Citrus Sinensis ID: 032870

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MLASDDGPPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGTGRGGDSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGNVNNIIVLLY
cccccccccEEEEEccccEEEEEEEccccHHHHHHHHHHHHcccccccEEEEEccccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEcccccccccccccHHEccc
cccccccccEEEEEEccccEEEEEccHHccHHHHHHHHHHHcccccccEccEEEcccEEEEcccccccccccEccEccEcccccHccccccccEEEEcccccccEcccEEEEccccHHHccccEEEEEEEc
mlasddgppevtletsmgsFTVELyykhsprtcrnfaelsrrgyynnskfHRIIKDFIvqggdptgtgrggdsiyghvfedeikpelkhtgAGILSmanagpntngsqFFITlapashldgnvnnIIVLLY
mlasddgppevtletsmgSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGTGRGGDSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLapashldgnvNNIIVLLY
MLASDDGPPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQggdptgtgrggdSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGNVNNIIVLLY
*****************GSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGTGRGGDSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGNVNNIIVLL*
************LETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGTGRGGDSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGNVN***V*LY
**********VTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGTGRGGDSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGNVNNIIVLLY
******GPPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGTGRGGDSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGNVNNIIVLLY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLASDDGPPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGTGRGGDSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGNVNNIIVLLY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
Q9D0W5166 Peptidyl-prolyl cis-trans yes no 0.877 0.692 0.747 5e-49
Q9Y3C6166 Peptidyl-prolyl cis-trans yes no 0.877 0.692 0.747 6e-49
Q5E992166 Peptidyl-prolyl cis-trans yes no 0.877 0.692 0.747 6e-49
Q7SF72163 Peptidyl-prolyl cis-trans N/A no 0.862 0.693 0.734 2e-46
Q5ASQ0162 Peptidyl-prolyl cis-trans yes no 0.854 0.691 0.758 3e-46
Q4WCR3161 Peptidyl-prolyl cis-trans yes no 0.854 0.695 0.758 6e-46
P0C1I4165 Peptidyl-prolyl cis-trans N/A no 0.854 0.678 0.741 1e-45
Q2U6U0161 Peptidyl-prolyl cis-trans yes no 0.854 0.695 0.741 2e-45
Q8X191162 Peptidyl-prolyl cis-trans yes no 0.854 0.691 0.75 3e-45
Q4I1Y1162 Peptidyl-prolyl cis-trans yes no 0.854 0.691 0.723 3e-44
>sp|Q9D0W5|PPIL1_MOUSE Peptidyl-prolyl cis-trans isomerase-like 1 OS=Mus musculus GN=Ppil1 PE=2 SV=1 Back     alignment and function desciption
 Score =  192 bits (488), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 86/115 (74%), Positives = 100/115 (86%)

Query: 8   PPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGT 67
           PP V LETSMG   +ELY+KH+P+TC+NFAEL+RRGYYN +KFHRIIKDF++QGGDPTGT
Sbjct: 11  PPNVYLETSMGVIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT 70

Query: 68  GRGGDSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGN 122
           GRGG SIYG  FEDE+ P+LK TGAGIL+MANAGP+TNGSQFF+TLAP   LDG 
Sbjct: 71  GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGK 125
PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.
Mus musculus (taxid: 10090)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9Y3C6|PPIL1_HUMAN Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens GN=PPIL1 PE=1 SV=1 Back     alignment and function description
>sp|Q5E992|PPIL1_BOVIN Peptidyl-prolyl cis-trans isomerase-like 1 OS=Bos taurus GN=PPIL1 PE=2 SV=1 Back     alignment and function description
>sp|Q7SF72|PPIL1_NEUCR Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-1 PE=3 SV=2 Back     alignment and function description
>sp|Q5ASQ0|PPIL1_EMENI Peptidyl-prolyl cis-trans isomerase-like 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp1 PE=3 SV=1 Back     alignment and function description
>sp|Q4WCR3|PPIL1_ASPFU Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp1 PE=3 SV=1 Back     alignment and function description
>sp|P0C1I4|PPIL1_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 1 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp3 PE=3 SV=1 Back     alignment and function description
>sp|Q2U6U0|PPIL1_ASPOR Peptidyl-prolyl cis-trans isomerase-like 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp1 PE=3 SV=1 Back     alignment and function description
>sp|Q8X191|PPIL1_ASPNG Peptidyl-prolyl cis-trans isomerase-like 1 OS=Aspergillus niger GN=cypC PE=3 SV=1 Back     alignment and function description
>sp|Q4I1Y1|PPIL1_GIBZE Peptidyl-prolyl cis-trans isomerase-like 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
225440807166 PREDICTED: peptidyl-prolyl cis-trans iso 0.916 0.722 0.875 3e-56
449462940164 PREDICTED: peptidyl-prolyl cis-trans iso 0.931 0.743 0.861 2e-55
363807377164 uncharacterized protein LOC100786302 [Gl 0.931 0.743 0.861 2e-54
255579379164 Peptidyl-prolyl cis-trans isomerase cypE 0.916 0.731 0.85 3e-54
351724221165 uncharacterized protein LOC100500406 [Gl 0.916 0.727 0.858 4e-54
125562555190 hypothetical protein OsI_30265 [Oryza sa 0.908 0.626 0.831 5e-54
115477813164 Os08g0559400 [Oryza sativa Japonica Grou 0.916 0.731 0.825 7e-54
169730528164 SKIP interacting protein 12 [Oryza sativ 0.916 0.731 0.825 7e-54
217070990164 unknown [Medicago truncatula] gi|3885155 0.931 0.743 0.853 2e-53
224138430164 predicted protein [Populus trichocarpa] 0.908 0.725 0.848 5e-53
>gi|225440807|ref|XP_002281866.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 1 [Vitis vinifera] gi|297740153|emb|CBI30335.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 105/120 (87%), Positives = 111/120 (92%)

Query: 3   ASDDGPPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGG 62
           ++D G PEVTLETSMGSFTVELYYKH+PRTCRNF ELSRRGYY+N KFHRIIKDFIVQGG
Sbjct: 4   SADGGAPEVTLETSMGSFTVELYYKHAPRTCRNFLELSRRGYYDNVKFHRIIKDFIVQGG 63

Query: 63  DPTGTGRGGDSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGN 122
           DPTGTGRGG+SIYG  FEDEIKPELKHTGAGILSMANAGPN+NGSQFFITLAPA  LDG 
Sbjct: 64  DPTGTGRGGESIYGSKFEDEIKPELKHTGAGILSMANAGPNSNGSQFFITLAPAQSLDGK 123

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449462940|ref|XP_004149193.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 1-like [Cucumis sativus] gi|449500879|ref|XP_004161218.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|363807377|ref|NP_001242378.1| uncharacterized protein LOC100786302 [Glycine max] gi|255640340|gb|ACU20458.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255579379|ref|XP_002530534.1| Peptidyl-prolyl cis-trans isomerase cypE, putative [Ricinus communis] gi|223529938|gb|EEF31866.1| Peptidyl-prolyl cis-trans isomerase cypE, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|351724221|ref|NP_001237562.1| uncharacterized protein LOC100500406 [Glycine max] gi|255630248|gb|ACU15479.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|125562555|gb|EAZ08003.1| hypothetical protein OsI_30265 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|115477813|ref|NP_001062502.1| Os08g0559400 [Oryza sativa Japonica Group] gi|15076665|dbj|BAB62328.1| cyclophilin [Oryza sativa Japonica Group] gi|15076667|dbj|BAB62329.1| cyclophilin [Oryza sativa Japonica Group] gi|45736107|dbj|BAD13138.1| cyclophilin [Oryza sativa Japonica Group] gi|113624471|dbj|BAF24416.1| Os08g0559400 [Oryza sativa Japonica Group] gi|125604327|gb|EAZ43652.1| hypothetical protein OsJ_28276 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|169730528|gb|ACA64830.1| SKIP interacting protein 12 [Oryza sativa] Back     alignment and taxonomy information
>gi|217070990|gb|ACJ83855.1| unknown [Medicago truncatula] gi|388515503|gb|AFK45813.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|224138430|ref|XP_002322812.1| predicted protein [Populus trichocarpa] gi|222867442|gb|EEF04573.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
TAIR|locus:2053491164 AT2G36130 [Arabidopsis thalian 0.923 0.737 0.745 2.8e-43
UNIPROTKB|Q5E992166 PPIL1 "Peptidyl-prolyl cis-tra 0.870 0.686 0.657 4.3e-38
UNIPROTKB|E2RPE2166 PPIL1 "Peptidyl-prolyl cis-tra 0.870 0.686 0.657 4.3e-38
UNIPROTKB|Q9Y3C6166 PPIL1 "Peptidyl-prolyl cis-tra 0.870 0.686 0.657 4.3e-38
UNIPROTKB|F2Z542166 PPIL1 "Uncharacterized protein 0.870 0.686 0.657 4.3e-38
MGI|MGI:1916066166 Ppil1 "peptidylprolyl isomeras 0.870 0.686 0.657 4.3e-38
RGD|1309119166 Ppil1 "peptidylprolyl isomeras 0.870 0.686 0.657 4.3e-38
UNIPROTKB|F1LUK7165 Ppil1 "Peptidyl-prolyl cis-tra 0.870 0.690 0.657 4.3e-38
FB|FBgn0035141176 Cypl "Cyclophilin-like" [Droso 0.870 0.647 0.675 1.9e-37
ZFIN|ZDB-GENE-051009-1166 ppil1 "peptidylprolyl isomeras 0.870 0.686 0.640 3.9e-37
TAIR|locus:2053491 AT2G36130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 457 (165.9 bits), Expect = 2.8e-43, P = 2.8e-43
 Identities = 91/122 (74%), Positives = 95/122 (77%)

Query:     1 MLASDDG-PPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIV 59
             M A  +G PPEVTLETSMG FTVE+YYKHSPRTCRNF ELSRRGYY+N  FHRI+KDFIV
Sbjct:     1 MSARPEGSPPEVTLETSMGPFTVEMYYKHSPRTCRNFLELSRRGYYDNVLFHRIVKDFIV 60

Query:    60 QXXXXXXXXXXXXSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHL 119
             Q            SIYG  FEDEI  ELKHTGAGILSMANAGPNTNGSQFFITLAP   L
Sbjct:    61 QGGDPTGTGRGGESIYGSKFEDEINKELKHTGAGILSMANAGPNTNGSQFFITLAPQPSL 120

Query:   120 DG 121
             DG
Sbjct:   121 DG 122
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006457 "protein folding" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=IDA
UNIPROTKB|Q5E992 PPIL1 "Peptidyl-prolyl cis-trans isomerase-like 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPE2 PPIL1 "Peptidyl-prolyl cis-trans isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y3C6 PPIL1 "Peptidyl-prolyl cis-trans isomerase-like 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z542 PPIL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1916066 Ppil1 "peptidylprolyl isomerase (cyclophilin)-like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309119 Ppil1 "peptidylprolyl isomerase (cyclophilin)-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LUK7 Ppil1 "Peptidyl-prolyl cis-trans isomerase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0035141 Cypl "Cyclophilin-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051009-1 ppil1 "peptidylprolyl isomerase (cyclophilin)-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0C1I4PPIL1_RHIO95, ., 2, ., 1, ., 80.74100.85490.6787N/Ano
Q5E992PPIL1_BOVIN5, ., 2, ., 1, ., 80.74780.87780.6927yesno
Q4I1Y1PPIL1_GIBZE5, ., 2, ., 1, ., 80.72320.85490.6913yesno
Q9D0W5PPIL1_MOUSE5, ., 2, ., 1, ., 80.74780.87780.6927yesno
Q5ASQ0PPIL1_EMENI5, ., 2, ., 1, ., 80.75890.85490.6913yesno
Q7SF72PPIL1_NEUCR5, ., 2, ., 1, ., 80.73450.86250.6932N/Ano
Q8X191PPIL1_ASPNG5, ., 2, ., 1, ., 80.750.85490.6913yesno
Q9NI62CYPE_DICDI5, ., 2, ., 1, ., 80.69360.84730.7115yesno
Q4WCR3PPIL1_ASPFU5, ., 2, ., 1, ., 80.75890.85490.6956yesno
Q9Y3C6PPIL1_HUMAN5, ., 2, ., 1, ., 80.74780.87780.6927yesno
P0CP84PPIL1_CRYNJ5, ., 2, ., 1, ., 80.69560.87780.6609yesno
Q2U6U0PPIL1_ASPOR5, ., 2, ., 1, ., 80.74100.85490.6956yesno
P87051PPIL1_SCHPO5, ., 2, ., 1, ., 80.66070.85490.7225yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.963
4th Layer5.2.1.80.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 5e-73
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 4e-55
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 1e-54
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 6e-52
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 8e-50
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 9e-50
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 5e-49
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 8e-46
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 1e-42
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 3e-38
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 3e-35
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 8e-32
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 1e-18
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 6e-14
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 4e-12
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 1e-11
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 1e-05
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information 
 Score =  213 bits (545), Expect = 5e-73
 Identities = 85/110 (77%), Positives = 97/110 (88%)

Query: 12  TLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGTGRGG 71
           TLET+MG  T+ELY+ H+P+TC+NF EL++RGYYN + FHR+IKDF++QGGDPTGTGRGG
Sbjct: 1   TLETTMGEITLELYWNHAPKTCKNFYELAKRGYYNGTIFHRLIKDFMIQGGDPTGTGRGG 60

Query: 72  DSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDG 121
            SIYG  FEDEI PELKHTGAGILSMANAGPNTNGSQFFITLAP   LDG
Sbjct: 61  ASIYGKKFEDEIHPELKHTGAGILSMANAGPNTNGSQFFITLAPTPWLDG 110

These proteins bind their respective SNW chromatin binding protein in autologous systems, in a CsA independent manner indicating interaction with a surface outside the PPIase active site. SNW proteins play a basic and broad range role in signaling. Length = 146
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
KOG0881164 consensus Cyclophilin type peptidyl-prolyl cis-tra 100.0
KOG0546 372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
KOG0880217 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
KOG0883 518 consensus Cyclophilin type, U box-containing pepti 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
KOG0885 439 consensus Peptidyl-prolyl cis-trans isomerase [Pos 100.0
KOG0879177 consensus U-snRNP-associated cyclophilin type pept 100.0
KOG0882558 consensus Cyclophilin-related peptidyl-prolyl cis- 100.0
KOG0884161 consensus Similar to cyclophilin-type peptidyl-pro 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
PTZ00060183 cyclophilin; Provisional 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
PTZ00221249 cyclophilin; Provisional 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 100.0
KOG0865167 consensus Cyclophilin type peptidyl-prolyl cis-tra 99.97
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.78
PRK00969508 hypothetical protein; Provisional 96.02
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 96.01
PRK00969 508 hypothetical protein; Provisional 95.91
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 95.85
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 90.9
PF12903147 DUF3830: Protein of unknown function (DUF3830); In 90.6
COG4070512 Predicted peptidyl-prolyl cis-trans isomerase (rot 88.4
PHA03001132 putative virion core protein; Provisional 81.77
PF06138130 Chordopox_E11: Chordopoxvirus E11 protein; InterPr 81.4
>KOG0881 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-50  Score=266.30  Aligned_cols=130  Identities=72%  Similarity=1.169  Sum_probs=124.6

Q ss_pred             CCCC-CCCCCEEEEEecceeEEEEEcCCCChHHHHHHHHHHhcCCcCCceeEEEecCcEEEcCCCCCCCCCCCcccCccC
Q 032870            1 MLAS-DDGPPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGTGRGGDSIYGHVF   79 (131)
Q Consensus         1 m~~~-~~~~~~v~l~ts~G~i~ieL~~~~aP~t~~nF~~l~~~g~Y~g~~f~rv~~~~~iq~G~~~~~~~~~~~~~~~~~   79 (131)
                      |+++ ....+.|.|+||.|.|++|||-+.||+||+||.+|+++|||+|..|||++++|+||||||++.|.++.++||..|
T Consensus         1 ~~~~~~~q~~~V~LeTsmG~i~~ElY~kHaP~TC~NF~eLarrgYYn~v~FHRii~DFmiQGGDPTGTGRGGaSIYG~kF   80 (164)
T KOG0881|consen    1 MIAPPEWQPPNVTLETSMGKITLELYWKHAPRTCQNFAELARRGYYNGVIFHRIIKDFMIQGGDPTGTGRGGASIYGDKF   80 (164)
T ss_pred             CCCCccCCCCeEEEeecccceehhhhhhcCcHHHHHHHHHHhcccccceeeeehhhhheeecCCCCCCCCCccccccchh
Confidence            5553 345689999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCccCcccEEEEEeCCCCCCcceEEEEcCCCCCCCCCccEEEEEe
Q 032870           80 EDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGNVNNIIVLL  130 (131)
Q Consensus        80 ~~e~~~~l~~~~~G~v~~~~~~~~~~~sqFfI~l~~~~~ld~~~~vfG~Vv  130 (131)
                      ++|.++.|+|..+|.|+|++.+|++++|||||+|++.+||||+|++||||.
T Consensus        81 ~DEi~~dLkhTGAGILsMANaGPnTNgSQFFiTLAPt~~LDGKHTIFGRV~  131 (164)
T KOG0881|consen   81 EDEIHSDLKHTGAGILSMANAGPNTNGSQFFITLAPTQWLDGKHTIFGRVC  131 (164)
T ss_pred             hhhhhhhhcccchhhhhhhccCCCCCCceEEEEecCccccCCcceeehhhh
Confidence            999999999999999999999999999999999999999999999999985

>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>KOG0880 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>KOG0885 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0879 consensus U-snRNP-associated cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0884 consensus Similar to cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0865 consensus Cyclophilin type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12903 DUF3830: Protein of unknown function (DUF3830); InterPro: IPR024532 This is a family of bacterial and archaeal proteins Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03001 putative virion core protein; Provisional Back     alignment and domain information
>PF06138 Chordopox_E11: Chordopoxvirus E11 protein; InterPro: IPR009201 This group represents a virion core protein, vaccinia E11L type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 4e-42
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 4e-42
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 5e-42
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 4e-34
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 4e-25
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 2e-24
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 3e-24
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 1e-23
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 5e-23
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 1e-22
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 5e-22
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 2e-20
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 3e-20
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 4e-19
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 4e-19
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 4e-19
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 4e-19
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 4e-19
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 4e-19
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 4e-19
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 4e-19
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 4e-19
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 5e-19
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 6e-19
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 6e-19
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 7e-19
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 8e-19
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 9e-19
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 1e-18
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 2e-18
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 2e-18
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 2e-18
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 2e-18
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 3e-18
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 3e-18
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 3e-18
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 4e-18
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 5e-18
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 6e-18
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 7e-18
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 1e-17
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 3e-17
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 4e-17
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 4e-17
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 4e-17
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 6e-17
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 7e-17
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 1e-16
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 1e-16
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 1e-16
1dyw_A173 Biochemical And Structural Characterization Of A Di 2e-16
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 2e-16
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 5e-16
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 5e-16
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 5e-16
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 5e-16
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 6e-16
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 8e-16
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 8e-16
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 8e-16
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 1e-15
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 2e-15
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 1e-14
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 2e-14
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 2e-14
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 2e-14
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 3e-14
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 2e-13
1clh_A166 Three-Dimensional Solution Structure Of Escherichia 2e-09
1j2a_A166 Structure Of E. Coli Cyclophilin B K163t Mutant Len 2e-09
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 2e-08
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 2e-08
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 7e-07
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 2e-05
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure 
Iteration: 1

 Score =  166 bits (420), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 89/115 (77%)
Query: 8   PPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQXXXXXXX 67
           PP V LETSMG   +ELY+KH+P+TC+NFAEL+RRGYYN +KFHRIIKDF++Q       
Sbjct: 11  PPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT 70
Query: 68  XXXXXSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGN 122
                SIYG  FEDE+ P+LK TGAGIL+MANAGP+TNGSQFF+TLAP   LDG 
Sbjct: 71  GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGK 125
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 Back     alignment and structure
>pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 9e-78
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 3e-77
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 5e-76
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 3e-75
2hq6_A185 Serologically defined colon cancer antigen 10; pro 5e-75
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 6e-75
2b71_A196 Cyclophilin-like protein; structural genomics, str 6e-75
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 6e-74
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 2e-73
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 8e-71
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 2e-68
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 3e-65
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 2e-50
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 3e-50
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 4e-50
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 4e-49
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 5e-49
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 6e-49
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 7e-49
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 7e-49
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 7e-49
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 9e-49
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 1e-48
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-48
1z81_A229 Cyclophilin; structural genomics, structural genom 1e-48
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 1e-48
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 2e-48
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 3e-48
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 5e-48
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 1e-46
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 3e-45
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 2e-44
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 4e-43
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 8e-42
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 1e-34
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
 Score =  225 bits (577), Expect = 9e-78
 Identities = 86/114 (75%), Positives = 100/114 (87%)

Query: 8   PPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGT 67
           PP V LETSMG   +ELY+KH+P+TC+NFAEL+RRGYYN +KFHRIIKDF++QGGDPTGT
Sbjct: 11  PPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT 70

Query: 68  GRGGDSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDG 121
           GRGG SIYG  FEDE+ P+LK TGAGIL+MANAGP+TNGSQFF+TLAP   LDG
Sbjct: 71  GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDG 124
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
2nnz_A153 Hypothetical protein; beta-barrel, structural geno 93.29
3kop_A188 Uncharacterized protein; protein with A cyclophili 87.75
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
Probab=100.00  E-value=2.4e-49  Score=276.91  Aligned_cols=127  Identities=68%  Similarity=1.153  Sum_probs=121.9

Q ss_pred             CCCCCCEEEEEecceeEEEEEcCCCChHHHHHHHHHHhcCCcCCceeEEEecCcEEEcCCCCCCCCCCCcccCccCCCCC
Q 032870            4 SDDGPPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGTGRGGDSIYGHVFEDEI   83 (131)
Q Consensus         4 ~~~~~~~v~l~ts~G~i~ieL~~~~aP~t~~nF~~l~~~g~Y~g~~f~rv~~~~~iq~G~~~~~~~~~~~~~~~~~~~e~   83 (131)
                      +...+++|.|+|+.|+|+||||++.||+||+||++||+.|||+|+.||||+|+|+|||||+.+++.+++++|+..+++|.
T Consensus         7 ~~~~~~~v~l~t~~G~i~ieL~~~~aP~t~~NF~~L~~~g~Y~g~~fhRvi~~f~iQgGd~~~~g~gg~si~g~~~~dE~   86 (166)
T 2x7k_A            7 DSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDEL   86 (166)
T ss_dssp             TTCCCSEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHHTTTTTEECCEEETTTEEEECCTTSSSSCCCCTTSSCBCCCC
T ss_pred             cccCCCEEEEEeCCCcEEEEEccCCCCHHHHHHHHHHhcCCCCCCEEEEEECCCEEEcCCCCCCCCCCCccCCCcccccc
Confidence            34467899999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCCCccCcccEEEEEeCCCCCCcceEEEEcCCCCCCCCCccEEEEEe
Q 032870           84 KPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGNVNNIIVLL  130 (131)
Q Consensus        84 ~~~l~~~~~G~v~~~~~~~~~~~sqFfI~l~~~~~ld~~~~vfG~Vv  130 (131)
                      .+.++|.++|+|||+++++++++|||||++.++|+||++|+|||||+
T Consensus        87 ~~~l~h~~~G~lsmAn~gp~s~gSQFfI~~~~~~~Ldg~~tvFG~Vv  133 (166)
T 2x7k_A           87 HPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVC  133 (166)
T ss_dssp             CTTSCCCSTTEEEECBSSTTCBCSCEEEESSCCGGGTTTSCEEEEEE
T ss_pred             ccccCCCCCeEEEEeeCCCCCccceEEEECCCCCccCCCeeEEEEEE
Confidence            77899998999999999999999999999999999999999999997
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>2nnz_A Hypothetical protein; beta-barrel, structural genomics, ontario centre for structu proteomics, OCSP, unknown function; NMR {Archaeoglobus fulgidus} Back     alignment and structure
>3kop_A Uncharacterized protein; protein with A cyclophilin-like fold, structural genomics, J center for structural genomics, JCSG; 1.90A {Arthrobacter SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 1e-41
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 3e-40
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 9e-35
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 5e-31
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 1e-28
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 9e-28
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 1e-27
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 1e-27
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-27
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 2e-26
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 9e-25
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-24
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 3e-24
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 9e-23
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 4e-22
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 1e-21
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 2e-21
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 3e-21
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 9e-21
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 1e-18
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 3e-17
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 3e-17
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  133 bits (335), Expect = 1e-41
 Identities = 85/113 (75%), Positives = 99/113 (87%)

Query: 8   PPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGT 67
           PP V LETSMG   +ELY+KH+P+TC+NFAEL+RRGYYN +KFHRIIKDF++QGGDPTGT
Sbjct: 11  PPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGT 70

Query: 68  GRGGDSIYGHVFEDEIKPELKHTGAGILSMANAGPNTNGSQFFITLAPASHLD 120
           GRGG SIYG  FEDE+ P+LK TGAGIL+MANAGP+TNGSQFF+TLAP   LD
Sbjct: 71  GRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLD 123
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1x7fa1117 Outer surface protein, C-terminal domain {Bacillus 84.54
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-43  Score=246.67  Aligned_cols=124  Identities=69%  Similarity=1.192  Sum_probs=118.8

Q ss_pred             CCCEEEEEecceeEEEEEcCCCChHHHHHHHHHHhcCCcCCceeEEEecCcEEEcCCCCCCCCCCCcccCccCCCCCCCC
Q 032870            7 GPPEVTLETSMGSFTVELYYKHSPRTCRNFAELSRRGYYNNSKFHRIIKDFIVQGGDPTGTGRGGDSIYGHVFEDEIKPE   86 (131)
Q Consensus         7 ~~~~v~l~ts~G~i~ieL~~~~aP~t~~nF~~l~~~g~Y~g~~f~rv~~~~~iq~G~~~~~~~~~~~~~~~~~~~e~~~~   86 (131)
                      .+++|.|+|++|+|+||||++.||+||+||++||+.|||+|+.|||+++++++|+||+.+.+.++...++..+++|..+.
T Consensus        10 ~~p~v~~~T~~G~i~ieL~~~~aP~tv~nF~~L~~~g~Y~g~~f~rv~~~~~iq~Gd~~~~~~~~~~~~~~~~~~e~~~~   89 (166)
T d1xwna1          10 QPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPD   89 (166)
T ss_dssp             CCCEEEEEESSCEEEEEECTTTCHHHHHHHHHHHHHTSSTTCCEEEEETTTEEEECCSTTTTSSCCCSSCSCCCCCCCTT
T ss_pred             CCCEEEEEECceeEEEEEcCCCChHHHHHHHHHHhcCCcCceeeeEEcccEEEEeCCCCCCCCCCccCCCCccccccCCC
Confidence            46799999999999999999999999999999999999999999999999999999999888888888889999998788


Q ss_pred             CccCcccEEEEEeCCCCCCcceEEEEcCCCCCCCCCccEEEEEe
Q 032870           87 LKHTGAGILSMANAGPNTNGSQFFITLAPASHLDGNVNNIIVLL  130 (131)
Q Consensus        87 l~~~~~G~v~~~~~~~~~~~sqFfI~l~~~~~ld~~~~vfG~Vv  130 (131)
                      +.|.++|+|+|+++++++++|||||++.+.++||++|+|||||+
T Consensus        90 ~~~~~~G~lsm~~~~~~s~~sqFfI~~~~~~~ld~~~tvFG~Vi  133 (166)
T d1xwna1          90 LKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVC  133 (166)
T ss_dssp             CCSCSSSEEEEEEEETTEEEEEEEEECSCCSTTTTTSEEEEECS
T ss_pred             CCCCCCeEEEecccCCCCCCcceEEeecChhhccccceEEEEEe
Confidence            99999999999999999999999999999999999999999997
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1x7fa1 b.62.1.2 (A:245-361) Outer surface protein, C-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure