Citrus Sinensis ID: 032728

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYRE
cccccccccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccc
ccccEEEEccEEEEEEEEEEEccccccccHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHccccccccHHHHHHcccEEcccccEEccccccHHHHHHHHHHHHcccccHHHHHHHcc
MICFWFCVIETKLFVNVQVYvdgmpalsskERKATLREFYAIIYPSLRQLESEFselednskrdqcseissrKRVEERRKLsdkdldrndecgicmenctkmvlpncghslcvncfhdwnarSQSCLFAVAAYRE
MICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFselednskrdqcseissrkrveerrklsdkdldrndecGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYRE
MICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYRE
*ICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLR******************************************ECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAY**
*ICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLES************************************NDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYR*
MICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLESE********************************LDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYRE
*ICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRK******KLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYR*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MICFWFCVIETKLFVNVQVYVDGMPALSSKERKATLREFYAIIYPSxxxxxxxxxxxxxxxxxxxxxEISSRKRVEERRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
297738323 247 unnamed protein product [Vitis vinifera] 0.822 0.449 0.756 2e-46
359473694 255 PREDICTED: uncharacterized protein LOC10 0.822 0.435 0.756 2e-46
255547924 253 protein binding protein, putative [Ricin 0.822 0.438 0.756 3e-44
224110810 250 predicted protein [Populus trichocarpa] 0.814 0.44 0.729 3e-42
356567396 243 PREDICTED: uncharacterized protein LOC10 0.762 0.423 0.621 5e-33
449512974 243 PREDICTED: uncharacterized protein LOC10 0.762 0.423 0.594 2e-31
449435031 243 PREDICTED: uncharacterized protein LOC10 0.762 0.423 0.594 2e-31
115471529 253 Os07g0275300 [Oryza sativa Japonica Grou 0.814 0.434 0.576 2e-30
38175465209 zinc finger (C3HC4-type RING finger) pro 0.814 0.526 0.576 2e-30
294464236 280 unknown [Picea sitchensis] 0.822 0.396 0.549 4e-30
>gi|297738323|emb|CBI27524.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/111 (75%), Positives = 100/111 (90%)

Query: 18  QVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEE 77
           +VYVDGMP +SS+ERKATLREFYA+IYPSLRQL  +F ELED +KR +C+E+ SRKRVE+
Sbjct: 78  KVYVDGMPTMSSQERKATLREFYAVIYPSLRQLGGQFIELEDTNKRSRCTEVLSRKRVED 137

Query: 78  RRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLF 128
           RRK+SDK++DR+DECGICME CTKMVLPNCGHS+C+ CFHDWN RSQSC F
Sbjct: 138 RRKVSDKEIDRDDECGICMETCTKMVLPNCGHSMCICCFHDWNVRSQSCPF 188

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359473694|ref|XP_002272517.2| PREDICTED: uncharacterized protein LOC100245965 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255547924|ref|XP_002515019.1| protein binding protein, putative [Ricinus communis] gi|223546070|gb|EEF47573.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224110810|ref|XP_002315643.1| predicted protein [Populus trichocarpa] gi|222864683|gb|EEF01814.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356567396|ref|XP_003551906.1| PREDICTED: uncharacterized protein LOC100805014 [Glycine max] Back     alignment and taxonomy information
>gi|449512974|ref|XP_004164193.1| PREDICTED: uncharacterized protein LOC101223953 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449435031|ref|XP_004135299.1| PREDICTED: uncharacterized protein LOC101207887 [Cucumis sativus] Back     alignment and taxonomy information
>gi|115471529|ref|NP_001059363.1| Os07g0275300 [Oryza sativa Japonica Group] gi|113610899|dbj|BAF21277.1| Os07g0275300 [Oryza sativa Japonica Group] gi|222636824|gb|EEE66956.1| hypothetical protein OsJ_23829 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|38175465|dbj|BAC84396.2| zinc finger (C3HC4-type RING finger) protein-like [Oryza sativa Japonica Group] gi|50509639|dbj|BAD31482.1| zinc finger (C3HC4-type RING finger) protein-like [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|294464236|gb|ADE77632.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
TAIR|locus:2149750242 AIRP2 "ABA Insensitive RING Pr 0.822 0.458 0.441 4e-26
TAIR|locus:505006703242 AT5G58787 "AT5G58787" [Arabido 0.785 0.438 0.458 3.6e-25
TAIR|locus:505006120260 AT1G13195 [Arabidopsis thalian 0.903 0.469 0.456 3.6e-25
TAIR|locus:2024026251 AT1G24440 [Arabidopsis thalian 0.851 0.458 0.441 4.2e-24
DICTYBASE|DDB_G0292408213 DDB_G0292408 "RING finger prot 0.777 0.492 0.285 3.7e-07
ZFIN|ZDB-GENE-040625-71222 rnf141 "ring finger protein 14 0.688 0.418 0.299 6e-06
UNIPROTKB|O76064485 RNF8 "E3 ubiquitin-protein lig 0.844 0.235 0.258 2.1e-05
UNIPROTKB|Q5ZM74230 RNF141 "RING finger protein 14 0.266 0.156 0.459 2.4e-05
UNIPROTKB|I3LUY7135 I3LUY7 "Uncharacterized protei 0.496 0.496 0.304 3e-05
UNIPROTKB|Q32L15230 RNF141 "RING finger protein 14 0.311 0.182 0.395 3.1e-05
TAIR|locus:2149750 AIRP2 "ABA Insensitive RING Protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 295 (108.9 bits), Expect = 4.0e-26, P = 4.0e-26
 Identities = 49/111 (44%), Positives = 77/111 (69%)

Query:    18 QVYVDGMPALSSKERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEE 77
             + YVDG   +S  ERK ++REFY +++PSL QL    +++E+  +++ C +   +K   +
Sbjct:    72 KAYVDGKTTMSLHERKTSIREFYDVLFPSLLQLHGGITDVEERKQKEICDKRYRKKDRTD 131

Query:    78 RRKLSDKDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLF 128
             + K+S+ DL+R +ECGIC+E   K+VLP C HS+C+NC+ +W ARSQSC F
Sbjct:   132 KGKMSEIDLEREEECGICLEIRNKVVLPTCNHSMCINCYRNWRARSQSCPF 182
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=IDA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
TAIR|locus:505006703 AT5G58787 "AT5G58787" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006120 AT1G13195 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024026 AT1G24440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292408 DDB_G0292408 "RING finger protein 141" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-71 rnf141 "ring finger protein 141" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O76064 RNF8 "E3 ubiquitin-protein ligase RNF8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM74 RNF141 "RING finger protein 141" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LUY7 I3LUY7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q32L15 RNF141 "RING finger protein 141" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
cd0016245 cd00162, RING, RING-finger (Really Interesting New 8e-04
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 0.001
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 0.002
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 0.004
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 0.004
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information 
 Score = 35.1 bits (81), Expect = 8e-04
 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 91  ECGICMENCTK-MVLPNCGHSLCVNCFHDWNARSQSC 126
           EC IC+E   + +VL  CGH  C +C   W    ++ 
Sbjct: 1   ECPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNT 37

Length = 45
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.33
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.32
PHA02929238 N1R/p28-like protein; Provisional 99.31
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.3
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.29
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.25
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.25
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.24
KOG1002 791 consensus Nucleotide excision repair protein RAD16 99.17
PHA02926242 zinc finger-like protein; Provisional 99.14
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.13
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.1
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.07
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.06
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.05
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.01
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.99
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.94
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.91
PF1463444 zf-RING_5: zinc-RING finger domain 98.91
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.85
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.82
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.78
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.76
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.75
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.65
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.64
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.6
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.58
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.56
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.54
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.53
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 98.51
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 98.49
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.43
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.3
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 98.28
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.27
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.22
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 98.01
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.0
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.93
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.92
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.84
COG52191525 Uncharacterized conserved protein, contains RING Z 97.79
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.75
COG5152259 Uncharacterized conserved protein, contains RING a 97.75
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.68
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.68
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.67
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.64
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.61
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.55
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.53
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.44
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 97.3
KOG2660 331 consensus Locus-specific chromosome binding protei 97.3
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.09
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.05
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.04
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 96.96
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.84
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 96.67
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.63
KOG3002 299 consensus Zn finger protein [General function pred 96.52
PHA03096284 p28-like protein; Provisional 96.48
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.46
KOG4739 233 consensus Uncharacterized protein involved in syna 96.25
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.11
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.1
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.06
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.65
PHA02825 162 LAP/PHD finger-like protein; Provisional 95.65
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.64
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.56
PF07800 162 DUF1644: Protein of unknown function (DUF1644); In 95.56
PF04641260 Rtf2: Rtf2 RING-finger 95.5
PHA02862 156 5L protein; Provisional 95.35
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.17
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.0
COG5222 427 Uncharacterized conserved protein, contains RING Z 94.78
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 94.61
COG5175 480 MOT2 Transcriptional repressor [Transcription] 94.57
PF10272358 Tmpp129: Putative transmembrane protein precursor; 94.43
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 94.35
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 93.34
KOG4367 699 consensus Predicted Zn-finger protein [Function un 93.34
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 93.14
KOG4445 368 consensus Uncharacterized conserved protein, conta 92.5
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 92.39
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 92.36
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 92.26
KOG0298 1394 consensus DEAD box-containing helicase-like transc 91.8
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 91.31
KOG1940276 consensus Zn-finger protein [General function pred 90.94
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 90.91
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 89.84
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 88.87
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 88.87
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 88.84
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 88.63
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 88.54
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 88.51
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 87.74
KOG03091081 consensus Conserved WD40 repeat-containing protein 85.74
KOG3053 293 consensus Uncharacterized conserved protein [Funct 85.28
KOG0269839 consensus WD40 repeat-containing protein [Function 84.43
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 83.19
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 82.21
KOG3899381 consensus Uncharacterized conserved protein [Funct 81.38
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 81.36
KOG3039 303 consensus Uncharacterized conserved protein [Funct 81.06
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information 
Probab=99.33  E-value=6.4e-13  Score=98.87  Aligned_cols=51  Identities=25%  Similarity=0.686  Sum_probs=42.9

Q ss_pred             cCCCCCCcccccccCCcccccCCCCCccchhhHHHHhcc----------------CCCCcccccccc
Q 032728           84 KDLDRNDECGICMENCTKMVLPNCGHSLCVNCFHDWNAR----------------SQSCLFAVAAYR  134 (135)
Q Consensus        84 ~~~~~~~~C~IC~~~~~~~~l~~CgH~FC~~Ci~~~~~~----------------~~~CP~CR~~i~  134 (135)
                      .+..++..|+||++...+++++.|||.||..||.+|+..                ...||+||.++.
T Consensus        13 ~~~~~~~~CpICld~~~dPVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is   79 (193)
T PLN03208         13 VDSGGDFDCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVS   79 (193)
T ss_pred             ccCCCccCCccCCCcCCCcEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCC
Confidence            344567799999999989888889999999999999742                358999999874

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-14
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-11
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-10
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-05
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 8e-05
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-04
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 1e-04
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-04
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-04
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-04
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-04
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
 Score = 65.4 bits (159), Expect = 1e-14
 Identities = 26/97 (26%), Positives = 39/97 (40%), Gaps = 11/97 (11%)

Query: 30  KERKATLREFYAIIYPSLRQLESEFSELEDNSKRDQCSEISSRKRVEERRKLSDKDLDRN 89
           +E   + ++F AII    ++LE    E E    +            EE     +  L+  
Sbjct: 16  EELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQK-----------EEVLSHMNDVLENE 64

Query: 90  DECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSC 126
            +C IC E   + V  NC HS C  C ++W  R   C
Sbjct: 65  LQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIEC 101
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.51
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.5
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.49
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.49
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.49
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.48
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.48
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.47
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.46
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.46
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.46
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.44
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.44
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.44
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.43
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.42
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.42
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.42
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.42
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.41
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.41
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.41
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.41
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.4
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.4
2ect_A78 Ring finger protein 126; metal binding protein, st 99.4
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.4
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.39
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.37
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.37
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.36
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.36
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.36
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.35
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.34
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.32
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.31
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.31
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.3
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.29
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.28
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.28
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.27
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.27
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.27
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.26
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.25
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.24
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.24
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.22
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.22
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.19
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.18
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.17
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 99.13
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.13
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.1
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.1
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.08
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.07
2ea5_A68 Cell growth regulator with ring finger domain prot 99.06
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.98
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.97
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.85
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.84
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.81
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.75
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.63
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.57
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.54
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.28
3nw0_A238 Non-structural maintenance of chromosomes element 97.37
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.7
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.53
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 92.84
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 92.27
1wil_A89 KIAA1045 protein; ring finger domain, structural g 90.63
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 88.92
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 87.61
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 86.96
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 85.19
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 84.88
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 83.74
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 82.62
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 80.78
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 80.74
2jmo_A80 Parkin; IBR, E3 ligase, zinc binding domain, RBR; 80.73
1zbd_B134 Rabphilin-3A; G protein, effector, RABCDR, synapti 80.34
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
Probab=99.51  E-value=5.3e-15  Score=103.75  Aligned_cols=47  Identities=30%  Similarity=0.690  Sum_probs=42.2

Q ss_pred             CCCcccccccCCcccccCCCCCccchhhHHHHhccCCCCcccccccc
Q 032728           88 RNDECGICMENCTKMVLPNCGHSLCVNCFHDWNARSQSCLFAVAAYR  134 (135)
Q Consensus        88 ~~~~C~IC~~~~~~~~l~~CgH~FC~~Ci~~~~~~~~~CP~CR~~i~  134 (135)
                      ++..|+||++.+.+++.++|||.||..||..|+..+..||+||.++.
T Consensus        52 ~~~~C~iC~~~~~~~~~~~CgH~fc~~Ci~~~~~~~~~CP~Cr~~~~   98 (138)
T 4ayc_A           52 NELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIK   98 (138)
T ss_dssp             HHSBCTTTCSBCSSEEEETTSCEEEHHHHHHHTTTCSBCTTTCCBCC
T ss_pred             ccCCCcccCcccCCceECCCCCCccHHHHHHHHHcCCcCCCCCCcCC
Confidence            34589999999888887789999999999999999999999999875
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2jmo_A Parkin; IBR, E3 ligase, zinc binding domain, RBR; NMR {Homo sapiens} Back     alignment and structure
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 3e-05
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 3e-05
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 5e-05
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 5e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 4e-04
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 4e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 0.003
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 37.2 bits (86), Expect = 3e-05
 Identities = 12/45 (26%), Positives = 16/45 (35%), Gaps = 4/45 (8%)

Query: 86  LDRNDECGICME----NCTKMVLPNCGHSLCVNCFHDWNARSQSC 126
           +D   EC +C+           LP CGH     C   W     +C
Sbjct: 2   MDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTC 46
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.57
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.51
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.45
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.44
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.4
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.39
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.37
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.36
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.36
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.33
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.32
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.31
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.24
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.13
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.05
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.47
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 88.24
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 87.59
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 87.28
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 86.12
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 84.86
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 84.37
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 83.23
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 81.54
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.57  E-value=7.9e-16  Score=91.11  Aligned_cols=47  Identities=26%  Similarity=0.718  Sum_probs=39.5

Q ss_pred             CCCCcccccccCCcc----cccCCCCCccchhhHHHHhccCCCCccccccc
Q 032728           87 DRNDECGICMENCTK----MVLPNCGHSLCVNCFHDWNARSQSCLFAVAAY  133 (135)
Q Consensus        87 ~~~~~C~IC~~~~~~----~~l~~CgH~FC~~Ci~~~~~~~~~CP~CR~~i  133 (135)
                      +++.+|+||++.+.+    ..++.|||.||..|+.+|++.+.+||+||+++
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i   53 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV   53 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCS
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEe
Confidence            556689999976533    24567999999999999999999999999986
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure