Citrus Sinensis ID: 032793

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130---
MASIVPLQSVYASSTTKNLDVARSPSVSSFFAVPRPINRTQKNKKRSLTVVAAAGDVSADGTTYLIAGAAAVALLGTGFPILFSRKDMCPECDGAGFVRKSGATLRANAARKDEVQIVCARCNGLGKLNQIDK
cccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccEEEEEHHHHHHHHcccccEEEEccccccccccccEEEEccccEEcccccccccEEEEcccccccccccccc
cccEEEcHHEccccccccccHccccccccccccccccccEccccccccEEEEEEEEccccccEEHHHHHHHHHHHHcHcHHHEcccccccccccccEEEccccEEEHcHHHccccEEEccccccccccccccc
masivplqsvyassttknldvarspsvssffavprpinrtqknkkrSLTVVAAagdvsadgTTYLIAGAAAVALLGtgfpilfsrkdmcpecdgagfvrksgaTLRANAARKDEVQIVCARCnglgklnqidk
masivplqsvyassttknldvarspsvssffavprpinrtqknkkrsltVVAAAGDVSADGTTYLIAGAAAVALLGTGFPILFSRKDMCPECDGAGFVRKSGATLRAnaarkdevqIVCARcnglgklnqidk
MASIVPLQSVYASSTTKNLDVARSPSVSSFFAVPRPINRTQKNKKRSLtvvaaagdvsadgttyliagaaavallgtgFPILFSRKDMCPECDGAGFVRKSGATLRANAARKDEVQIVCARCNGLGKLNQIDK
***********************************************LTVVAAAGDVSADGTTYLIAGAAAVALLGTGFPILFSRKDMCPECDGAGFVRKSGATLRANAARKDEVQIVCARCNGLGK******
*******QSVYASST************************************AAAGDVSADGTTYLIAGAAAVALLGTGFPILFSRKDMCPECDGAGFVRKSGATL****A*KDEVQIVCARCNGLGKLN****
MASIVPLQSVYASSTTKNLDVARSPSVSSFFAVPRPINRTQKNKKRSLTVVAAAGDVSADGTTYLIAGAAAVALLGTGFPILFSRKDMCPECDGAGFVRKSGATLRANAARKDEVQIVCARCNGLGKLNQIDK
**SIVPLQSVYASSTTKNLD******VSSFFAVPRPINRTQKNKKRSLTVVAAAGDVSADGTTYLIAGAAAVALLGTGFPILFSRKDMCPECDGAGFVRKSGATLRANAARKDEVQIVCARCNGLGKLN****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASIVPLQSVYASSTTKNLDVARSPSVSSFFAVPRPINRTQKNKKRSLTVVAAAGDVSADGTTYLIAGAAAVALLGTGFPILFSRKDMCPECDGAGFVRKSGATLRANAARKDEVQIVCARCNGLGKLNQIDK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
388501814128 unknown [Lotus japonicus] 0.962 1.0 0.691 2e-43
225440410129 PREDICTED: uncharacterized protein LOC10 0.954 0.984 0.622 1e-40
449532086135 PREDICTED: uncharacterized protein LOC10 0.849 0.837 0.675 6e-39
255581504134 conserved hypothetical protein [Ricinus 0.954 0.947 0.633 2e-38
449440038135 PREDICTED: uncharacterized protein LOC10 0.729 0.718 0.773 4e-38
351721529139 uncharacterized protein LOC100306383 [Gl 0.736 0.705 0.777 1e-37
224090749137 predicted protein [Populus trichocarpa] 0.984 0.956 0.661 9e-37
358248166140 uncharacterized protein LOC100798036 [Gl 0.721 0.685 0.762 1e-35
116790708160 unknown [Picea sitchensis] 0.714 0.593 0.760 5e-35
226502010134 uncharacterized protein LOC100277183 [Ze 0.932 0.925 0.6 1e-33
>gi|388501814|gb|AFK38973.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 106/133 (79%), Gaps = 5/133 (3%)

Query: 1   MASIVPLQSVYASSTTKNLDVARSPSVSSFFAVPRPINRTQKNKKRSLTVVAAAGDVSAD 60
           MAS++PL ++   +TT    V+++  +SS      P +R QKNK R+LTVV+A GDVSAD
Sbjct: 1   MASLIPLHTIIPRNTT----VSKT-GLSSAGLTGVPCSRIQKNKNRTLTVVSAVGDVSAD 55

Query: 61  GTTYLIAGAAAVALLGTGFPILFSRKDMCPECDGAGFVRKSGATLRANAARKDEVQIVCA 120
           G TYLIAGA AVAL+GT FPILFSRKD CPECDGAGFVRKSG TLRANAARKD+ QIVCA
Sbjct: 56  GNTYLIAGAIAVALVGTAFPILFSRKDTCPECDGAGFVRKSGKTLRANAARKDQTQIVCA 115

Query: 121 RCNGLGKLNQIDK 133
            CNGLGKLNQIDK
Sbjct: 116 NCNGLGKLNQIDK 128

Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225440410|ref|XP_002269159.1| PREDICTED: uncharacterized protein LOC100249439 [Vitis vinifera] gi|147861902|emb|CAN82963.1| hypothetical protein VITISV_000344 [Vitis vinifera] gi|297740343|emb|CBI30525.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449532086|ref|XP_004173015.1| PREDICTED: uncharacterized protein LOC101228756 [Cucumis sativus] Back     alignment and taxonomy information
>gi|255581504|ref|XP_002531558.1| conserved hypothetical protein [Ricinus communis] gi|223528819|gb|EEF30824.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449440038|ref|XP_004137792.1| PREDICTED: uncharacterized protein LOC101209846 [Cucumis sativus] Back     alignment and taxonomy information
>gi|351721529|ref|NP_001237980.1| uncharacterized protein LOC100306383 [Glycine max] gi|255628365|gb|ACU14527.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224090749|ref|XP_002309071.1| predicted protein [Populus trichocarpa] gi|222855047|gb|EEE92594.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358248166|ref|NP_001240085.1| uncharacterized protein LOC100798036 [Glycine max] gi|255640412|gb|ACU20493.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|116790708|gb|ABK25712.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|226502010|ref|NP_001144296.1| uncharacterized protein LOC100277183 [Zea mays] gi|195639830|gb|ACG39383.1| hypothetical protein [Zea mays] gi|413950231|gb|AFW82880.1| hypothetical protein ZEAMMB73_998797 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query133
TAIR|locus:2185128129 AT5G02160 "AT5G02160" [Arabido 0.932 0.961 0.492 5.5e-22
TAIR|locus:2185128 AT5G02160 "AT5G02160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 256 (95.2 bits), Expect = 5.5e-22, P = 5.5e-22
 Identities = 66/134 (49%), Positives = 71/134 (52%)

Query:     3 SIVP-LQSVYASSTTKNLDVARSPSVSSFFAVPRPINRT-QKNKKRSLXXXXXXXXXXXX 60
             +I P LQ+ + SST  N  +  S S  S    P P N    KNK+ S             
Sbjct:     2 TIAPALQTTFVSST--NF-LKHSSSWGS----PSPNNVILPKNKRSSSSVVVAAVGDVSS 54

Query:    61 XXXXXXXXXXXXXXXX-XXFPILFSRKDMCPECDGAGFVRKSGATLRANAARKDEVQIVC 119
                                FPILF RKD CPECDGAGFVRK G TLRANAARKD  QIVC
Sbjct:    55 DGTIYLIGGAIAVALVGTAFPILFKRKDTCPECDGAGFVRKGGVTLRANAARKDLPQIVC 114

Query:   120 ARCNGLGKLNQIDK 133
             A CNGLGKLNQIDK
Sbjct:   115 ANCNGLGKLNQIDK 128


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.320   0.132   0.381    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      133       103   0.00091  102 3  11 22  0.38    30
                                                     29  0.49    31


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  482 (51 KB)
  Total size of DFA:  94 KB (2069 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  8.39u 0.09s 8.48t   Elapsed:  00:00:01
  Total cpu time:  8.39u 0.09s 8.48t   Elapsed:  00:00:01
  Start:  Fri May 10 03:41:44 2013   End:  Fri May 10 03:41:45 2013
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0030003 "cellular cation homeostasis" evidence=RCA
GO:0030154 "cell differentiation" evidence=RCA
GO:0043085 "positive regulation of catalytic activity" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0070838 "divalent metal ion transport" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00021347001
SubName- Full=Putative uncharacterized protein (Chromosome chr8 scaffold_23, whole genome shotgun sequence); (129 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00037228001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (221 aa)
   •    0.439
GSVIVG00034383001
SubName- Full=Putative uncharacterized protein (Chromosome chr9 scaffold_7, whole genome shotgu [...] (144 aa)
   •    0.428
GSVIVG00035114001
SubName- Full=Chromosome chr1 scaffold_75, whole genome shotgun sequence; (226 aa)
   •    0.422
GSVIVG00025097001
SubName- Full=Putative uncharacterized protein (Chromosome chr4 scaffold_32, whole genome shotg [...] (221 aa)
   •    0.420

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query133
cd1071965 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and H 0.003
>gnl|CDD|199908 cd10719, DnaJ_zf, Zinc finger domain of DnaJ and HSP40 Back     alignment and domain information 
 Score = 33.8 bits (78), Expect = 0.003
 Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 4/39 (10%)

Query: 89  CPECDGAGFVRKSGATLRANAARKDEVQIVCARCNGLGK 127
           CP C G+G VR+   T         + Q  C  C G GK
Sbjct: 18  CPTCGGSGQVRQVQGTGFGFF----QTQTTCPTCGGTGK 52

Central/middle or CxxCxGxG-motif containing domain of DnaJ/Hsp40 (heat shock protein 40). DnaJ proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s, an important chaperonin family. Hsp40 proteins are characterized by the presence of an N-terminal J domain, which mediates the interaction with Hsp70. This central domain contains four repeats of a CxxCxGxG motif and binds to two Zinc ions. It has been implicated in substrate binding. Length = 65

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 133
PLN03165111 chaperone protein dnaJ-related; Provisional 97.34
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 96.93
KOG0712 337 consensus Molecular chaperone (DnaJ superfamily) [ 96.15
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 95.95
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 95.69
PRK14297 380 chaperone protein DnaJ; Provisional 95.68
PTZ00037 421 DnaJ_C chaperone protein; Provisional 95.58
PRK14285 365 chaperone protein DnaJ; Provisional 95.53
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 95.46
PRK14278 378 chaperone protein DnaJ; Provisional 95.41
PRK14298 377 chaperone protein DnaJ; Provisional 95.37
PRK14294 366 chaperone protein DnaJ; Provisional 95.26
PRK14296 372 chaperone protein DnaJ; Provisional 95.24
PRK14300 372 chaperone protein DnaJ; Provisional 95.1
PRK14279 392 chaperone protein DnaJ; Provisional 95.08
PRK14300 372 chaperone protein DnaJ; Provisional 95.07
PRK14301 373 chaperone protein DnaJ; Provisional 95.03
PRK14282 369 chaperone protein DnaJ; Provisional 94.98
PRK14276 380 chaperone protein DnaJ; Provisional 94.78
PRK14287 371 chaperone protein DnaJ; Provisional 94.75
PRK10767 371 chaperone protein DnaJ; Provisional 94.7
PRK14288 369 chaperone protein DnaJ; Provisional 94.69
PRK14295 389 chaperone protein DnaJ; Provisional 94.67
PRK14280 376 chaperone protein DnaJ; Provisional 94.62
PRK14291 382 chaperone protein DnaJ; Provisional 94.38
PRK10767 371 chaperone protein DnaJ; Provisional 94.32
PRK14279 392 chaperone protein DnaJ; Provisional 94.29
PRK14277 386 chaperone protein DnaJ; Provisional 94.28
PRK14286 372 chaperone protein DnaJ; Provisional 94.22
PRK14284 391 chaperone protein DnaJ; Provisional 94.21
PRK14287 371 chaperone protein DnaJ; Provisional 94.2
PRK14281 397 chaperone protein DnaJ; Provisional 94.04
PRK14290 365 chaperone protein DnaJ; Provisional 93.94
PRK14288 369 chaperone protein DnaJ; Provisional 93.92
PRK14289 386 chaperone protein DnaJ; Provisional 93.89
PRK14291 382 chaperone protein DnaJ; Provisional 93.88
PRK14289 386 chaperone protein DnaJ; Provisional 93.61
PRK14290 365 chaperone protein DnaJ; Provisional 93.38
PRK14281 397 chaperone protein DnaJ; Provisional 93.35
PRK14301 373 chaperone protein DnaJ; Provisional 93.12
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 92.94
PRK14292 371 chaperone protein DnaJ; Provisional 92.72
PRK14280 376 chaperone protein DnaJ; Provisional 92.58
PRK14283 378 chaperone protein DnaJ; Provisional 92.39
PRK14297 380 chaperone protein DnaJ; Provisional 92.34
PRK14293 374 chaperone protein DnaJ; Provisional 91.8
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 91.23
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 91.22
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 91.21
PRK14292 371 chaperone protein DnaJ; Provisional 90.55
PRK14294 366 chaperone protein DnaJ; Provisional 90.5
PRK14276 380 chaperone protein DnaJ; Provisional 90.37
PRK14283 378 chaperone protein DnaJ; Provisional 90.36
PRK14296 372 chaperone protein DnaJ; Provisional 90.3
PRK14278 378 chaperone protein DnaJ; Provisional 89.97
PRK14293 374 chaperone protein DnaJ; Provisional 89.64
PRK14286 372 chaperone protein DnaJ; Provisional 89.53
PRK14285 365 chaperone protein DnaJ; Provisional 89.05
PRK14277 386 chaperone protein DnaJ; Provisional 88.68
PF10080102 DUF2318: Predicted membrane protein (DUF2318); Int 88.1
PRK14284 391 chaperone protein DnaJ; Provisional 87.98
PF1436935 zf-RING_3: zinc-finger 87.6
PRK14282 369 chaperone protein DnaJ; Provisional 87.51
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 86.69
PRK14298 377 chaperone protein DnaJ; Provisional 86.37
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 85.89
KOG2813 406 consensus Predicted molecular chaperone, contains 85.44
PRK14295 389 chaperone protein DnaJ; Provisional 84.82
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 84.68
PTZ00037 421 DnaJ_C chaperone protein; Provisional 83.4
COG1107 715 Archaea-specific RecJ-like exonuclease, contains D 83.02
PF14353128 CpXC: CpXC protein 82.94
PRK00635 1809 excinuclease ABC subunit A; Provisional 81.5
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information 
Probab=97.34  E-value=0.00021  Score=52.67  Aligned_cols=48  Identities=27%  Similarity=0.667  Sum_probs=35.1

Q ss_pred             HhcccceeeeecC---------------------CCCCCCCCcceeeeccccchhhhhccccceEeecccCCCccc
Q 032793           74 LLGTGFPILFSRK---------------------DMCPECDGAGFVRKSGATLRANAARKDEVQIVCARCNGLGKL  128 (133)
Q Consensus        74 lvGTAfpIlfsRk---------------------d~CPECdGaGFvrk~g~~l~anaArkd~~qivc~~cnglgkl  128 (133)
                      .+|...||||--.                     ..|+.|+|.|++.....       -.-+.|..|+.|+|-||.
T Consensus        19 ~~~~~~~~~~~~q~~~~~~~~~~v~C~~C~GsG~~~C~~C~G~G~v~~~~~-------g~~q~~~~C~~C~G~Gk~   87 (111)
T PLN03165         19 AVGIGIPVFYETQIDNAAKRENTQPCFPCSGTGAQVCRFCVGSGNVTVELG-------GGEKEVSKCINCDGAGSL   87 (111)
T ss_pred             hhccCCcEEEEEeeehhhhhccCCCCCCCCCCCCcCCCCCcCcCeEEEEeC-------CcEEEEEECCCCCCccee
Confidence            3688899999532                     27889999998875421       124678899999999973

>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF10080 DUF2318: Predicted membrane protein (DUF2318); InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF14369 zf-RING_3: zinc-finger Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>KOG2813 consensus Predicted molecular chaperone, contains DnaJ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 96.81
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 96.06
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 96.02
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 95.96
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 95.39
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 95.32
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 94.77
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 93.66
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 88.76
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 84.74
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 84.59
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 82.67
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 82.42
2bw2_A140 Bypass of forespore C; sporulation, signaling prot 80.3
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
Probab=96.81  E-value=0.00029  Score=44.57  Aligned_cols=14  Identities=50%  Similarity=1.044  Sum_probs=10.0

Q ss_pred             ceEeecccCCCccc
Q 032793          115 VQIVCARCNGLGKL  128 (133)
Q Consensus       115 ~qivc~~cnglgkl  128 (133)
                      .|..|+.|+|-|++
T Consensus        49 ~~~~C~~C~G~G~~   62 (79)
T 1exk_A           49 VQQTCPHCQGRGTL   62 (79)
T ss_dssp             EEEECTTTTTSSEE
T ss_pred             EeeECcCCCCccEE
Confidence            45678888887765
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2bw2_A Bypass of forespore C; sporulation, signaling protein, BOFC, sigmak checkpoint; NMR {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query133
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 96.52
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 96.37
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 96.28
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 95.44
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 80.59
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Small proteins
fold: DnaJ/Hsp40 cysteine-rich domain
superfamily: DnaJ/Hsp40 cysteine-rich domain
family: DnaJ/Hsp40 cysteine-rich domain
domain: Cysteine-rich domain of the chaperone protein DnaJ
species: Escherichia coli [TaxId: 562]

Probab=96.52  E-value=0.00051  Score=43.32  Aligned_cols=15  Identities=47%  Similarity=0.975  Sum_probs=10.6

Q ss_pred             cceEeecccCCCccc
Q 032793          114 EVQIVCARCNGLGKL  128 (133)
Q Consensus       114 ~~qivc~~cnglgkl  128 (133)
                      +.|..|+.|+|.|++
T Consensus        48 ~~~~~C~~C~G~G~~   62 (79)
T d1exka_          48 AVQQTCPHCQGRGTL   62 (79)
T ss_dssp             EEEEECTTTTTSSEE
T ss_pred             eeeEECcccCcceeE
Confidence            345578888888875
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure