Citrus Sinensis ID: 032830


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MYAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGVLQDRVNNWRETALILTAILFPAAAIWFIGIFLHSVDKFSEDNEDKVSRIERSKTTPLLEDEKAETTQACAEP
cHHHHHHHHHHHHHHHccccccHHEEEEcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
MYAFLALFAVGELLVfatqgpvnficlhcvkpsirplsMAISTVSIhifgdvpssplvgvLQDRVNNWRETALILTAILFPAAAIWFIGIFLHSvdkfsednedkvsrierskttplledekaettqacaep
MYAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGVLQDRVNNWRETALILTAILFPAAAIWFIGIFLHSVDKFsednedkvsrierskttplledekaettqacaep
MYAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGVLQDRVNNWRETALILTAILFPAAAIWFIGIFLHSVDKFSEDNEDKVSRIERSKTTPLLEDEKAETTQACAEP
*YAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGVLQDRVNNWRETALILTAILFPAAAIWFIGIFLHSVDK***********************************
MYAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGVLQDRVNNWRETALILTAILFPAAAIWFIGIFLHS**************************************
MYAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGVLQDRVNNWRETALILTAILFPAAAIWFIGIFLHSVDKFS*********IERSKTTPLLE*************
MYAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGVLQDRVNNWRETALILTAILFPAAAIWFIGIFLHSVD************************************
ooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSoooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGVLQDRVNNWRETALILTAILFPAAAIWFIGIFLHSVDKFSEDNEDKVSRIERSKTTPLLEDEKAETTQACAEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query132 2.2.26 [Sep-21-2011]
Q9FLG8484 Probable sphingolipid tra yes no 0.893 0.243 0.776 2e-48
F4IKF6510 Probable sphingolipid tra no no 0.818 0.211 0.672 1e-39
Q6NMN6492 Probable sphingolipid tra no no 0.734 0.197 0.701 1e-36
>sp|Q9FLG8|SPNS2_ARATH Probable sphingolipid transporter spinster homolog 2 OS=Arabidopsis thaliana GN=At5g64500 PE=2 SV=1 Back     alignment and function desciption
 Score =  190 bits (482), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 94/121 (77%), Positives = 108/121 (89%), Gaps = 3/121 (2%)

Query: 1   MYAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGV 60
           MYAFLALFAVGELLVFATQGPVNFI LHCVKPS+RPL+MA+STVSIHIFGDVPSSPLVGV
Sbjct: 365 MYAFLALFAVGELLVFATQGPVNFIVLHCVKPSLRPLAMAMSTVSIHIFGDVPSSPLVGV 424

Query: 61  LQDRVNNWRETALILTAILFPAAAIWFIGIFLHSVDKFSEDNE-DKVSRIERSKTTPLLE 119
           LQD VNNWR T+L+LT +LFPAAAIW IGIFL+SVD+++ED+E D V+R   S   PLL+
Sbjct: 425 LQDYVNNWRVTSLVLTFVLFPAAAIWSIGIFLNSVDRYNEDSEPDAVTR--ESTAAPLLQ 482

Query: 120 D 120
           +
Sbjct: 483 E 483




Probable sphingolipid transporter that plays a central role in endosomes and/or lysosomes storage.
Arabidopsis thaliana (taxid: 3702)
>sp|F4IKF6|SPNS3_ARATH Probable sphingolipid transporter spinster homolog 3 OS=Arabidopsis thaliana GN=At2g22730 PE=3 SV=1 Back     alignment and function description
>sp|Q6NMN6|SPNS1_ARATH Probable sphingolipid transporter spinster homolog 1 OS=Arabidopsis thaliana GN=At5g65687 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
255554517 541 transporter, putative [Ricinus communis] 1.0 0.243 0.795 6e-56
296088668 427 unnamed protein product [Vitis vinifera] 0.984 0.304 0.761 4e-55
359496250 466 PREDICTED: protein spinster homolog 1-li 0.984 0.278 0.761 8e-55
356519493 530 PREDICTED: protein spinster homolog 1-li 0.962 0.239 0.763 1e-53
357476101 562 Spinster-like protein [Medicago truncatu 0.977 0.229 0.753 6e-53
356527981 537 PREDICTED: protein spinster homolog 1-li 0.962 0.236 0.755 9e-53
356546730 532 PREDICTED: protein spinster homolog 1-li 0.954 0.236 0.753 2e-52
356557609 496 PREDICTED: LOW QUALITY PROTEIN: protein 0.992 0.264 0.702 7e-49
357446115 525 Spinster-like protein [Medicago truncatu 0.977 0.245 0.674 2e-48
224105833 468 sugar transporter/spinster transmembrane 0.893 0.252 0.756 4e-48
>gi|255554517|ref|XP_002518297.1| transporter, putative [Ricinus communis] gi|223542517|gb|EEF44057.1| transporter, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  221 bits (564), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 105/132 (79%), Positives = 118/132 (89%)

Query: 1   MYAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGV 60
           MY FLALFA+GELLVFATQGPVN+ICLHCVKPS+RPLSMA+S VSIHIFGDVPSSPLVGV
Sbjct: 410 MYVFLALFAIGELLVFATQGPVNYICLHCVKPSMRPLSMAMSIVSIHIFGDVPSSPLVGV 469

Query: 61  LQDRVNNWRETALILTAILFPAAAIWFIGIFLHSVDKFSEDNEDKVSRIERSKTTPLLED 120
           LQD++NNWR TALILTAILFPAA IWFIGIFL SVDKF+E++E +V+  +RS TTPLLE 
Sbjct: 470 LQDKINNWRLTALILTAILFPAAFIWFIGIFLKSVDKFNEESEHQVAVTDRSNTTPLLEG 529

Query: 121 EKAETTQACAEP 132
           + AETT   AEP
Sbjct: 530 KTAETTATSAEP 541




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296088668|emb|CBI38036.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359496250|ref|XP_002264030.2| PREDICTED: protein spinster homolog 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356519493|ref|XP_003528407.1| PREDICTED: protein spinster homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|357476101|ref|XP_003608336.1| Spinster-like protein [Medicago truncatula] gi|355509391|gb|AES90533.1| Spinster-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356527981|ref|XP_003532584.1| PREDICTED: protein spinster homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356546730|ref|XP_003541776.1| PREDICTED: protein spinster homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356557609|ref|XP_003547108.1| PREDICTED: LOW QUALITY PROTEIN: protein spinster homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|357446115|ref|XP_003593335.1| Spinster-like protein [Medicago truncatula] gi|355482383|gb|AES63586.1| Spinster-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224105833|ref|XP_002313948.1| sugar transporter/spinster transmembrane protein [Populus trichocarpa] gi|222850356|gb|EEE87903.1| sugar transporter/spinster transmembrane protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query132
TAIR|locus:2179401484 AT5G64500 "AT5G64500" [Arabido 0.893 0.243 0.776 3.4e-45
TAIR|locus:2066045510 AT2G22730 "AT2G22730" [Arabido 0.75 0.194 0.745 8e-37
TAIR|locus:504954889492 AT5G65687 "AT5G65687" [Arabido 0.856 0.229 0.649 2.7e-36
TAIR|locus:2179401 AT5G64500 "AT5G64500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 475 (172.3 bits), Expect = 3.4e-45, P = 3.4e-45
 Identities = 94/121 (77%), Positives = 108/121 (89%)

Query:     1 MYAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGV 60
             MYAFLALFAVGELLVFATQGPVNFI LHCVKPS+RPL+MA+STVSIHIFGDVPSSPLVGV
Sbjct:   365 MYAFLALFAVGELLVFATQGPVNFIVLHCVKPSLRPLAMAMSTVSIHIFGDVPSSPLVGV 424

Query:    61 LQDRVNNWRETALILTAILFPAAAIWFIGIFLHSVDKFSEDNE-DKVSRIERSKTTPLLE 119
             LQD VNNWR T+L+LT +LFPAAAIW IGIFL+SVD+++ED+E D V+R   S   PLL+
Sbjct:   425 LQDYVNNWRVTSLVLTFVLFPAAAIWSIGIFLNSVDRYNEDSEPDAVTR--ESTAAPLLQ 482

Query:   120 D 120
             +
Sbjct:   483 E 483




GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=ISS
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0016126 "sterol biosynthetic process" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0046520 "sphingoid biosynthetic process" evidence=RCA
TAIR|locus:2066045 AT2G22730 "AT2G22730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504954889 AT5G65687 "AT5G65687" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FLG8SPNS2_ARATHNo assigned EC number0.77680.89390.2438yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
PtrOATP2
sugar transporter/spinster transmembrane protein (468 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query132
TIGR00805633 TIGR00805, oat, sodium-independent organic anion t 2e-04
pfam03137582 pfam03137, OATP, Organic Anion Transporter Polypep 0.002
>gnl|CDD|233136 TIGR00805, oat, sodium-independent organic anion transporter Back     alignment and domain information
 Score = 39.7 bits (93), Expect = 2e-04
 Identities = 19/64 (29%), Positives = 32/64 (50%)

Query: 1   MYAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGV 60
           +  FL LF     + F T  P+  + L  V P  R L++ +  + + +FG +P+  L G+
Sbjct: 518 LLYFLILFIPLSFIAFITAVPLYMVLLRVVNPEERSLAIGLQWLCMRVFGTIPAPILFGL 577

Query: 61  LQDR 64
           L D 
Sbjct: 578 LIDV 581


The Organo Anion Transporter (OAT) Family (TC 2.A.60)Proteins of the OAT family catalyze the Na+-independent facilitated transport of organic anions such as bromosulfobromophthalein and prostaglandins as well as conjugated and unconjugated bile acids (taurocholate and cholate, respectively). These transporters have been characterized in mammals, but homologues are present in C. elegans and A. thaliana. Some of the mammalian proteins exhibit a high degree of tissue specificity. For example, the rat OAT is found at high levels in liver and kidney and at lower levels in other tissues. These proteins possess 10-12 putative a-helical transmembrane spanners. They may catalyze electrogenic anion uniport or anion exchange. Length = 633

>gnl|CDD|217384 pfam03137, OATP, Organic Anion Transporter Polypeptide (OATP) family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 132
KOG3626735 consensus Organic anion transporter [Secondary met 99.34
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.14
TIGR00805633 oat sodium-independent organic anion transporter. 99.12
TIGR00892455 2A0113 monocarboxylate transporter 1. 98.9
KOG1330493 consensus Sugar transporter/spinster transmembrane 98.76
TIGR00893 399 2A0114 d-galactonate transporter. 98.72
PRK11663 434 regulatory protein UhpC; Provisional 98.67
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.62
PRK10489417 enterobactin exporter EntS; Provisional 98.62
PRK03893496 putative sialic acid transporter; Provisional 98.57
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 98.56
TIGR00900 365 2A0121 H+ Antiporter protein. 98.54
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.53
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.52
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.52
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 98.5
TIGR00889418 2A0110 nucleoside transporter. This family of prot 98.49
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 98.49
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 98.49
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 98.47
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 98.45
PRK05122399 major facilitator superfamily transporter; Provisi 98.43
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.42
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 98.42
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.42
PRK03545 390 putative arabinose transporter; Provisional 98.41
PRK14995 495 methyl viologen resistance protein SmvA; Provision 98.41
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 98.37
PRK09584 500 tppB putative tripeptide transporter permease; Rev 98.36
PRK10207 489 dipeptide/tripeptide permease B; Provisional 98.35
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.35
PRK10213 394 nepI ribonucleoside transporter; Reviewed 98.33
PRK11663434 regulatory protein UhpC; Provisional 98.33
KOG1330 493 consensus Sugar transporter/spinster transmembrane 98.32
TIGR00895 398 2A0115 benzoate transport. 98.32
PRK12382392 putative transporter; Provisional 98.31
TIGR00893399 2A0114 d-galactonate transporter. 98.31
TIGR00892 455 2A0113 monocarboxylate transporter 1. 98.27
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.27
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 98.26
PRK10504 471 putative transporter; Provisional 98.26
PRK09874408 drug efflux system protein MdtG; Provisional 98.24
KOG2532 466 consensus Permease of the major facilitator superf 98.24
PRK15403 413 multidrug efflux system protein MdtM; Provisional 98.23
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 98.22
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 98.21
PRK10091 382 MFS transport protein AraJ; Provisional 98.2
PRK11646 400 multidrug resistance protein MdtH; Provisional 98.2
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 98.18
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 98.17
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 98.17
PRK09874 408 drug efflux system protein MdtG; Provisional 98.16
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 98.16
TIGR00891 405 2A0112 putative sialic acid transporter. 98.16
PRK09528420 lacY galactoside permease; Reviewed 98.15
PRK15462 493 dipeptide/tripeptide permease D; Provisional 98.15
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 98.15
PRK10473 392 multidrug efflux system protein MdtL; Provisional 98.14
PRK10489 417 enterobactin exporter EntS; Provisional 98.13
PRK10642490 proline/glycine betaine transporter; Provisional 98.11
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 98.11
PRK03545390 putative arabinose transporter; Provisional 98.11
PRK11010491 ampG muropeptide transporter; Validated 98.1
PRK03893 496 putative sialic acid transporter; Provisional 98.09
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 98.09
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.08
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 98.08
PRK11902 402 ampG muropeptide transporter; Reviewed 98.07
PRK12307 426 putative sialic acid transporter; Provisional 98.07
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 98.06
PRK11010 491 ampG muropeptide transporter; Validated 98.05
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 98.05
KOG2533 495 consensus Permease of the major facilitator superf 98.04
TIGR00805 633 oat sodium-independent organic anion transporter. 98.02
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 97.99
TIGR00891405 2A0112 putative sialic acid transporter. 97.98
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 97.97
TIGR00901 356 2A0125 AmpG-related permease. 97.97
PRK11043 401 putative transporter; Provisional 97.97
PRK15011393 sugar efflux transporter B; Provisional 97.94
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 97.94
PRK05122 399 major facilitator superfamily transporter; Provisi 97.94
PRK11646400 multidrug resistance protein MdtH; Provisional 97.92
PRK11652 394 emrD multidrug resistance protein D; Provisional 97.92
PRK09705 393 cynX putative cyanate transporter; Provisional 97.92
TIGR00881379 2A0104 phosphoglycerate transporter family protein 97.92
PRK12382 392 putative transporter; Provisional 97.9
PRK15011 393 sugar efflux transporter B; Provisional 97.9
PRK09952438 shikimate transporter; Provisional 97.9
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 97.89
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 97.89
PRK10054 395 putative transporter; Provisional 97.88
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 97.88
PRK03699 394 putative transporter; Provisional 97.87
PRK09705393 cynX putative cyanate transporter; Provisional 97.86
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 97.86
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 97.86
PRK10642 490 proline/glycine betaine transporter; Provisional 97.85
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 97.84
PRK15075434 citrate-proton symporter; Provisional 97.84
KOG3762618 consensus Predicted transporter [General function 97.81
PLN00028476 nitrate transmembrane transporter; Provisional 97.8
KOG2504509 consensus Monocarboxylate transporter [Carbohydrat 97.8
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 97.78
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.76
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.76
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 97.76
PRK10077 479 xylE D-xylose transporter XylE; Provisional 97.76
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 97.75
PRK12307426 putative sialic acid transporter; Provisional 97.74
PRK15075 434 citrate-proton symporter; Provisional 97.73
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.73
PRK03633381 putative MFS family transporter protein; Provision 97.73
PRK10504471 putative transporter; Provisional 97.71
PLN00028 476 nitrate transmembrane transporter; Provisional 97.71
TIGR00897402 2A0118 polyol permease family. This family of prot 97.69
PRK10077479 xylE D-xylose transporter XylE; Provisional 97.69
PRK10406 432 alpha-ketoglutarate transporter; Provisional 97.68
PRK11195 393 lysophospholipid transporter LplT; Provisional 97.68
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 97.68
KOG2615 451 consensus Permease of the major facilitator superf 97.67
TIGR00897 402 2A0118 polyol permease family. This family of prot 97.67
TIGR00900365 2A0121 H+ Antiporter protein. 97.67
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 97.66
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 97.64
PRK10406432 alpha-ketoglutarate transporter; Provisional 97.63
PRK09952 438 shikimate transporter; Provisional 97.61
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 97.61
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 97.58
TIGR00898 505 2A0119 cation transport protein. 97.56
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.55
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 97.54
PRK03699394 putative transporter; Provisional 97.53
KOG0255 521 consensus Synaptic vesicle transporter SVOP and re 97.53
TIGR00902382 2A0127 phenyl proprionate permease family protein. 97.52
TIGR00788468 fbt folate/biopterin transporter. The only functio 97.5
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 97.49
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 97.49
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 97.47
TIGR00896 355 CynX cyanate transporter. This family of proteins 97.46
PTZ00207 591 hypothetical protein; Provisional 97.45
KOG3764 464 consensus Vesicular amine transporter [Intracellul 97.4
PRK11902402 ampG muropeptide transporter; Reviewed 97.4
PRK11195393 lysophospholipid transporter LplT; Provisional 97.37
TIGR00898505 2A0119 cation transport protein. 97.36
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 97.35
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.34
PRK10091382 MFS transport protein AraJ; Provisional 97.3
PRK10054395 putative transporter; Provisional 97.28
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 97.21
PRK10429473 melibiose:sodium symporter; Provisional 97.21
PRK10213394 nepI ribonucleoside transporter; Reviewed 97.19
PRK15402406 multidrug efflux system translocase MdfA; Provisio 97.15
TIGR01272310 gluP glucose/galactose transporter. Disruption of 97.15
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.11
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 97.05
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 97.05
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 97.03
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 97.01
PRK09848448 glucuronide transporter; Provisional 97.01
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 96.9
PRK10207489 dipeptide/tripeptide permease B; Provisional 96.85
KOG2504 509 consensus Monocarboxylate transporter [Carbohydrat 96.84
PRK10133 438 L-fucose transporter; Provisional 96.81
COG0738422 FucP Fucose permease [Carbohydrate transport and m 96.79
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 96.75
PRK11043401 putative transporter; Provisional 96.71
TIGR00895398 2A0115 benzoate transport. 96.68
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 96.67
PRK03633 381 putative MFS family transporter protein; Provision 96.67
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 96.66
KOG4686459 consensus Predicted sugar transporter [Carbohydrat 96.63
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 96.44
PRK09528 420 lacY galactoside permease; Reviewed 96.42
PRK09584500 tppB putative tripeptide transporter permease; Rev 96.37
PRK10133438 L-fucose transporter; Provisional 96.27
COG2270438 Permeases of the major facilitator superfamily [Ge 96.25
PRK09669444 putative symporter YagG; Provisional 96.24
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 96.14
TIGR00788 468 fbt folate/biopterin transporter. The only functio 96.12
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 95.89
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 95.88
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 95.72
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 95.66
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 95.57
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 95.52
KOG2532466 consensus Permease of the major facilitator superf 95.49
PRK11462460 putative transporter; Provisional 95.41
PRK14995495 methyl viologen resistance protein SmvA; Provision 95.33
PRK10473392 multidrug efflux system protein MdtL; Provisional 95.24
COG2807395 CynX Cyanate permease [Inorganic ion transport and 95.06
PRK09669 444 putative symporter YagG; Provisional 95.06
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 95.05
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 95.02
TIGR00896355 CynX cyanate transporter. This family of proteins 94.92
PRK15462493 dipeptide/tripeptide permease D; Provisional 94.9
KOG0252538 consensus Inorganic phosphate transporter [Inorgan 94.78
PF13347 428 MFS_2: MFS/sugar transport protein 94.77
KOG2816 463 consensus Predicted transporter ADD1 (major facili 94.76
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 94.7
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 94.63
PRK11652394 emrD multidrug resistance protein D; Provisional 94.58
KOG0569 485 consensus Permease of the major facilitator superf 94.55
KOG3764464 consensus Vesicular amine transporter [Intracellul 94.48
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 94.28
KOG3626 735 consensus Organic anion transporter [Secondary met 94.21
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 94.0
PRK11462 460 putative transporter; Provisional 93.99
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 93.92
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 93.69
PRK14778186 lipoprotein signal peptidase; Provisional 93.65
PF13347428 MFS_2: MFS/sugar transport protein 93.43
KOG2533495 consensus Permease of the major facilitator superf 93.33
PRK10429 473 melibiose:sodium symporter; Provisional 93.17
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 92.98
PTZ00207591 hypothetical protein; Provisional 92.85
KOG0254 513 consensus Predicted transporter (major facilitator 92.45
COG0477 338 ProP Permeases of the major facilitator superfamil 91.85
COG2211467 MelB Na+/melibiose symporter and related transport 91.83
KOG2325 488 consensus Predicted transporter/transmembrane prot 91.74
PRK15403413 multidrug efflux system protein MdtM; Provisional 91.62
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 91.53
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 91.34
PF1283277 MFS_1_like: MFS_1 like family 90.66
KOG0569485 consensus Permease of the major facilitator superf 90.58
TIGR00901356 2A0125 AmpG-related permease. 90.54
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 89.92
COG2211 467 MelB Na+/melibiose symporter and related transport 89.76
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 89.59
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 88.63
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 88.22
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 88.04
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 87.13
PF12273130 RCR: Chitin synthesis regulation, resistance to Co 86.61
PF1506158 DUF4538: Domain of unknown function (DUF4538) 86.07
KOG0254 513 consensus Predicted transporter (major facilitator 84.5
KOG0253528 consensus Synaptic vesicle transporter SV2 (major 83.91
PRK09848 448 glucuronide transporter; Provisional 83.89
PF00939 471 Na_sulph_symp: Sodium:sulfate symporter transmembr 82.92
PF03219491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 82.48
PRK14794136 lipoprotein signal peptidase; Provisional 82.09
PF1111877 DUF2627: Protein of unknown function (DUF2627); In 81.81
KOG2816463 consensus Predicted transporter ADD1 (major facili 81.45
KOG0255521 consensus Synaptic vesicle transporter SVOP and re 81.42
PRK14772190 lipoprotein signal peptidase; Provisional 80.59
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=99.34  E-value=3.4e-12  Score=112.33  Aligned_cols=93  Identities=28%  Similarity=0.459  Sum_probs=77.2

Q ss_pred             HHHHHHHHHHHHHHhcchhHHHHHhHhhcCCCCchHHHHHHHHHHHhhcccchHHHHHHHHHhh----------------
Q 032830            2 YAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGVLQDRV----------------   65 (132)
Q Consensus         2 ~~~~~~~~l~~~~~~~~~~~~~~ii~~~vp~~~R~~a~gi~~l~~~llG~~~gP~i~G~l~D~~----------------   65 (132)
                      +.|+++++++.|+.+....|...+++|+||+++|+.|+|+..++.+++|.+|+|+++|+++|..                
T Consensus       587 ~~Fl~~~~~~sf~~~~~~~p~~~i~LR~V~~e~ks~AlG~~~~~irllg~IPsPIifG~~ID~tCl~W~~~C~~~GsC~i  666 (735)
T KOG3626|consen  587 LIFLALFAIGSFIGALGAVPGMLIVLRCVPPEEKSFALGFQWMLIRLLGFIPSPIIFGAVIDTTCLLWGKSCGSRGSCLI  666 (735)
T ss_pred             HHHHHHHHHHHHHHHhccCcceEEEEEccCchhchhhhHHHHHHHHHHhcCCchHhhhhhHhhHHHHhhcccCCCCceee
Confidence            5789999999999999999999999999999999999999999999999999999999999985                


Q ss_pred             ---hhHHHHHHHHHHHHHH-HHHHHHHHHHHhh
Q 032830           66 ---NNWRETALILTAILFP-AAAIWFIGIFLHS   94 (132)
Q Consensus        66 ---g~~r~a~~~~~~~~iv-~~~~~~~~~~~~~   94 (132)
                         ..+|+.|..+.+.+.. +.+.+.+.++..|
T Consensus       667 Yd~~~lr~~y~gl~~~~~~~~~i~~i~~~~v~r  699 (735)
T KOG3626|consen  667 YDNDSLRYRYLGLHIILKVIALILLIIDLYVWR  699 (735)
T ss_pred             echHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence               1299988776555533 4444444444333



>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>KOG1330 consensus Sugar transporter/spinster transmembrane protein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>KOG3762 consensus Predicted transporter [General function prediction only] Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG2615 consensus Permease of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG2504 consensus Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG4686 consensus Predicted sugar transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>KOG2532 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG0252 consensus Inorganic phosphate transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3764 consensus Vesicular amine transporter [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14778 lipoprotein signal peptidase; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>KOG2533 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2325 consensus Predicted transporter/transmembrane protein [General function prediction only] Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>KOG0569 consensus Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>PF12273 RCR: Chitin synthesis regulation, resistance to Congo red; InterPro: IPR020999 RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls Back     alignment and domain information
>PF15061 DUF4538: Domain of unknown function (DUF4538) Back     alignment and domain information
>KOG0254 consensus Predicted transporter (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG0253 consensus Synaptic vesicle transporter SV2 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PF00939 Na_sulph_symp: Sodium:sulfate symporter transmembrane region; InterPro: IPR001898 Integral membrane proteins that mediate the intake of a wide variety of molecules with the concomitant uptake of sodium ions (sodium symporters) can be grouped, on the basis of sequence and functional similarities into a number of distinct families Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>PRK14794 lipoprotein signal peptidase; Provisional Back     alignment and domain information
>PF11118 DUF2627: Protein of unknown function (DUF2627); InterPro: IPR020138 This entry represents uncharacterised membrane proteins with no known function Back     alignment and domain information
>KOG2816 consensus Predicted transporter ADD1 (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>KOG0255 consensus Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) [General function prediction only] Back     alignment and domain information
>PRK14772 lipoprotein signal peptidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 98.77
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 98.74
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 98.69
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 98.46
2xut_A 524 Proton/peptide symporter family protein; transport 98.38
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 98.29
2xut_A524 Proton/peptide symporter family protein; transport 98.12
2cfq_A417 Lactose permease; transport, transport mechanism, 98.05
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 98.0
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 97.45
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 97.34
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 97.23
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 96.54
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
Probab=98.77  E-value=1.6e-08  Score=79.86  Aligned_cols=80  Identities=10%  Similarity=0.030  Sum_probs=66.4

Q ss_pred             HHHHHHHHHHHHHHhcchhHHHHHhHhhcCCCCchHHHHHHHHHHHhhcccchHHHHHHHHHhhhhHHHHHHHHHHHHHH
Q 032830            2 YAFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGVLQDRVNNWRETALILTAILFP   81 (132)
Q Consensus         2 ~~~~~~~~l~~~~~~~~~~~~~~ii~~~vp~~~R~~a~gi~~l~~~llG~~~gP~i~G~l~D~~g~~r~a~~~~~~~~iv   81 (132)
                      +.+++..++.+++.+...+...+.+.+++|+++|++++++.....+ +|..+||.+.|++.+.+|+||+.|++.++..++
T Consensus       120 ~~l~~~~~l~G~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~-~g~~~g~~~~~~l~~~~g~w~~~f~~~~~~~~~  198 (451)
T 1pw4_A          120 AVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHN-VGGGIPPLLFLLGMAWFNDWHAALYMPAFCAIL  198 (451)
T ss_dssp             SHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHH-HHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhhccchHHHHHHHHCCchhhhHHHHHHHHHHH-HHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHH
Confidence            3456667777888888888899999999999999999999998875 788999999999998876699999887654444


Q ss_pred             H
Q 032830           82 A   82 (132)
Q Consensus        82 ~   82 (132)
                      .
T Consensus       199 ~  199 (451)
T 1pw4_A          199 V  199 (451)
T ss_dssp             H
T ss_pred             H
Confidence            3



>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query132
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.88
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.86
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 98.73
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 92.29
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=98.88  E-value=4.3e-09  Score=80.47  Aligned_cols=83  Identities=13%  Similarity=0.145  Sum_probs=64.4

Q ss_pred             HHHHHHHHHHHHHhcchhHHHHHhHhhcCCCCchHHHHHHHHHHHhhcccchHHHHHHHHHhhhhHHHHHHHHHHHHHHH
Q 032830            3 AFLALFAVGELLVFATQGPVNFICLHCVKPSIRPLSMAISTVSIHIFGDVPSSPLVGVLQDRVNNWRETALILTAILFPA   82 (132)
Q Consensus         3 ~~~~~~~l~~~~~~~~~~~~~~ii~~~vp~~~R~~a~gi~~l~~~llG~~~gP~i~G~l~D~~g~~r~a~~~~~~~~iv~   82 (132)
                      +.++++++.++......+..+....+.+|++.|++++|+.++..++.|...+|++.|++.|++| |+..+.+.....+++
T Consensus       345 ~~~~~~~~~g~~~~~~~~~~~~~~~~~~p~~~~g~~~g~~~~~~~~~g~~~~~~~~g~~~~~~g-~~~~~~~~~~~~~~~  423 (447)
T d1pw4a_         345 VDMICMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVAASAIVGYTVDFFG-WDGGFMVMIGGSILA  423 (447)
T ss_dssp             HHHHHHHHHHHHHTHHHHHHHHHHHHTSCTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSC-SHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC-hHHHHHHHHHHHHHH
Confidence            3444555556666666677778889999999999999999888776677789999999999999 999988776555555


Q ss_pred             HHHH
Q 032830           83 AAIW   86 (132)
Q Consensus        83 ~~~~   86 (132)
                      .+++
T Consensus       424 ~~~~  427 (447)
T d1pw4a_         424 VILL  427 (447)
T ss_dssp             HHHH
T ss_pred             HHHH
Confidence            4443



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure