Citrus Sinensis ID: 032733

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPG
ccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHHHccccccccc
ccccccccccHHHHHHHHHHHHHccHHHHHcccccccHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccHHHccccccccHHHHHHHHHHHHHHHccccccccc
maateensqlfpIFILTIMALPLVPYTILKLCHAFSKKIKtihcqcsdcarsgkyRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKstsremqvfepfsilglehgasdsdIKKAYRRLSIqyhpdknpdpg
maateensqlfPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIqyhpdknpdpg
MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNlslvllwvimiiliyyiKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPG
*********LFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHG**************************
MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFS******************************STCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGA**SDIKKAYRRLSIQY*********
MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPG
*******SQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPD******
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
P14906 663 Protein translocation pro yes no 0.903 0.184 0.267 1e-12
Q5R660 761 Translocation protein SEC yes no 0.674 0.119 0.346 8e-11
Q9UGP8 760 Translocation protein SEC yes no 0.674 0.119 0.346 8e-11
Q8VHE0 760 Translocation protein SEC yes no 0.674 0.119 0.346 1e-10
Q9HGN7 611 Translocation protein sec yes no 0.881 0.194 0.325 3e-10
Q5FVM7 771 DnaJ homolog subfamily C no no 0.444 0.077 0.435 2e-09
Q80TN4 772 DnaJ homolog subfamily C no no 0.414 0.072 0.431 6e-09
Q5RCM7 782 DnaJ homolog subfamily C no no 0.444 0.076 0.419 1e-08
Q9Y2G8 782 DnaJ homolog subfamily C no no 0.444 0.076 0.419 1e-08
A4XYF5 375 Chaperone protein DnaJ OS yes no 0.244 0.088 0.606 6e-08
>sp|P14906|SEC63_YEAST Protein translocation protein SEC63 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC63 PE=1 SV=2 Back     alignment and function desciption
 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 77/153 (50%), Gaps = 31/153 (20%)

Query: 5   EENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRIS 64
           +E S+ +P FILT + + + P T+L++   F       + +  +  +S ++ + +FK ++
Sbjct: 8   DEASETWPSFILTGLLMVVGPMTLLQIYQIFFGA----NAEDGNSGKSKEFNEEVFKNLN 63

Query: 65  NFSTCS-----------------------NLSLVLLWVIMIILIYYIKSTSR----EMQV 97
              T                         N+ +++ W+++ IL+  I S         ++
Sbjct: 64  EEYTSDEIKQFRRKFDKNSNKKSKIWSRRNIIIIVGWILVAILLQRINSNDAIKDAATKL 123

Query: 98  FEPFSILGLEHGASDSDIKKAYRRLSIQYHPDK 130
           F+P+ ILG+   ASD DIK AYR+LS+++HPDK
Sbjct: 124 FDPYEILGISTSASDRDIKSAYRKLSVKFHPDK 156
Acts as component of the Sec62/63 complex which is involved in SRP-independent post-translational translocation across the endoplasmic reticulum (ER) and functions together with the Sec61 complex and KAR2 in a channel-forming translocon complex. A cycle of assembly and disassembly of Sec62/63 complex from SEC61 may govern the activity of the translocon. SEC63 may affect SEC1-polypeptide interactions by increasing the affinity of targeting pathways for SEC61 and/or by modifying SEC61 to allow more efficient polypeptide interaction. May also be involved in SRP-dependent cotranslational translocation. Is essential for cell growth and for germination.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
>sp|Q5R660|SEC63_PONAB Translocation protein SEC63 homolog OS=Pongo abelii GN=SEC63 PE=2 SV=1 Back     alignment and function description
>sp|Q9UGP8|SEC63_HUMAN Translocation protein SEC63 homolog OS=Homo sapiens GN=SEC63 PE=1 SV=2 Back     alignment and function description
>sp|Q8VHE0|SEC63_MOUSE Translocation protein SEC63 homolog OS=Mus musculus GN=Sec63 PE=1 SV=4 Back     alignment and function description
>sp|Q9HGN7|SEC63_SCHPO Translocation protein sec63 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec63 PE=1 SV=1 Back     alignment and function description
>sp|Q5FVM7|DJC16_RAT DnaJ homolog subfamily C member 16 OS=Rattus norvegicus GN=Dnajc16 PE=2 SV=1 Back     alignment and function description
>sp|Q80TN4|DJC16_MOUSE DnaJ homolog subfamily C member 16 OS=Mus musculus GN=Dnajc16 PE=1 SV=2 Back     alignment and function description
>sp|Q5RCM7|DJC16_PONAB DnaJ homolog subfamily C member 16 OS=Pongo abelii GN=DNAJC16 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y2G8|DJC16_HUMAN DnaJ homolog subfamily C member 16 OS=Homo sapiens GN=DNAJC16 PE=2 SV=3 Back     alignment and function description
>sp|A4XYF5|DNAJ_PSEMY Chaperone protein DnaJ OS=Pseudomonas mendocina (strain ymp) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
225464625 688 PREDICTED: translocation protein SEC63 h 0.992 0.194 0.850 2e-64
302143768 618 unnamed protein product [Vitis vinifera] 0.992 0.216 0.850 2e-64
449445973 685 PREDICTED: translocation protein SEC63 h 0.992 0.195 0.813 4e-60
449533991 242 PREDICTED: translocation protein SEC63 h 0.992 0.553 0.813 1e-59
255545152 682 heat shock protein binding protein, puta 0.992 0.196 0.798 4e-59
413918040 345 hypothetical protein ZEAMMB73_611252 [Ze 0.992 0.388 0.783 6e-59
224079782 685 predicted protein [Populus trichocarpa] 0.992 0.195 0.791 9e-59
356530479 685 PREDICTED: translocation protein SEC63 h 0.992 0.195 0.768 3e-58
224135305 685 predicted protein [Populus trichocarpa] 0.992 0.195 0.776 3e-58
356556432 685 PREDICTED: translocation protein SEC63 h 0.992 0.195 0.761 4e-58
>gi|225464625|ref|XP_002275958.1| PREDICTED: translocation protein SEC63 homolog [Vitis vinifera] Back     alignment and taxonomy information
 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 127/134 (94%)

Query: 1   MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIF 60
           MAA+EENS LFPIFILTIMALPLVPYTI+KLCHA S+K K+IHCQCS+C RSGKYR+SIF
Sbjct: 1   MAASEENSALFPIFILTIMALPLVPYTIMKLCHAASRKTKSIHCQCSECTRSGKYRRSIF 60

Query: 61  KRISNFSTCSNLSLVLLWVIMIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYR 120
           KRISNFSTCSNL+LVLLWV+MIIL+YYIK  S+E+Q+FEPFSILGLE GASDS+IKKAYR
Sbjct: 61  KRISNFSTCSNLTLVLLWVVMIILVYYIKHISQEIQIFEPFSILGLESGASDSEIKKAYR 120

Query: 121 RLSIQYHPDKNPDP 134
           RLSIQYHPDKNPDP
Sbjct: 121 RLSIQYHPDKNPDP 134

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302143768|emb|CBI22629.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449445973|ref|XP_004140746.1| PREDICTED: translocation protein SEC63 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|449533991|ref|XP_004173953.1| PREDICTED: translocation protein SEC63 homolog, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|255545152|ref|XP_002513637.1| heat shock protein binding protein, putative [Ricinus communis] gi|223547545|gb|EEF49040.1| heat shock protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|413918040|gb|AFW57972.1| hypothetical protein ZEAMMB73_611252 [Zea mays] Back     alignment and taxonomy information
>gi|224079782|ref|XP_002305942.1| predicted protein [Populus trichocarpa] gi|118481069|gb|ABK92488.1| unknown [Populus trichocarpa] gi|222848906|gb|EEE86453.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356530479|ref|XP_003533808.1| PREDICTED: translocation protein SEC63 homolog [Glycine max] Back     alignment and taxonomy information
>gi|224135305|ref|XP_002327614.1| predicted protein [Populus trichocarpa] gi|222836168|gb|EEE74589.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356556432|ref|XP_003546530.1| PREDICTED: translocation protein SEC63 homolog [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
TAIR|locus:2016354 687 ATERDJ2A [Arabidopsis thaliana 0.992 0.195 0.679 2.9e-44
TAIR|locus:2127373 661 ATERDJ2B [Arabidopsis thaliana 0.992 0.202 0.649 1.8e-42
SGD|S000005780 663 SEC63 "Essential subunit of Se 0.259 0.052 0.571 2.7e-10
DICTYBASE|DDB_G0286131 814 sec63 "protein transport prote 0.948 0.157 0.280 3.6e-09
MGI|MGI:1923844 357 Dnajc18 "DnaJ (Hsp40) homolog, 0.259 0.098 0.542 6.4e-09
GENEDB_PFALCIPARUM|PF13_0102 651 PF13_0102 "DNAJ-like Sec63 hom 0.311 0.064 0.547 1.8e-08
UNIPROTKB|Q8IEC8 651 PF13_0102 "DnaJ/SEC63 protein, 0.311 0.064 0.547 1.8e-08
UNIPROTKB|Q9H819 358 DNAJC18 "DnaJ homolog subfamil 0.259 0.097 0.542 2.9e-08
DICTYBASE|DDB_G0280037 411 ddj1 "heat shock protein" [Dic 0.251 0.082 0.676 3.2e-08
UNIPROTKB|Q5EA26 358 DNAJC18 "DnaJ homolog subfamil 0.259 0.097 0.542 3.7e-08
TAIR|locus:2016354 ATERDJ2A [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 468 (169.8 bits), Expect = 2.9e-44, P = 2.9e-44
 Identities = 91/134 (67%), Positives = 105/134 (78%)

Query:     1 MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIF 60
             MAA+EENS LFPIFILTIMA+PLVPYT++KL  A SKK +TIHCQC +C RSGKY++S+F
Sbjct:     1 MAASEENSALFPIFILTIMAIPLVPYTMVKLSGALSKKQRTIHCQCLECDRSGKYKRSLF 60

Query:    61 KRISNFSTCSNXXXXXXXXXXXXXXXXXKSTSREMQVFEPFSILGLEHGASDSDIKKAYR 120
             K+ISNFST SN                 K+ SRE QVF+PFSILGLE G +DS+IKKAYR
Sbjct:    61 KKISNFSTWSNLTLVLLWVVMIFLIYYTKNMSREAQVFDPFSILGLEPGVTDSEIKKAYR 120

Query:   121 RLSIQYHPDKNPDP 134
             RLSIQYHPDKNPDP
Sbjct:   121 RLSIQYHPDKNPDP 134
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0030176 "integral to endoplasmic reticulum membrane" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:2127373 ATERDJ2B [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
SGD|S000005780 SEC63 "Essential subunit of Sec63 complex" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286131 sec63 "protein transport protein SEC63" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1923844 Dnajc18 "DnaJ (Hsp40) homolog, subfamily C, member 18" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF13_0102 PF13_0102 "DNAJ-like Sec63 homologue" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IEC8 PF13_0102 "DnaJ/SEC63 protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H819 DNAJC18 "DnaJ homolog subfamily C member 18" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280037 ddj1 "heat shock protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA26 DNAJC18 "DnaJ homolog subfamily C member 18" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 1e-20
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-16
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 3e-15
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 7e-15
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 2e-13
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 6e-13
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 6e-13
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-12
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 2e-12
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 9e-12
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 6e-11
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 9e-11
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-10
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-10
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 5e-10
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 9e-10
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 1e-09
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-09
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 4e-09
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 5e-09
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 6e-09
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 7e-09
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 7e-09
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 8e-09
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 1e-08
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 1e-08
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 4e-08
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 5e-08
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 6e-08
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 8e-08
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 3e-07
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 3e-07
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 2e-06
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 3e-06
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 4e-06
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 2e-05
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 8e-05
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 3e-04
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information 
 Score = 86.2 bits (213), Expect = 1e-20
 Identities = 43/132 (32%), Positives = 72/132 (54%), Gaps = 11/132 (8%)

Query: 5   EENSQLFPIFILTIMALPLVPYTI-LKLCHAFSKKIKTIHCQCSDCARSGK--YRKSIFK 61
           +E+    P F+L+ +   ++P T  L    + SK+++ + C C  C    K   RKSIFK
Sbjct: 8   DESGLASPYFVLSGLVPVVLPMTYDLIEGPSASKELRRVRCACQGCRPKDKNVSRKSIFK 67

Query: 62  RISNFSTCSNLSLVLLWVIMIILIYYIKSTSRE-MQVFEPFSILGLEHGASDSDIKKAYR 120
                     +  ++ W+++  LI  I++   E  + F+P+ ILG++   S+ DIKK YR
Sbjct: 68  L-------RKIFTIVGWLVISYLISNIRTLKIEYRRGFDPYEILGIDQDTSERDIKKRYR 120

Query: 121 RLSIQYHPDKNP 132
            LS+++HPDK P
Sbjct: 121 MLSMKFHPDKAP 132

Length = 610
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 100.0
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.95
KOG0713 336 consensus Molecular chaperone (DnaJ superfamily) [ 99.57
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.4
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.36
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.36
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.35
PTZ00100116 DnaJ chaperone protein; Provisional 99.32
PRK14279 392 chaperone protein DnaJ; Provisional 99.3
PRK14295 389 chaperone protein DnaJ; Provisional 99.25
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.17
KOG0716 279 consensus Molecular chaperone (DnaJ superfamily) [ 99.17
KOG0715 288 consensus Molecular chaperone (DnaJ superfamily) [ 99.15
KOG0719 264 consensus Molecular chaperone (DnaJ superfamily) [ 99.14
KOG0722 329 consensus Molecular chaperone (DnaJ superfamily) [ 99.13
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.08
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.03
KOG1150 250 consensus Predicted molecular chaperone (DnaJ supe 98.96
PHA02624 647 large T antigen; Provisional 98.88
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.87
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 98.82
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 98.59
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.57
KOG0720 490 consensus Molecular chaperone (DnaJ superfamily) [ 98.52
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.08
KOG0568 342 consensus Molecular chaperone (DnaJ superfamily) [ 97.62
PRK03578 176 hscB co-chaperone HscB; Provisional 97.47
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 97.01
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.71
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 96.62
KOG0431453 consensus Auxilin-like protein and related protein 95.21
PF1344662 RPT: A repeated domain in UCH-protein 92.54
KOG3442132 consensus Uncharacterized conserved protein [Funct 91.48
COG299177 Uncharacterized protein conserved in bacteria [Fun 83.94
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.7e-42  Score=265.77  Aligned_cols=132  Identities=39%  Similarity=0.712  Sum_probs=116.1

Q ss_pred             CCccccCCCchHHHHHHHHhhhHHHHHHHHhhhcccccccccccCcchhhhhhhhhhhhhhhhcccccchhHHHHHHHHH
Q 032733            1 MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVI   80 (135)
Q Consensus         1 ~~~~DE~g~~f~~F~lt~l~~~LiP~T~~~l~~~~~~~~~~~~c~c~~c~~~~~~~~~~~~~~~~~~~~~~~~l~~~w~~   80 (135)
                      +.+|||+|++|+||+|||++++++|.||+.|++.........+|+|..|++.+++.++..++  .+++.+++++++||++
T Consensus         4 ~~eYDE~g~tf~yflls~~~~i~~P~Ty~~i~~~~~~~~~~~~c~c~~c~~~r~~~~~~~~k--~~~~~~~i~lv~~W~v   81 (230)
T KOG0721|consen    4 DYEYDESGNTFPYFLLSFLAIILLPMTYLLIPRNPEPPKRKEECQCHGCDKKRRKKAKVSPK--SISTKRKVFLVVGWAV   81 (230)
T ss_pred             ccccccccCccHHHHHHHHHHHHHHHHHHHhccccchhhhhhHHhhhhhhhhhhhhcccCcc--cchhHHHHHHHHHHHH
Confidence            46899999999999999999999999999998644444667889999999887653333222  5667789999999999


Q ss_pred             HHHHHHHHHhcCcccccCCcchhccCCCCCCHHHHHHHHHHHHHhhCCCCCCCC
Q 032733           81 MIILIYYIKSTSREMQVFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDP  134 (135)
Q Consensus        81 ~~~l~~~~~~~~~~~~~~d~y~iLgv~~~as~~eIkkaYRkLs~k~HPDK~~~~  134 (135)
                      +++++|.+.+++.+.+.+||||||||+++++++|||||||+|++||||||++++
T Consensus        82 ~~fL~y~i~~~~~~~~~fDPyEILGl~pgas~~eIKkaYR~LSik~HPDK~~~~  135 (230)
T KOG0721|consen   82 IAFLIYKIMNSRRERQKFDPYEILGLDPGASEKEIKKAYRRLSIKYHPDKQPPE  135 (230)
T ss_pred             HHHHHHHHhhhhHHhhcCCcHHhhCCCCCCCHHHHHHHHHHhhhhhCCCcCCCc
Confidence            999999999999999999999999999999999999999999999999998764

>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>KOG3442 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2991 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 1e-08
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 2e-08
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 4e-08
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 2e-07
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 3e-07
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 8e-07
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 1e-06
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 2e-06
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-04
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 2e-04
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 2e-04
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-04
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 2e-04
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 2e-04
2ys8_A90 Solution Structure Of The Dnaj-Like Domain From Hum 5e-04
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure 
Iteration: 1

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 31/38 (81%)
Query: 98  FEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPG 135
           F+P+ +LG+   AS +DIKKAY++L+ ++HPDKN DPG
Sbjct: 17  FDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPG 54
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|2YS8|A Chain A, Solution Structure Of The Dnaj-Like Domain From Human Ras- Associated Protein Rap1 Length = 90 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 3e-17
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 6e-17
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 1e-16
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 1e-16
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 1e-16
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 3e-16
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 4e-16
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 6e-16
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 6e-16
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 1e-15
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 2e-15
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 2e-15
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-15
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 3e-15
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 4e-15
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 6e-15
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 7e-15
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-14
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 4e-14
2l6l_A 155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 2e-13
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 3e-12
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 4e-12
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 1e-11
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 9e-11
2guz_A71 Mitochondrial import inner membrane translocase su 4e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-08
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 6e-08
3hho_A 174 CO-chaperone protein HSCB homolog; structural geno 7e-08
1fpo_A 171 HSC20, chaperone protein HSCB; molecular chaperone 9e-08
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 2e-06
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 3e-06
3uo3_A 181 J-type CO-chaperone JAC1, mitochondrial; structura 8e-06
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 6e-05
3bvo_A 207 CO-chaperone protein HSCB, mitochondrial precurso; 4e-04
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
 Score = 69.9 bits (172), Expect = 3e-17
 Identities = 21/33 (63%), Positives = 27/33 (81%)

Query: 103 ILGLEHGASDSDIKKAYRRLSIQYHPDKNPDPG 135
            LGL  GASD +IK+AYRR +++YHPDKN +PG
Sbjct: 8   TLGLARGASDEEIKRAYRRQALRYHPDKNKEPG 40
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.5
2guz_A71 Mitochondrial import inner membrane translocase su 99.47
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.46
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.46
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.45
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.45
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.45
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.44
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.44
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.43
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.41
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.41
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.4
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.4
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.39
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.39
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.38
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.38
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.38
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.37
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.33
2l6l_A 155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.31
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.3
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.29
2pf4_E 174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.25
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.2
2guz_B65 Mitochondrial import inner membrane translocase su 99.19
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.17
3bvo_A 207 CO-chaperone protein HSCB, mitochondrial precurso; 99.1
3uo3_A 181 J-type CO-chaperone JAC1, mitochondrial; structura 98.97
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 98.93
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 97.54
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 88.67
2lif_A27 Core protein P21; signal peptide, E1 envelope prot 80.07
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.50  E-value=1.5e-14  Score=97.32  Aligned_cols=38  Identities=39%  Similarity=0.776  Sum_probs=35.9

Q ss_pred             cCCcchhccCCCCCCHHHHHHHHHHHHHhhCCCCCCCC
Q 032733           97 VFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDP  134 (135)
Q Consensus        97 ~~d~y~iLgv~~~as~~eIkkaYRkLs~k~HPDK~~~~  134 (135)
                      ..|||+||||+++++.+|||+|||+|+++|||||++++
T Consensus        26 ~~~~y~iLgv~~~as~~eIk~aYr~la~~~HPDk~~~~   63 (90)
T 2ys8_A           26 SKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAP   63 (90)
T ss_dssp             CSSHHHHHTCCTTCCHHHHHHHHHHHHHHHCTTTCCCT
T ss_pred             CCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCCCc
Confidence            47999999999999999999999999999999999764
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2lif_A Core protein P21; signal peptide, E1 envelope protein, transmemb membrane protein, viral protein; NMR {Hepatitis c virus jfh-1} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 4e-08
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 1e-07
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-07
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 5e-07
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 9e-07
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 4e-06
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 2e-05
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 5e-04
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 45.7 bits (108), Expect = 4e-08
 Identities = 9/32 (28%), Positives = 15/32 (46%)

Query: 103 ILGLEHGASDSDIKKAYRRLSIQYHPDKNPDP 134
            +G+    +   +KK YR+  +  HPDK    
Sbjct: 38  PVGMADLVTPEQVKKVYRKAVLVVHPDKATGQ 69
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.55
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.5
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.43
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.41
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.4
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.17
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.12
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.55  E-value=2.3e-15  Score=96.82  Aligned_cols=38  Identities=39%  Similarity=0.815  Sum_probs=35.7

Q ss_pred             cCCcchhccCCCCCCHHHHHHHHHHHHHhhCCCCCCCC
Q 032733           97 VFEPFSILGLEHGASDSDIKKAYRRLSIQYHPDKNPDP  134 (135)
Q Consensus        97 ~~d~y~iLgv~~~as~~eIkkaYRkLs~k~HPDK~~~~  134 (135)
                      ..|+|+||||+++||.+|||+|||+|++++||||++++
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~   39 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGD   39 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTT
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCC
Confidence            36999999999999999999999999999999999764
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure