred             ChHHHHHHHHHHHc-CCCCEEEEcChHHH
Confidence            99999999988876 99999999998764
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure