Citrus Sinensis ID: 032813
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| 425856886 | 565 | 4-coumarate:CoA ligase [Cunninghamia lan | 0.473 | 0.111 | 0.873 | 3e-28 | |
| 255557999 | 573 | AMP dependent CoA ligase, putative [Rici | 0.473 | 0.109 | 0.936 | 2e-27 | |
| 268528133 | 574 | 4-coumarate:CoA ligase 2 [Gossypium hirs | 0.639 | 0.148 | 0.637 | 9e-27 | |
| 253509565 | 573 | 4-coumarate:CoA ligase 1 [Gossypium hirs | 0.473 | 0.109 | 0.920 | 1e-26 | |
| 315419007 | 574 | 4CL [Gossypium hirsutum] | 0.473 | 0.109 | 0.920 | 2e-26 | |
| 351723189 | 570 | 4-coumarate:CoA ligase isoenzyme 3 [Glyc | 0.473 | 0.110 | 0.888 | 3e-26 | |
| 387316078 | 491 | 4-coumarate: coenzyme A ligase, partial | 0.473 | 0.128 | 0.809 | 3e-26 | |
| 371534669 | 570 | Coumaroyl-CoA ligase [Vitis vinifera] | 0.473 | 0.110 | 0.904 | 4e-26 | |
| 381356182 | 565 | 4-coumarate-CoA ligase [Cinnamomum osmop | 0.473 | 0.111 | 0.904 | 4e-26 | |
| 379061385 | 569 | 4-coumarate: coenzyme A ligase 2 [Populu | 0.473 | 0.110 | 0.888 | 9e-26 |
| >gi|425856886|gb|AFX98059.1| 4-coumarate:CoA ligase [Cunninghamia lanceolata] | Back alignment and taxonomy information |
|---|
Score = 129 bits (325), Expect = 3e-28, Method: Composition-based stats.
Identities = 55/63 (87%), Positives = 61/63 (96%)
Query: 1 MTEAGPVLSMCLGFAKQPFPTKSGSCGTVVRNAELKVIDPEIGASLPHNQPGEICIRGPQ 60
MTEAGPVLSMCLGFAK+PFPTKSGSCGTVVRNA++K+IDPE G SLP+N+PGEICIRGPQ
Sbjct: 357 MTEAGPVLSMCLGFAKEPFPTKSGSCGTVVRNAQMKIIDPETGESLPYNKPGEICIRGPQ 416
Query: 61 IMK 63
IMK
Sbjct: 417 IMK 419
|
Source: Cunninghamia lanceolata Species: Cunninghamia lanceolata Genus: Cunninghamia Family: Cupressaceae Order: Coniferales Class: Coniferopsida Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255557999|ref|XP_002520028.1| AMP dependent CoA ligase, putative [Ricinus communis] gi|223540792|gb|EEF42352.1| AMP dependent CoA ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|268528133|gb|ACZ06243.1| 4-coumarate:CoA ligase 2 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|253509565|gb|ACT32027.1| 4-coumarate:CoA ligase 1 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|315419007|gb|ADU15550.1| 4CL [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|351723189|ref|NP_001237270.1| 4-coumarate:CoA ligase isoenzyme 3 [Glycine max] gi|4038971|gb|AAC97389.1| 4-coumarate:CoA ligase isoenzyme 3 [Glycine max] gi|4038973|gb|AAC97599.1| 4-coumarate:CoA ligase isoenzyme 3 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|387316078|gb|AFJ73431.1| 4-coumarate: coenzyme A ligase, partial [Metasequoia glyptostroboides] | Back alignment and taxonomy information |
|---|
| >gi|371534669|gb|AEX32786.1| Coumaroyl-CoA ligase [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|381356182|gb|AFG26324.1| 4-coumarate-CoA ligase [Cinnamomum osmophloeum] | Back alignment and taxonomy information |
|---|
| >gi|379061385|gb|AFC89538.1| 4-coumarate: coenzyme A ligase 2 [Populus tomentosa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 133 | ||||||
| TAIR|locus:2094716 | 556 | 4CL2 "4-coumarate:CoA ligase 2 | 0.473 | 0.113 | 0.777 | 8e-23 | |
| TAIR|locus:2017602 | 561 | 4CL1 "4-coumarate:CoA ligase 1 | 0.473 | 0.112 | 0.777 | 1.7e-22 | |
| TAIR|locus:2015003 | 561 | 4CL3 "4-coumarate:CoA ligase 3 | 0.473 | 0.112 | 0.809 | 2.7e-21 | |
| TAIR|locus:2094771 | 570 | 4CL5 "4-coumarate:CoA ligase 5 | 0.466 | 0.108 | 0.650 | 7.9e-17 | |
| UNIPROTKB|Q5LVA1 | 535 | fadD "4-coumarate:CoA ligase" | 0.315 | 0.078 | 0.476 | 2e-06 | |
| TIGR_CMR|SPO_0801 | 535 | SPO_0801 "4-coumarate:CoA liga | 0.315 | 0.078 | 0.476 | 2e-06 | |
| UNIPROTKB|P69451 | 561 | fadD [Escherichia coli K-12 (t | 0.578 | 0.137 | 0.344 | 5.8e-06 | |
| TAIR|locus:2158559 | 562 | AT5G63380 [Arabidopsis thalian | 0.443 | 0.104 | 0.421 | 7.5e-06 | |
| UNIPROTKB|E1BS15 | 589 | ACSF2 "Uncharacterized protein | 0.548 | 0.123 | 0.329 | 1.3e-05 | |
| UNIPROTKB|E1BVI3 | 593 | ACSF2 "Uncharacterized protein | 0.548 | 0.123 | 0.329 | 1.3e-05 |
| TAIR|locus:2094716 4CL2 "4-coumarate:CoA ligase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 271 (100.5 bits), Expect = 8.0e-23, P = 8.0e-23
Identities = 49/63 (77%), Positives = 57/63 (90%)
Query: 1 MTEAGPVLSMCLGFAKQPFPTKSGSCGTVVRNAELKVIDPEIGASLPHNQPGEICIRGPQ 60
MTEAGPVL+M LGFAK+PFP KSG+CGTVVRNAE+K++DP+ G SLP N+PGEICIRG Q
Sbjct: 349 MTEAGPVLAMSLGFAKEPFPVKSGACGTVVRNAEMKILDPDTGDSLPRNKPGEICIRGNQ 408
Query: 61 IMK 63
IMK
Sbjct: 409 IMK 411
|
|
| TAIR|locus:2017602 4CL1 "4-coumarate:CoA ligase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2015003 4CL3 "4-coumarate:CoA ligase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094771 4CL5 "4-coumarate:CoA ligase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5LVA1 fadD "4-coumarate:CoA ligase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_0801 SPO_0801 "4-coumarate:CoA ligase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P69451 fadD [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2158559 AT5G63380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BS15 ACSF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVI3 ACSF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| 4CL | SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (378 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00024561001 | • | • | 0.944 | ||||||||
| GSVIVG00023211001 | • | • | 0.944 | ||||||||
| GSVIVG00018175001 | • | • | 0.944 | ||||||||
| GSVIVG00016492001 | • | • | 0.944 | ||||||||
| GSVIVG00016489001 | • | • | 0.944 | ||||||||
| GSVIVG00013947001 | • | • | 0.944 | ||||||||
| GSVIVG00013943001 | • | • | 0.944 | ||||||||
| GSVIVG00013939001 | • | • | 0.944 | ||||||||
| gVvPAL1 | • | • | 0.944 | ||||||||
| GSVIVG00013928001 | • | • | 0.944 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| PLN02246 | 537 | PLN02246, PLN02246, 4-coumarate--CoA ligase | 1e-46 | |
| cd05904 | 504 | cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) | 5e-25 | |
| cd05911 | 487 | cd05911, Firefly_Luc_like, Firefly luciferase of l | 3e-17 | |
| cd05917 | 347 | cd05917, FACL_like_2, Uncharacterized subfamily of | 1e-13 | |
| cd05936 | 468 | cd05936, FC-FACS_FadD_like, Prokaryotic long-chain | 1e-12 | |
| pfam00501 | 412 | pfam00501, AMP-binding, AMP-binding enzyme | 7e-12 | |
| cd05929 | 342 | cd05929, BACL_like, Bacterial Bile acid CoA ligase | 1e-11 | |
| cd04433 | 338 | cd04433, AFD_class_I, Adenylate forming domain, Cl | 6e-11 | |
| PRK07656 | 513 | PRK07656, PRK07656, long-chain-fatty-acid--CoA lig | 1e-10 | |
| COG0318 | 534 | COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ | 4e-10 | |
| cd05935 | 430 | cd05935, LC_FACS_like, Putative long-chain fatty a | 6e-10 | |
| PRK08315 | 559 | PRK08315, PRK08315, AMP-binding domain protein; Va | 9e-10 | |
| PRK08974 | 560 | PRK08974, PRK08974, long-chain-fatty-acid--CoA lig | 7e-09 | |
| PLN02330 | 546 | PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 | 3e-08 | |
| PRK05677 | 562 | PRK05677, PRK05677, long-chain-fatty-acid--CoA lig | 5e-08 | |
| PRK08633 | 1146 | PRK08633, PRK08633, 2-acyl-glycerophospho-ethanola | 5e-08 | |
| PRK06187 | 521 | PRK06187, PRK06187, long-chain-fatty-acid--CoA lig | 6e-08 | |
| cd05909 | 489 | cd05909, AAS_C, C-terminal domain of the acyl-acyl | 7e-08 | |
| PRK12492 | 562 | PRK12492, PRK12492, long-chain-fatty-acid--CoA lig | 1e-07 | |
| PRK07059 | 557 | PRK07059, PRK07059, Long-chain-fatty-acid--CoA lig | 3e-06 | |
| PRK06839 | 496 | PRK06839, PRK06839, acyl-CoA synthetase; Validated | 4e-06 | |
| cd05907 | 456 | cd05907, VL_LC_FACS_like, Long-chain fatty acid Co | 4e-06 | |
| cd05903 | 437 | cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li | 4e-06 | |
| PRK12583 | 558 | PRK12583, PRK12583, acyl-CoA synthetase; Provision | 5e-06 | |
| cd05931 | 547 | cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | 6e-06 | |
| PRK08314 | 546 | PRK08314, PRK08314, long-chain-fatty-acid--CoA lig | 7e-06 | |
| PRK08316 | 523 | PRK08316, PRK08316, acyl-CoA synthetase; Validated | 9e-06 | |
| cd05927 | 539 | cd05927, LC-FACS_euk, Eukaryotic long-chain fatty | 2e-05 | |
| PRK06178 | 567 | PRK06178, PRK06178, acyl-CoA synthetase; Validated | 3e-05 | |
| PRK06145 | 497 | PRK06145, PRK06145, acyl-CoA synthetase; Validated | 4e-05 | |
| cd05941 | 430 | cd05941, MCS, Malonyl-CoA synthetase (MCS) | 5e-05 | |
| cd05934 | 421 | cd05934, FACL_DitJ_like, Uncharacterized subfamily | 5e-05 | |
| cd05926 | 345 | cd05926, FACL_fum10p_like, Subfamily of fatty acid | 5e-05 | |
| PRK06188 | 524 | PRK06188, PRK06188, acyl-CoA synthetase; Validated | 1e-04 | |
| PLN02574 | 560 | PLN02574, PLN02574, 4-coumarate--CoA ligase-like | 2e-04 | |
| PRK09192 | 579 | PRK09192, PRK09192, acyl-CoA synthetase; Validated | 2e-04 | |
| cd12119 | 517 | cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synth | 3e-04 | |
| PRK10524 | 629 | PRK10524, prpE, propionyl-CoA synthetase; Provisio | 3e-04 | |
| PRK06164 | 540 | PRK06164, PRK06164, acyl-CoA synthetase; Validated | 4e-04 | |
| cd05922 | 350 | cd05922, FACL_like_6, Uncharacterized subfamily of | 7e-04 | |
| COG1022 | 613 | COG1022, FAA1, Long-chain acyl-CoA synthetases (AM | 0.001 | |
| PRK12476 | 612 | PRK12476, PRK12476, putative fatty-acid--CoA ligas | 0.001 | |
| cd05919 | 436 | cd05919, BCL_like, Benzoate CoA ligase (BCL) and s | 0.001 | |
| PRK06710 | 563 | PRK06710, PRK06710, long-chain-fatty-acid--CoA lig | 0.002 | |
| PRK07514 | 504 | PRK07514, PRK07514, malonyl-CoA synthase; Validate | 0.003 | |
| PRK07769 | 631 | PRK07769, PRK07769, long-chain-fatty-acid--CoA lig | 0.004 | |
| cd05918 | 447 | cd05918, A_NRPS_SidN3_like, The adenylation (A) do | 0.004 | |
| cd05912 | 407 | cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase | 0.004 | |
| cd05945 | 447 | cd05945, DltA, D-alanine:D-alanyl carrier protein | 0.004 | |
| PRK09088 | 488 | PRK09088, PRK09088, acyl-CoA synthetase; Validated | 0.004 |
| >gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
Score = 157 bits (399), Expect = 1e-46
Identities = 55/63 (87%), Positives = 59/63 (93%)
Query: 1 MTEAGPVLSMCLGFAKQPFPTKSGSCGTVVRNAELKVIDPEIGASLPHNQPGEICIRGPQ 60
MTEAGPVL+MCL FAK+PFP KSGSCGTVVRNAELK++DPE GASLP NQPGEICIRGPQ
Sbjct: 333 MTEAGPVLAMCLAFAKEPFPVKSGSCGTVVRNAELKIVDPETGASLPRNQPGEICIRGPQ 392
Query: 61 IMK 63
IMK
Sbjct: 393 IMK 395
|
Length = 537 |
| >gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) | Back alignment and domain information |
|---|
| >gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) | Back alignment and domain information |
|---|
| >gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD | Back alignment and domain information |
|---|
| >gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I | Back alignment and domain information |
|---|
| >gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase | Back alignment and domain information |
|---|
| >gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236359 PRK08974, PRK08974, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215189 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|168170 PRK05677, PRK05677, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236315 PRK08633, PRK08633, 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas) | Back alignment and domain information |
|---|
| >gnl|CDD|171539 PRK12492, PRK12492, long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235923 PRK07059, PRK07059, Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases | Back alignment and domain information |
|---|
| >gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) | Back alignment and domain information |
|---|
| >gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) | Back alignment and domain information |
|---|
| >gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213293 cd05927, LC-FACS_euk, Eukaryotic long-chain fatty acid CoA synthetase (LC-FACS) | Back alignment and domain information |
|---|
| >gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|102207 PRK06145, PRK06145, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) | Back alignment and domain information |
|---|
| >gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis | Back alignment and domain information |
|---|
| >gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >gnl|CDD|236403 PRK09192, PRK09192, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213327 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles | Back alignment and domain information |
|---|
| >gnl|CDD|182517 PRK10524, prpE, propionyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235722 PRK06164, PRK06164, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) | Back alignment and domain information |
|---|
| >gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|171527 PRK12476, PRK12476, putative fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213286 cd05919, BCL_like, Benzoate CoA ligase (BCL) and similar adenylate forming enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181011 PRK07514, PRK07514, malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181109 PRK07769, PRK07769, long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213285 cd05918, A_NRPS_SidN3_like, The adenylation (A) domain of siderophore-synthesizing nonribosomal peptide synthetases (NRPS) | Back alignment and domain information |
|---|
| >gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) | Back alignment and domain information |
|---|
| >gnl|CDD|213310 cd05945, DltA, D-alanine:D-alanyl carrier protein ligase (DltA) | Back alignment and domain information |
|---|
| >gnl|CDD|181644 PRK09088, PRK09088, acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| KOG1176 | 537 | consensus Acyl-CoA synthetase [Lipid transport and | 99.94 | |
| PLN02614 | 666 | long-chain acyl-CoA synthetase | 99.92 | |
| COG1022 | 613 | FAA1 Long-chain acyl-CoA synthetases (AMP-forming) | 99.92 | |
| KOG1256 | 691 | consensus Long-chain acyl-CoA synthetases (AMP-for | 99.91 | |
| COG0318 | 534 | CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l | 99.91 | |
| PLN02861 | 660 | long-chain-fatty-acid-CoA ligase | 99.9 | |
| PF00501 | 417 | AMP-binding: AMP-binding enzyme; InterPro: IPR0008 | 99.9 | |
| PTZ00342 | 746 | acyl-CoA synthetase; Provisional | 99.89 | |
| PTZ00216 | 700 | acyl-CoA synthetase; Provisional | 99.89 | |
| PLN02574 | 560 | 4-coumarate--CoA ligase-like | 99.89 | |
| PLN02736 | 651 | long-chain acyl-CoA synthetase | 99.88 | |
| PLN02387 | 696 | long-chain-fatty-acid-CoA ligase family protein | 99.88 | |
| PRK06334 | 539 | long chain fatty acid--[acyl-carrier-protein] liga | 99.88 | |
| PRK07769 | 631 | long-chain-fatty-acid--CoA ligase; Validated | 99.88 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 99.87 | |
| PRK12476 | 612 | putative fatty-acid--CoA ligase; Provisional | 99.87 | |
| PTZ00237 | 647 | acetyl-CoA synthetase; Provisional | 99.87 | |
| PLN02654 | 666 | acetate-CoA ligase | 99.86 | |
| PRK00174 | 637 | acetyl-CoA synthetase; Provisional | 99.86 | |
| PLN02430 | 660 | long-chain-fatty-acid-CoA ligase | 99.86 | |
| PLN02246 | 537 | 4-coumarate--CoA ligase | 99.86 | |
| PRK05677 | 562 | long-chain-fatty-acid--CoA ligase; Validated | 99.86 | |
| PRK09274 | 552 | peptide synthase; Provisional | 99.86 | |
| TIGR02188 | 625 | Ac_CoA_lig_AcsA acetate--CoA ligase. This model de | 99.86 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.86 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 99.86 | |
| PRK07638 | 487 | acyl-CoA synthetase; Validated | 99.85 | |
| KOG1177 | 596 | consensus Long chain fatty acid acyl-CoA ligase [L | 99.85 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.85 | |
| PRK09088 | 488 | acyl-CoA synthetase; Validated | 99.85 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.85 | |
| PRK12492 | 562 | long-chain-fatty-acid--CoA ligase; Provisional | 99.85 | |
| PRK05851 | 525 | long-chain-fatty-acid--[acyl-carrier-protein] liga | 99.85 | |
| PRK06164 | 540 | acyl-CoA synthetase; Validated | 99.85 | |
| PRK06178 | 567 | acyl-CoA synthetase; Validated | 99.85 | |
| PLN02330 | 546 | 4-coumarate--CoA ligase-like 1 | 99.84 | |
| PRK12316 | 5163 | peptide synthase; Provisional | 99.84 | |
| COG0365 | 528 | Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l | 99.84 | |
| PRK06839 | 496 | acyl-CoA synthetase; Validated | 99.84 | |
| PRK04319 | 570 | acetyl-CoA synthetase; Provisional | 99.84 | |
| PRK06145 | 497 | acyl-CoA synthetase; Validated | 99.84 | |
| PRK06060 | 705 | acyl-CoA synthetase; Validated | 99.84 | |
| TIGR02316 | 628 | propion_prpE propionate--CoA ligase. This family c | 99.84 | |
| PRK05857 | 540 | acyl-CoA synthetase; Validated | 99.84 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 99.84 | |
| PRK07514 | 504 | malonyl-CoA synthase; Validated | 99.83 | |
| PRK07059 | 557 | Long-chain-fatty-acid--CoA ligase; Validated | 99.83 | |
| PRK12467 | 3956 | peptide synthase; Provisional | 99.83 | |
| PRK08315 | 559 | AMP-binding domain protein; Validated | 99.83 | |
| PRK07529 | 632 | AMP-binding domain protein; Validated | 99.83 | |
| PLN03051 | 499 | acyl-activating enzyme; Provisional | 99.83 | |
| PLN02860 | 563 | o-succinylbenzoate-CoA ligase | 99.83 | |
| PRK13390 | 501 | acyl-CoA synthetase; Provisional | 99.83 | |
| PRK05691 | 4334 | peptide synthase; Validated | 99.83 | |
| PRK08008 | 517 | caiC putative crotonobetaine/carnitine-CoA ligase; | 99.82 | |
| PRK07788 | 549 | acyl-CoA synthetase; Validated | 99.82 | |
| PRK05852 | 534 | acyl-CoA synthetase; Validated | 99.82 | |
| PRK08316 | 523 | acyl-CoA synthetase; Validated | 99.82 | |
| PRK06155 | 542 | crotonobetaine/carnitine-CoA ligase; Provisional | 99.82 | |
| PRK10946 | 536 | entE enterobactin synthase subunit E; Provisional | 99.82 | |
| PRK07470 | 528 | acyl-CoA synthetase; Validated | 99.82 | |
| PRK03640 | 483 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.82 | |
| PRK08314 | 546 | long-chain-fatty-acid--CoA ligase; Validated | 99.81 | |
| PRK13382 | 537 | acyl-CoA synthetase; Provisional | 99.81 | |
| PRK13295 | 547 | cyclohexanecarboxylate-CoA ligase; Reviewed | 99.81 | |
| TIGR02275 | 527 | DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot | 99.81 | |
| PRK08751 | 560 | putative long-chain fatty acyl CoA ligase; Provisi | 99.81 | |
| PRK10524 | 629 | prpE propionyl-CoA synthetase; Provisional | 99.81 | |
| PRK12583 | 558 | acyl-CoA synthetase; Provisional | 99.81 | |
| TIGR01734 | 502 | D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig | 99.81 | |
| TIGR03208 | 538 | cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. | 99.81 | |
| PRK07656 | 513 | long-chain-fatty-acid--CoA ligase; Validated | 99.81 | |
| PRK05605 | 573 | long-chain-fatty-acid--CoA ligase; Validated | 99.81 | |
| PRK07786 | 542 | long-chain-fatty-acid--CoA ligase; Validated | 99.81 | |
| PRK06087 | 547 | short chain acyl-CoA synthetase; Reviewed | 99.81 | |
| PRK07787 | 471 | acyl-CoA synthetase; Validated | 99.81 | |
| PRK08180 | 614 | feruloyl-CoA synthase; Reviewed | 99.8 | |
| TIGR01733 | 408 | AA-adenyl-dom amino acid adenylation domain. This | 99.8 | |
| PRK12582 | 624 | acyl-CoA synthetase; Provisional | 99.8 | |
| PRK06710 | 563 | long-chain-fatty-acid--CoA ligase; Validated | 99.8 | |
| PRK08974 | 560 | long-chain-fatty-acid--CoA ligase; Validated | 99.79 | |
| KOG1180 | 678 | consensus Acyl-CoA synthetase [Lipid transport and | 99.79 | |
| TIGR02262 | 508 | benz_CoA_lig benzoate-CoA ligase family. Character | 99.79 | |
| PRK07867 | 529 | acyl-CoA synthetase; Validated | 99.79 | |
| PRK06188 | 524 | acyl-CoA synthetase; Validated | 99.78 | |
| PRK13388 | 540 | acyl-CoA synthetase; Provisional | 99.78 | |
| COG1021 | 542 | EntE Peptide arylation enzymes [Secondary metaboli | 99.78 | |
| PRK08276 | 502 | long-chain-fatty-acid--CoA ligase; Validated | 99.78 | |
| TIGR03205 | 541 | pimA dicarboxylate--CoA ligase PimA. PimA, a membe | 99.78 | |
| TIGR03098 | 515 | ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor | 99.78 | |
| PRK12406 | 509 | long-chain-fatty-acid--CoA ligase; Provisional | 99.78 | |
| PRK09192 | 579 | acyl-CoA synthetase; Validated | 99.78 | |
| TIGR01217 | 652 | ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym | 99.78 | |
| PRK08043 | 718 | bifunctional acyl-[acyl carrier protein] synthetas | 99.78 | |
| PRK03584 | 655 | acetoacetyl-CoA synthetase; Provisional | 99.78 | |
| PRK13383 | 516 | acyl-CoA synthetase; Provisional | 99.77 | |
| PRK04813 | 503 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.77 | |
| PRK13391 | 511 | acyl-CoA synthetase; Provisional | 99.77 | |
| PRK05850 | 578 | acyl-CoA synthetase; Validated | 99.76 | |
| PRK06187 | 521 | long-chain-fatty-acid--CoA ligase; Validated | 99.75 | |
| PRK07445 | 452 | O-succinylbenzoic acid--CoA ligase; Reviewed | 99.73 | |
| PRK07008 | 539 | long-chain-fatty-acid--CoA ligase; Validated | 99.73 | |
| PLN02479 | 567 | acetate-CoA ligase | 99.73 | |
| PRK07768 | 545 | long-chain-fatty-acid--CoA ligase; Validated | 99.73 | |
| PLN03102 | 579 | acyl-activating enzyme; Provisional | 99.72 | |
| PRK08162 | 545 | acyl-CoA synthetase; Validated | 99.71 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 99.71 | |
| KOG1175 | 626 | consensus Acyl-CoA synthetase [Lipid transport and | 99.69 | |
| PRK05620 | 576 | long-chain-fatty-acid--CoA ligase; Validated | 99.69 | |
| PRK09029 | 458 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.66 | |
| PRK06018 | 542 | putative acyl-CoA synthetase; Provisional | 99.65 | |
| PLN03052 | 728 | acetate--CoA ligase; Provisional | 99.65 | |
| TIGR01923 | 436 | menE O-succinylbenzoate-CoA ligase. This model rep | 99.65 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 99.63 | |
| PRK08279 | 600 | long-chain-acyl-CoA synthetase; Validated | 99.6 | |
| COG1020 | 642 | EntF Non-ribosomal peptide synthetase modules and | 99.58 | |
| PRK07798 | 533 | acyl-CoA synthetase; Validated | 99.56 | |
| PRK07824 | 358 | O-succinylbenzoic acid--CoA ligase; Provisional | 99.56 | |
| PRK08308 | 414 | acyl-CoA synthetase; Validated | 99.29 | |
| TIGR02155 | 422 | PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet | 99.11 | |
| TIGR03335 | 445 | F390_ftsA coenzyme F390 synthetase. This enzyme, c | 98.39 | |
| KOG1179 | 649 | consensus Very long-chain acyl-CoA synthetase/fatt | 98.25 | |
| PTZ00297 | 1452 | pantothenate kinase; Provisional | 98.08 | |
| KOG3628 | 1363 | consensus Predicted AMP-binding protein [General f | 97.94 | |
| TIGR02372 | 386 | 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv | 97.69 | |
| KOG1178 | 1032 | consensus Non-ribosomal peptide synthetase/alpha-a | 97.65 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 97.64 | |
| COG1541 | 438 | PaaK Coenzyme F390 synthetase [Coenzyme metabolism | 97.24 | |
| KOG3628 | 1363 | consensus Predicted AMP-binding protein [General f | 97.18 | |
| PF04443 | 365 | LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR | 95.4 | |
| TIGR02304 | 430 | aden_form_hyp probable adenylate-forming enzyme. M | 85.98 |
| >KOG1176 consensus Acyl-CoA synthetase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.94 E-value=3.2e-27 Score=187.92 Aligned_cols=106 Identities=36% Similarity=0.523 Sum_probs=95.3
Q ss_pred CCCCCcccccccCCCCCCCCCCCCccccCCCCcEEEEEcCCCCccCCCCCCeEEEEEcCccccccccccCCCchhhHHHH
Q 032813 1 MTEAGPVLSMCLGFAKQPFPTKSGSCGTVVRNAELKVIDPEIGASLPHNQPGEICIRGPQIMKVAELEFWSDGGHDEEII 80 (133)
Q Consensus 1 ~TE~~~~~~~~~~~~~~~~~~~~~~vG~p~p~~~v~i~d~~~g~~~~~g~~Gel~i~gp~~~~GY~~~~~~~~~~t~~~f 80 (133)
|||+++.++.+... +. .+++++|+++++.+++|.+ ++|+.+++++.||||++|+++|.|| |+||++|++.|
T Consensus 334 mTE~~~~~~~~~~~---~e-~k~~svG~~~~g~~~~v~~-e~g~~l~~~~~GEI~vrg~~imkGY----~~NpeaT~~~~ 404 (537)
T KOG1176|consen 334 MTEAGGLITSNDWG---PE-RKPGSVGRLLPGVRVKVLD-ETGVSLGPNQTGEICVRGPQVMKGY----LKNPEATKEAF 404 (537)
T ss_pred cccccCceeecCCC---cc-CcccccCccccceEEEeeC-CCCCCCCCCCceEEEEECcccchhh----cCChHHHHhhc
Confidence 79999777766431 11 5889999999999999888 8999999999999999999999999 99999999999
Q ss_pred hhhhcccCCCCcccccccCCCCCCCCcEEEEcCCCeE-EEeecCCeEEeCCCC
Q 032813 81 KLNRLTMGSSLGWASKAQAEPGRWAFDLALRTRAGYE-LKKRKKVWVRFDPLF 132 (133)
Q Consensus 81 ~~~~~~~~~~~gw~~t~~~~~~~~tGD~g~~d~dG~l-~~GR~dd~Iki~~~~ 132 (133)
. ++||||| ||+|++|+||+| |++|+||+||.+|..
T Consensus 405 ~--------~~GW~~T---------GDiGy~D~DG~l~IvdR~KdlIk~~G~q 440 (537)
T KOG1176|consen 405 D--------DDGWFHT---------GDLGYFDEDGYLYIVDRSKDLIKYGGEQ 440 (537)
T ss_pred c--------cCCcccc---------CceEEEcCCCeEEEecchhhheeeCCEE
Confidence 6 4599999 999999999999 999999999999864
|
|
| >PLN02614 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG1256 consensus Long-chain acyl-CoA synthetases (AMP-forming) [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02861 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] | Back alignment and domain information |
|---|
| >PTZ00342 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00216 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02574 4-coumarate--CoA ligase-like | Back alignment and domain information |
|---|
| >PLN02736 long-chain acyl-CoA synthetase | Back alignment and domain information |
|---|
| >PLN02387 long-chain-fatty-acid-CoA ligase family protein | Back alignment and domain information |
|---|
| >PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PRK07769 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK12476 putative fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PTZ00237 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02654 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK00174 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN02430 long-chain-fatty-acid-CoA ligase | Back alignment and domain information |
|---|
| >PLN02246 4-coumarate--CoA ligase | Back alignment and domain information |
|---|
| >PRK05677 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK09274 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK07638 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >KOG1177 consensus Long chain fatty acid acyl-CoA ligase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK09088 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12492 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated | Back alignment and domain information |
|---|
| >PRK06164 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06178 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PLN02330 4-coumarate--CoA ligase-like 1 | Back alignment and domain information |
|---|
| >PRK12316 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK06839 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK04319 acetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06145 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06060 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR02316 propion_prpE propionate--CoA ligase | Back alignment and domain information |
|---|
| >PRK05857 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK07514 malonyl-CoA synthase; Validated | Back alignment and domain information |
|---|
| >PRK07059 Long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK12467 peptide synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08315 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PRK07529 AMP-binding domain protein; Validated | Back alignment and domain information |
|---|
| >PLN03051 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02860 o-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >PRK13390 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05691 peptide synthase; Validated | Back alignment and domain information |
|---|
| >PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07788 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05852 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08316 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK10946 entE enterobactin synthase subunit E; Provisional | Back alignment and domain information |
|---|
| >PRK07470 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08314 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK13382 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase | Back alignment and domain information |
|---|
| >PRK08751 putative long-chain fatty acyl CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK10524 prpE propionyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12583 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 | Back alignment and domain information |
|---|
| >TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase | Back alignment and domain information |
|---|
| >PRK07656 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK05605 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07786 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK06087 short chain acyl-CoA synthetase; Reviewed | Back alignment and domain information |
|---|
| >PRK07787 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08180 feruloyl-CoA synthase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01733 AA-adenyl-dom amino acid adenylation domain | Back alignment and domain information |
|---|
| >PRK12582 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06710 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK08974 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >KOG1180 consensus Acyl-CoA synthetase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02262 benz_CoA_lig benzoate-CoA ligase family | Back alignment and domain information |
|---|
| >PRK07867 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06188 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK13388 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK08276 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >TIGR03205 pimA dicarboxylate--CoA ligase PimA | Back alignment and domain information |
|---|
| >TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PRK12406 long-chain-fatty-acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK09192 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase | Back alignment and domain information |
|---|
| >PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK03584 acetoacetyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK13383 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK13391 acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05850 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06187 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed | Back alignment and domain information |
|---|
| >PRK07008 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PLN02479 acetate-CoA ligase | Back alignment and domain information |
|---|
| >PRK07768 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PLN03102 acyl-activating enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK08162 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1175 consensus Acyl-CoA synthetase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05620 long-chain-fatty-acid--CoA ligase; Validated | Back alignment and domain information |
|---|
| >PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK06018 putative acyl-CoA synthetase; Provisional | Back alignment and domain information |
|---|
| >PLN03052 acetate--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR01923 menE O-succinylbenzoate-CoA ligase | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK08279 long-chain-acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK07798 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional | Back alignment and domain information |
|---|
| >PRK08308 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase | Back alignment and domain information |
|---|
| >TIGR03335 F390_ftsA coenzyme F390 synthetase | Back alignment and domain information |
|---|
| >KOG1179 consensus Very long-chain acyl-CoA synthetase/fatty acid transporter [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00297 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3628 consensus Predicted AMP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family | Back alignment and domain information |
|---|
| >KOG1178 consensus Non-ribosomal peptide synthetase/alpha-aminoadipate reductase and related enzymes [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG3628 consensus Predicted AMP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria | Back alignment and domain information |
|---|
| >TIGR02304 aden_form_hyp probable adenylate-forming enzyme | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 133 | ||||
| 3a9u_A | 536 | Crystal Structures And Enzymatic Mechanisms Of A Po | 3e-26 | ||
| 3tsy_A | 979 | 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Pr | 2e-25 | ||
| 3qya_A | 582 | Crystal Structure Of A Red-Emitter Mutant Of Lampyr | 9e-06 | ||
| 1ba3_A | 550 | Firefly Luciferase In Complex With Bromoform Length | 2e-05 | ||
| 3iep_A | 551 | Firefly Luciferase Apo Structure (P41 Form) Length | 2e-05 | ||
| 4g36_A | 555 | Photinus Pyralis Luciferase In The Adenylate-Formin | 2e-05 | ||
| 4g37_A | 555 | Structure Of Cross-Linked Firefly Luciferase In Sec | 3e-04 |
| >pdb|3A9U|A Chain A, Crystal Structures And Enzymatic Mechanisms Of A Populus Tomentosa 4- Coumarate--Coa Ligase Length = 536 | Back alignment and structure |
|
| >pdb|3TSY|A Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Protein Length = 979 | Back alignment and structure |
| >pdb|3QYA|A Chain A, Crystal Structure Of A Red-Emitter Mutant Of Lampyris Turkestanicus Luciferase Length = 582 | Back alignment and structure |
| >pdb|1BA3|A Chain A, Firefly Luciferase In Complex With Bromoform Length = 550 | Back alignment and structure |
| >pdb|3IEP|A Chain A, Firefly Luciferase Apo Structure (P41 Form) Length = 551 | Back alignment and structure |
| >pdb|4G36|A Chain A, Photinus Pyralis Luciferase In The Adenylate-Forming Conformation Bound To Dlsa Length = 555 | Back alignment and structure |
| >pdb|4G37|A Chain A, Structure Of Cross-Linked Firefly Luciferase In Second Catalytic Conformation Length = 555 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 133 | |||
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 6e-29 | |
| 3ni2_A | 536 | 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy | 1e-28 | |
| 3g7s_A | 549 | Long-chain-fatty-acid--COA ligase (FADD-1); protei | 9e-25 | |
| 2d1s_A | 548 | Luciferase, luciferin 4-monooxygenase; alpha/beta, | 6e-24 | |
| 3rix_A | 550 | Luciferase, luciferin 4-monooxygenase; oxidoreduct | 9e-24 | |
| 4fuq_A | 503 | Malonyl COA synthetase; ANL superfamily, methylma | 8e-17 | |
| 3ivr_A | 509 | Putative long-chain-fatty-acid COA ligase; structu | 1e-14 | |
| 3r44_A | 517 | Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s | 4e-13 | |
| 3nyq_A | 505 | Malonyl-COA ligase; A/B topology ababa sandwich be | 8e-13 | |
| 1t5h_X | 504 | 4-chlorobenzoyl COA ligase; adenylate-forming coen | 1e-12 | |
| 3ipl_A | 501 | 2-succinylbenzoate--COA ligase; structural genomic | 3e-12 | |
| 2v7b_A | 529 | Benzoate-coenzyme A ligase; benzoate oxidation, be | 2e-11 | |
| 3o83_A | 544 | Peptide arylation enzyme; ligase, adenylation of 2 | 1e-09 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 1e-09 | |
| 1mdb_A | 539 | 2,3-dihydroxybenzoate-AMP ligase; adenylation doma | 3e-09 | |
| 3kxw_A | 590 | Saframycin MX1 synthetase B; fatty acid AMP ligase | 1e-05 | |
| 1v25_A | 541 | Long-chain-fatty-acid-COA synthetase; ligase, stru | 2e-05 | |
| 3gqw_A | 576 | Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen | 3e-05 | |
| 3t5a_A | 480 | Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C | 3e-05 | |
| 3c5e_A | 570 | Acyl-coenzyme A synthetase ACSM2A, mitochondrial; | 3e-05 | |
| 3etc_A | 580 | AMP-binding protein; adenylate-forming acyl-COA sy | 9e-04 |
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 | Back alignment and structure |
|---|
Score = 108 bits (273), Expect = 6e-29
Identities = 49/63 (77%), Positives = 56/63 (88%)
Query: 1 MTEAGPVLSMCLGFAKQPFPTKSGSCGTVVRNAELKVIDPEIGASLPHNQPGEICIRGPQ 60
MTEAGPVL+M LGFAK+PFP KSG+CGTVVRNAE+K++DP+ G SL NQPGEICIRG Q
Sbjct: 379 MTEAGPVLAMSLGFAKEPFPVKSGACGTVVRNAEMKIVDPDTGDSLSRNQPGEICIRGHQ 438
Query: 61 IMK 63
IMK
Sbjct: 439 IMK 441
|
| >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 | Back alignment and structure |
|---|
| >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 | Back alignment and structure |
|---|
| >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 | Back alignment and structure |
|---|
| >3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} PDB: 1ba3_A 1lci_A* 3ies_A* 3iep_A* 3ier_A* 3qya_A Length = 550 | Back alignment and structure |
|---|
| >4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* Length = 503 | Back alignment and structure |
|---|
| >3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} Length = 509 | Back alignment and structure |
|---|
| >3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Length = 517 | Back alignment and structure |
|---|
| >3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Length = 505 | Back alignment and structure |
|---|
| >1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Length = 504 | Back alignment and structure |
|---|
| >3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 501 | Back alignment and structure |
|---|
| >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Length = 529 | Back alignment and structure |
|---|
| >3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 | Back alignment and structure |
|---|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Length = 617 | Back alignment and structure |
|---|
| >1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 | Back alignment and structure |
|---|
| >3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Length = 590 | Back alignment and structure |
|---|
| >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Length = 541 | Back alignment and structure |
|---|
| >3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Length = 480 | Back alignment and structure |
|---|
| >3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 | Back alignment and structure |
|---|
| >3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| 3ni2_A | 536 | 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy | 99.94 | |
| 4fuq_A | 503 | Malonyl COA synthetase; ANL superfamily, methylma | 99.93 | |
| 4gr5_A | 570 | Non-ribosomal peptide synthetase; MBTH-like domain | 99.93 | |
| 3rix_A | 550 | Luciferase, luciferin 4-monooxygenase; oxidoreduct | 99.93 | |
| 1amu_A | 563 | GRSA, gramicidin synthetase 1; peptide synthetase, | 99.92 | |
| 2d1s_A | 548 | Luciferase, luciferin 4-monooxygenase; alpha/beta, | 99.92 | |
| 3tsy_A | 979 | Fusion protein 4-coumarate--COA ligase 1, resvera | 99.92 | |
| 3etc_A | 580 | AMP-binding protein; adenylate-forming acyl-COA sy | 99.92 | |
| 3g7s_A | 549 | Long-chain-fatty-acid--COA ligase (FADD-1); protei | 99.92 | |
| 3l8c_A | 521 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.92 | |
| 4dg8_A | 620 | PA1221; ANL superfamily, adenylation domain, pepti | 99.91 | |
| 3nyq_A | 505 | Malonyl-COA ligase; A/B topology ababa sandwich be | 99.91 | |
| 1mdb_A | 539 | 2,3-dihydroxybenzoate-AMP ligase; adenylation doma | 99.91 | |
| 2v7b_A | 529 | Benzoate-coenzyme A ligase; benzoate oxidation, be | 99.91 | |
| 3o83_A | 544 | Peptide arylation enzyme; ligase, adenylation of 2 | 99.91 | |
| 3c5e_A | 570 | Acyl-coenzyme A synthetase ACSM2A, mitochondrial; | 99.91 | |
| 3ite_A | 562 | SIDN siderophore synthetase; ligase, non-ribosomal | 99.9 | |
| 1pg4_A | 652 | Acetyl-COA synthetase; AMP-forming, adenylate-form | 99.9 | |
| 3ivr_A | 509 | Putative long-chain-fatty-acid COA ligase; structu | 99.9 | |
| 3e7w_A | 511 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.9 | |
| 2vsq_A | 1304 | Surfactin synthetase subunit 3; ligase, peptidyl c | 99.9 | |
| 1v25_A | 541 | Long-chain-fatty-acid-COA synthetase; ligase, stru | 99.9 | |
| 3r44_A | 517 | Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s | 99.9 | |
| 3fce_A | 512 | D-alanine--poly(phosphoribitol) ligase subunit 1; | 99.9 | |
| 3rg2_A | 617 | Enterobactin synthase component E (ENTE), 2,3-DIH | 99.9 | |
| 3kxw_A | 590 | Saframycin MX1 synthetase B; fatty acid AMP ligase | 99.89 | |
| 3gqw_A | 576 | Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen | 99.89 | |
| 1ry2_A | 663 | Acetyl-coenzyme A synthetase 1, acyl-activating en | 99.89 | |
| 1t5h_X | 504 | 4-chlorobenzoyl COA ligase; adenylate-forming coen | 99.88 | |
| 3t5a_A | 480 | Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C | 99.85 | |
| 3ipl_A | 501 | 2-succinylbenzoate--COA ligase; structural genomic | 99.85 | |
| 3qov_A | 436 | Phenylacetate-coenzyme A ligase; acetyl-COA synthe | 99.58 | |
| 2y27_A | 437 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.51 | |
| 2y4o_A | 443 | Phenylacetate-coenzyme A ligase; phenylacetic acid | 99.49 | |
| 4gs5_A | 358 | Acyl-COA synthetase (AMP-forming)/AMP-acid ligase | 99.46 | |
| 3hgu_A | 369 | EHPF; phenazine, antibiotic, biosynthetic protein; | 98.8 | |
| 4eql_A | 581 | 4-substituted benzoates-glutamate ligase GH3.12; f | 94.16 | |
| 4b2g_A | 609 | GH3-1 auxin conjugating enzyme; signaling protein, | 93.87 | |
| 4epl_A | 581 | Jasmonic acid-amido synthetase JAR1; ANL adenylati | 92.26 |
| >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* | Back alignment and structure |
|---|
Probab=99.94 E-value=4.4e-27 Score=185.80 Aligned_cols=111 Identities=51% Similarity=0.847 Sum_probs=96.5
Q ss_pred CCCCCcccccccCCCCCCCCCCCCccccCCCCcEEEEEcCCCCccCCCCCCeEEEEEcCccccccccccCCCchhhHHHH
Q 032813 1 MTEAGPVLSMCLGFAKQPFPTKSGSCGTVVRNAELKVIDPEIGASLPHNQPGEICIRGPQIMKVAELEFWSDGGHDEEII 80 (133)
Q Consensus 1 ~TE~~~~~~~~~~~~~~~~~~~~~~vG~p~p~~~v~i~d~~~g~~~~~g~~Gel~i~gp~~~~GY~~~~~~~~~~t~~~f 80 (133)
+||++.+++............+.+++|+|+++++++|+|++++++++.|+.|||+|+||+++.|| |++|+.|++.|
T Consensus 332 ~TE~~~~~~~~~~~~~~~~~~~~~~~G~~~~~~~~~i~d~~~~~~~~~g~~GEl~v~g~~v~~GY----~~~p~~t~~~~ 407 (536)
T 3ni2_A 332 MTEAGPVLAMCLAFAKEPFDIKPGACGTVVRNAEMKIVDPETGASLPRNQPGEICIRGDQIMKGY----LNDPEATSRTI 407 (536)
T ss_dssp CGGGSSEEEECGGGSSSCCCCCTTCCCEECSSCEEEEECTTTCCBCCTTCCEEEEEESTTSCSEE----TTCHHHHHHHB
T ss_pred ccccchhhhcccccCCccccCCCCCeeEeCCCcEEEEEeCCCCcCCCCCCccEEEEeCcccchhh----cCChhHHHhhc
Confidence 69998765544222223334567899999999999999988899999999999999999999999 99999999999
Q ss_pred hhhhcccCCCCcccccccCCCCCCCCcEEEEcCCCeE-EEeecCCeEEeCCCC
Q 032813 81 KLNRLTMGSSLGWASKAQAEPGRWAFDLALRTRAGYE-LKKRKKVWVRFDPLF 132 (133)
Q Consensus 81 ~~~~~~~~~~~gw~~t~~~~~~~~tGD~g~~d~dG~l-~~GR~dd~Iki~~~~ 132 (133)
. .+|||+| ||+|++|+||+| |+||+|||||++|.+
T Consensus 408 ~--------~~g~~~T---------GDl~~~~~dG~l~~~GR~dd~ik~~G~~ 443 (536)
T 3ni2_A 408 D--------KEGWLHT---------GDIGYIDDDDELFIVDRLKELIKYKGFQ 443 (536)
T ss_dssp C--------TTSCEEE---------EEEEEECTTSCEEEEEECSCCEEETTEE
T ss_pred c--------CCCceEc---------ccEEEEcCCceEEEEecccceEEECCEE
Confidence 5 5799999 999999999999 999999999999864
|
| >4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* | Back alignment and structure |
|---|
| >4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A | Back alignment and structure |
|---|
| >3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A | Back alignment and structure |
|---|
| >1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* | Back alignment and structure |
|---|
| >3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} | Back alignment and structure |
|---|
| >3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} | Back alignment and structure |
|---|
| >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} | Back alignment and structure |
|---|
| >3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* | Back alignment and structure |
|---|
| >4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* | Back alignment and structure |
|---|
| >3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* | Back alignment and structure |
|---|
| >1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A | Back alignment and structure |
|---|
| >2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* | Back alignment and structure |
|---|
| >3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* | Back alignment and structure |
|---|
| >3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} | Back alignment and structure |
|---|
| >1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* | Back alignment and structure |
|---|
| >3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 | Back alignment and structure |
|---|
| >3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* | Back alignment and structure |
|---|
| >2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* | Back alignment and structure |
|---|
| >3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A | Back alignment and structure |
|---|
| >3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* | Back alignment and structure |
|---|
| >3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* | Back alignment and structure |
|---|
| >1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 | Back alignment and structure |
|---|
| >1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* | Back alignment and structure |
|---|
| >3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A | Back alignment and structure |
|---|
| >3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* | Back alignment and structure |
|---|
| >2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* | Back alignment and structure |
|---|
| >2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} | Back alignment and structure |
|---|
| >4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* | Back alignment and structure |
|---|
| >4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* | Back alignment and structure |
|---|
| >4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} | Back alignment and structure |
|---|
| >4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 133 | ||||
| d1lcia_ | 541 | e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali | 5e-10 | |
| d1pg4a_ | 643 | e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en | 2e-08 | |
| d1v25a_ | 534 | e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 | 2e-06 | |
| d1amua_ | 514 | e.23.1.1 (A:) Phenylalanine activating domain of g | 2e-04 | |
| d1mdba_ | 536 | e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B | 4e-04 | |
| d1ry2a_ | 640 | e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast | 4e-04 |
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Luciferase species: Firefly (Photinus pyralis) [TaxId: 7054]
Score = 53.8 bits (128), Expect = 5e-10
Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 5/63 (7%)
Query: 1 MTEAGPVLSMCLGFAKQPFPTKSGSCGTVVRNAELKVIDPEIGASLPHNQPGEICIRGPQ 60
+TE + + K G+ G VV E KV+D + G +L NQ GE+C+RGP
Sbjct: 339 LTETTSAILIT-----PEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPM 393
Query: 61 IMK 63
IM
Sbjct: 394 IMS 396
|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 | Back information, alignment and structure |
|---|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 | Back information, alignment and structure |
|---|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 133 | |||
| d1lcia_ | 541 | Luciferase {Firefly (Photinus pyralis) [TaxId: 705 | 99.92 | |
| d1pg4a_ | 643 | Acetyl-CoA synthetase {Salmonella enterica [TaxId: | 99.88 | |
| d1v25a_ | 534 | Long chain fatty acid-CoA ligase TT0168 {Thermus t | 99.88 | |
| d1amua_ | 514 | Phenylalanine activating domain of gramicidin synt | 99.86 | |
| d1ry2a_ | 640 | Acetyl-CoA synthetase {Baker's yeast (Saccharomyce | 99.84 | |
| d1mdba_ | 536 | Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil | 99.76 | |
| d3cw9a1 | 503 | 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId | 99.55 |
| >d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Acetyl-CoA synthetase-like superfamily: Acetyl-CoA synthetase-like family: Acetyl-CoA synthetase-like domain: Luciferase species: Firefly (Photinus pyralis) [TaxId: 7054]
Probab=99.92 E-value=1.1e-25 Score=173.86 Aligned_cols=106 Identities=28% Similarity=0.410 Sum_probs=87.9
Q ss_pred CCCCCcccccccCCCCCCCCCCCCccccCCCCcEEEEEcCCCCccCCCCCCeEEEEEcCccccccccccCCCchhhHHHH
Q 032813 1 MTEAGPVLSMCLGFAKQPFPTKSGSCGTVVRNAELKVIDPEIGASLPHNQPGEICIRGPQIMKVAELEFWSDGGHDEEII 80 (133)
Q Consensus 1 ~TE~~~~~~~~~~~~~~~~~~~~~~vG~p~p~~~v~i~d~~~g~~~~~g~~Gel~i~gp~~~~GY~~~~~~~~~~t~~~f 80 (133)
|||++..++.... ...+.+++|+|+|+++++|+|++++++++.|+.|||+|+|++++.|| |++++.+...+
T Consensus 339 ~TE~~~~~~~~~~-----~~~~~~svG~p~~~~~~~i~d~d~~~~~~~g~~Gel~v~g~~~~~gY----~~~~~~~~~~~ 409 (541)
T d1lcia_ 339 LTETTSAILITPE-----GDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGY----VNNPEATNALI 409 (541)
T ss_dssp CGGGSSCSEECCC-----C---CCCCBEECTTCEEEEECTTTCCBCCTTCCEEEEEESTTSCSEE----TTBHHHHHHHB
T ss_pred ccccCceEEecCc-----ccCCCCccccccCCCEEEEEECCCCcCCCCCCeEEEEEccCccCCee----CCChhhhhhcc
Confidence 6899877766532 24567899999999999999988899999999999999999999999 99999888877
Q ss_pred hhhhcccCCCCcccccccCCCCCCCCcEEEEcCCCeE-EEeecCCeEEeCCCC
Q 032813 81 KLNRLTMGSSLGWASKAQAEPGRWAFDLALRTRAGYE-LKKRKKVWVRFDPLF 132 (133)
Q Consensus 81 ~~~~~~~~~~~gw~~t~~~~~~~~tGD~g~~d~dG~l-~~GR~dd~Iki~~~~ 132 (133)
. .++||+| ||+|++|++|++ ++||+||+||++|.+
T Consensus 410 ~--------~~~~~~T---------GDl~~~~~~G~~~~~GR~~d~i~~~G~~ 445 (541)
T d1lcia_ 410 D--------KDGWLHS---------GDIAYWDEDEHFFIVDRLKSLIKYKGYQ 445 (541)
T ss_dssp C--------TTSCEEE---------EEEEEECTTCCEEEC-----CEEETTEE
T ss_pred c--------CCccccC---------CCeeEEcCCeEEEEeeeecCEEEECCEE
Confidence 5 5799999 999999999999 999999999999864
|
| >d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} | Back information, alignment and structure |
|---|
| >d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|