Citrus Sinensis ID: 032885

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MAAAAAAAAQWLSVCITFSVSLIIIIIGSSSLVAVASGNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGRLVPELGKLEHLQYLYVNQNLFLFISFHNMYILNIN
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccccccccEEEEcccccEEEEEccccccEEEccccccccccccEEEcccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEEccccEEEEEEccccccccccccccccccccEEEEEEcccEEEEEEccEEEEEcc
MAAAAAAAAQWLSVCITFSVSLIIIIIGSSSLVAVASGNSEGDALYALRRslsdpdnvlqswdptlvnpctwfhitcnqdnrvtrldlgnsnlsgrlvpelgklEHLQYLYVNQNLFLFISFHNMYILNIN
MAAAAAAAAQWLSVCITFSVSLIIIIIGSSSLVAVASGNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGRLVPELGKLEHLQYLYVNQNLFLFISFHNMYILNIN
MaaaaaaaaQWLSVCITFsvsliiiiigssslvavasgNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGRLVPELGKLEHLQYLYVNQNLFLFISFHNMYILNIN
******AAAQWLSVCITFSVSLIIIIIGSSSLVAVASGNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGRLVPELGKLEHLQYLYVNQNLFLFISFHNMYILNI*
***********LSVCITFSVSLIIIIIGSSSLVAVASGNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGRLVPELGKLEHLQYLYVNQNLFLFISFHNMYILNIN
*********QWLSVCITFSVSLIIIIIGSSSLVAVASGNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGRLVPELGKLEHLQYLYVNQNLFLFISFHNMYILNIN
MAAAAAAAAQWLSVCITFSVSLIIIIIGSSSLVAVASGNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGRLVPELGKLEHLQYLYVNQNLFLFISFHNMYILNIN
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAAAAAAAQWLSVCITFSVSLIIIIIGSSSLVAVASGNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGRLVPELGKLEHLQYLYVNQNLFLFISFHNMYILNIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
Q9XIC7 628 Somatic embryogenesis rec no no 0.610 0.127 0.687 7e-30
Q94F62 615 BRASSINOSTEROID INSENSITI no no 0.641 0.136 0.678 3e-29
Q94AG2 625 Somatic embryogenesis rec no no 0.618 0.129 0.691 8e-28
Q9SKG5 620 Somatic embryogenesis rec no no 0.603 0.127 0.670 1e-26
Q8LPS5 601 Somatic embryogenesis rec no no 0.641 0.139 0.563 1e-22
C0LGT1 613 Probable LRR receptor-lik no no 0.656 0.140 0.418 6e-13
Q93ZS4 632 Protein NSP-INTERACTING K no no 0.656 0.136 0.390 8e-12
Q8RY65 635 Protein NSP-INTERACTING K no no 0.580 0.119 0.441 6e-11
Q9SHI2 1101 Leucine-rich repeat recep no no 0.740 0.088 0.41 7e-10
Q8VYT3 648 Probable LRR receptor-lik no no 0.603 0.121 0.349 1e-09
>sp|Q9XIC7|SERK2_ARATH Somatic embryogenesis receptor kinase 2 OS=Arabidopsis thaliana GN=SERK2 PE=1 SV=1 Back     alignment and function desciption
 Score =  129 bits (323), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 55/80 (68%), Positives = 70/80 (87%)

Query: 36  ASGNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSG 95
           AS N EGDAL++LR +L DP+NVLQSWDPTLVNPCTWFH+TCN +N V R+DLGN++LSG
Sbjct: 27  ASSNMEGDALHSLRANLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNADLSG 86

Query: 96  RLVPELGKLEHLQYLYVNQN 115
           +LVP+LG+L++LQYL +  N
Sbjct: 87  QLVPQLGQLKNLQYLELYSN 106
Serine/threonine-kinase involved in brassinosteroid-dependent and -independent signaling pathways. Acts redundantly with SERK1 as a control point for sporophytic development controlling male gametophyte production.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1 SV=2 Back     alignment and function description
>sp|Q94AG2|SERK1_ARATH Somatic embryogenesis receptor kinase 1 OS=Arabidopsis thaliana GN=SERK1 PE=1 SV=2 Back     alignment and function description
>sp|Q9SKG5|SERK4_ARATH Somatic embryogenesis receptor kinase 4 OS=Arabidopsis thaliana GN=SERK4 PE=1 SV=2 Back     alignment and function description
>sp|Q8LPS5|SERK5_ARATH Somatic embryogenesis receptor kinase 5 OS=Arabidopsis thaliana GN=SERK5 PE=1 SV=2 Back     alignment and function description
>sp|C0LGT1|Y5129_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g10290 OS=Arabidopsis thaliana GN=At5g10290 PE=1 SV=1 Back     alignment and function description
>sp|Q93ZS4|NIK3_ARATH Protein NSP-INTERACTING KINASE 3 OS=Arabidopsis thaliana GN=NIK3 PE=1 SV=1 Back     alignment and function description
>sp|Q8RY65|NIK2_ARATH Protein NSP-INTERACTING KINASE 2 OS=Arabidopsis thaliana GN=NIK2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 Back     alignment and function description
>sp|Q8VYT3|Y4052_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g30520 OS=Arabidopsis thaliana GN=At4g30520 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
30385250228 leucine-rich repeat protein [x Citrofort 0.870 0.5 0.921 7e-41
255578680223 serine-threonine protein kinase, plant-t 0.816 0.479 0.707 5e-38
224106682215 predicted protein [Populus trichocarpa] 0.763 0.465 0.697 2e-37
356501350218 PREDICTED: somatic embryogenesis recepto 0.793 0.477 0.669 2e-36
255637944218 unknown [Glycine max] 0.793 0.477 0.669 2e-36
255644475218 unknown [Glycine max] 0.793 0.477 0.669 3e-36
297815476 248 leucine-rich repeat family protein [Arab 0.801 0.423 0.626 3e-36
359807462218 somatic embryogenesis receptor kinase 1- 0.793 0.477 0.669 3e-36
116779223216 unknown [Picea sitchensis] gi|224285665| 0.732 0.444 0.752 4e-36
116786314216 unknown [Picea sitchensis] 0.732 0.444 0.742 7e-36
>gi|30385250|gb|AAP23944.1| leucine-rich repeat protein [x Citrofortunella microcarpa] Back     alignment and taxonomy information
 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 108/115 (93%), Gaps = 1/115 (0%)

Query: 1   MAAAAAAAAQWLSVCITFSVSLIIIIIGSSSLVAVASGNSEGDALYALRRSLSDPDNVLQ 60
           MAAAAAAAAQWLSVCITFSVSLIIII  SSSLVAV SGNSEGDALYALRRSLSDPD VLQ
Sbjct: 1   MAAAAAAAAQWLSVCITFSVSLIIIIG-SSSLVAVVSGNSEGDALYALRRSLSDPDYVLQ 59

Query: 61  SWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGRLVPELGKLEHLQYLYVNQN 115
           SWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSG LVPELGKLEHLQYL + +N
Sbjct: 60  SWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGHLVPELGKLEHLQYLELYKN 114

Source: x Citrofortunella microcarpa

Species: x Citrofortunella microcarpa

Genus: x Citrofortunella

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255578680|ref|XP_002530200.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223530293|gb|EEF32190.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224106682|ref|XP_002314247.1| predicted protein [Populus trichocarpa] gi|118487907|gb|ABK95775.1| unknown [Populus trichocarpa] gi|222850655|gb|EEE88202.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356501350|ref|XP_003519488.1| PREDICTED: somatic embryogenesis receptor kinase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255637944|gb|ACU19288.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255644475|gb|ACU22741.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297815476|ref|XP_002875621.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297321459|gb|EFH51880.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|359807462|ref|NP_001241394.1| somatic embryogenesis receptor kinase 1-like precursor [Glycine max] gi|223452524|gb|ACM89589.1| leucine-rich repeat protein [Glycine max] Back     alignment and taxonomy information
>gi|116779223|gb|ABK21187.1| unknown [Picea sitchensis] gi|224285665|gb|ACN40548.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|116786314|gb|ABK24062.1| unknown [Picea sitchensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
TAIR|locus:2178968218 AT5G21090 [Arabidopsis thalian 0.587 0.353 0.870 2.2e-34
TAIR|locus:2101064 248 AT3G43740 [Arabidopsis thalian 0.557 0.294 0.904 9.5e-34
TAIR|locus:2026097 628 SERK2 "somatic embryogenesis r 0.587 0.122 0.688 2.3e-26
TAIR|locus:2013021 625 SERK1 "somatic embryogenesis r 0.587 0.123 0.701 1e-25
TAIR|locus:2040461 620 SERK4 "somatic embryogenesis r 0.587 0.124 0.675 8.8e-24
TAIR|locus:2040471 601 SERK5 "somatic embryogenesis r 0.564 0.123 0.615 8.3e-20
TAIR|locus:2145407 613 AT5G10290 [Arabidopsis thalian 0.587 0.125 0.441 3.6e-11
TAIR|locus:2058598 773 AT2G23300 [Arabidopsis thalian 0.587 0.099 0.448 6.5e-11
TAIR|locus:2036636 632 NIK3 "NSP-interacting kinase 3 0.580 0.120 0.415 7.9e-11
TAIR|locus:2146102 638 NIK1 "NSP-interacting kinase 1 0.587 0.120 0.389 7.5e-10
TAIR|locus:2178968 AT5G21090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 373 (136.4 bits), Expect = 2.2e-34, P = 2.2e-34
 Identities = 67/77 (87%), Positives = 73/77 (94%)

Query:    39 NSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGRLV 98
             NSEGDALYALRRSL+DPD+VLQSWDPTLVNPCTWFH+TCNQDNRVTR+DLGNSNLSG L 
Sbjct:    28 NSEGDALYALRRSLTDPDHVLQSWDPTLVNPCTWFHVTCNQDNRVTRVDLGNSNLSGHLA 87

Query:    99 PELGKLEHLQYLYVNQN 115
             PELGKLEHLQYL + +N
Sbjct:    88 PELGKLEHLQYLELYKN 104
GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=IC
GO:0006096 "glycolysis" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009627 "systemic acquired resistance" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
TAIR|locus:2101064 AT3G43740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026097 SERK2 "somatic embryogenesis receptor-like kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013021 SERK1 "somatic embryogenesis receptor-like kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040461 SERK4 "somatic embryogenesis receptor-like kinase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040471 SERK5 "somatic embryogenesis receptor-like kinase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145407 AT5G10290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058598 AT2G23300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036636 NIK3 "NSP-interacting kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146102 NIK1 "NSP-interacting kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 1e-10
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-08
pfam03853170 pfam03853, YjeF_N, YjeF-related protein N-terminus 0.003
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information 
 Score = 52.3 bits (126), Expect = 1e-10
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 39 NSEGDALYALRRSL-SDPDNVLQSWDPTLVNPCTWFHITCN 78
          N + DAL A + SL  DP   L SW+P+  +PC+W  +TC+
Sbjct: 2  NDDRDALLAFKSSLNGDPSGALSSWNPSSSDPCSWTGVTCD 42

Leucine Rich Repeats pfam00560 are short sequence motifs present in a number of proteins with diverse functions and cellular locations. Leucine Rich Repeats are often flanked by cysteine rich domains. This domain is often found at the N-terminus of tandem leucine rich repeats. Length = 42
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|217763 pfam03853, YjeF_N, YjeF-related protein N-terminus Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.55
PLN03150 623 hypothetical protein; Provisional 99.22
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.9
PLN03150 623 hypothetical protein; Provisional 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.01
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.78
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 97.53
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.05
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.98
KOG0617 264 consensus Ras suppressor protein (contains leucine 95.87
KOG0472 565 consensus Leucine-rich repeat protein [Function un 95.75
KOG4237 498 consensus Extracellular matrix protein slit, conta 95.7
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 95.52
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 94.94
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 94.61
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 94.34
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 94.33
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 94.32
KOG0472565 consensus Leucine-rich repeat protein [Function un 94.26
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 94.21
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 93.92
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 93.77
PLN03210 1153 Resistant to P. syringae 6; Provisional 93.77
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 93.73
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 93.43
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 92.91
KOG0617 264 consensus Ras suppressor protein (contains leucine 91.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 91.47
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 91.33
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.14
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.88
smart0037026 LRR Leucine-rich repeats, outliers. 90.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 90.18
PLN03210 1153 Resistant to P. syringae 6; Provisional 89.49
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 88.81
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 88.04
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 86.41
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 84.83
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 84.8
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 83.98
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 83.47
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 82.64
KOG4237 498 consensus Extracellular matrix protein slit, conta 82.43
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.55  E-value=1.9e-14  Score=120.64  Aligned_cols=93  Identities=27%  Similarity=0.512  Sum_probs=78.7

Q ss_pred             ChhHHHHHHHHHHhcCCCCCCCCCCCCCCCCCcccceeeeCCCCCEEEEecCCCCcceeCchhhcCCcccceeeccCCcc
Q 032885           38 GNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDLGNSNLSGRLVPELGKLEHLQYLYVNQNLF  117 (131)
Q Consensus        38 ~~~~~~~L~~~~~~l~~~~~~l~~W~~~~~~~C~w~gv~C~~~~~v~~l~l~~~~l~G~ip~~l~~L~~L~~L~L~~N~l  117 (131)
                      .+.|..+|..||+.+.+|.+.+.+|+.. .++|.|.|++|+..++|+.|++++++++|.+|+.+..+++|+.|+|++|.+
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~~~-~~~c~w~gv~c~~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~  105 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWNSS-ADVCLWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQL  105 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCCCC-CCCCcCcceecCCCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCcc
Confidence            4578899999999998776677889765 689999999998778999999999999999998899999999999999998


Q ss_pred             cCCCC-------CCCceeecC
Q 032885          118 LFISF-------HNMYILNIN  131 (131)
Q Consensus       118 ~G~~~-------~~l~~L~ls  131 (131)
                      +|.+|       ++|+.||||
T Consensus       106 ~~~ip~~~~~~l~~L~~L~Ls  126 (968)
T PLN00113        106 SGPIPDDIFTTSSSLRYLNLS  126 (968)
T ss_pred             CCcCChHHhccCCCCCEEECc
Confidence            88655       455666664

>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-15
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-12
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score = 68.4 bits (168), Expect = 8e-15
 Identities = 25/92 (27%), Positives = 41/92 (44%), Gaps = 6/92 (6%)

Query: 29  SSSLVAVASGNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCTWFHITCNQDNRVTRLDL 88
           S       S   E   L + +  L D  N+L  W     NPCT+  +TC  D++VT +DL
Sbjct: 1   SFQASPSQSLYREIHQLISFKDVLPDK-NLLPDWSSN-KNPCTFDGVTCR-DDKVTSIDL 57

Query: 89  GNSNLS---GRLVPELGKLEHLQYLYVNQNLF 117
            +  L+     +   L  L  L+ L+++ +  
Sbjct: 58  SSKPLNVGFSAVSSSLLSLTGLESLFLSNSHI 89
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.63
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.63
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.46
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.43
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 99.0
3e6j_A 229 Variable lymphocyte receptor diversity region; var 98.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.31
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 98.31
2o6s_A 208 Variable lymphocyte receptor B; leucine-rich repea 98.27
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.27
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.25
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.1
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 98.06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.01
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.98
3m19_A 251 Variable lymphocyte receptor A diversity region; a 97.95
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 97.95
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 97.87
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.86
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.85
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.79
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.78
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.74
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 97.73
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 97.73
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 97.72
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.71
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.69
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.66
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.66
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.65
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.64
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.64
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.63
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.58
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.58
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.57
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 97.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.56
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.56
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.56
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 97.55
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.52
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.51
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.5
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 97.5
3m19_A 251 Variable lymphocyte receptor A diversity region; a 97.49
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.49
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.48
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.47
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.43
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.43
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.43
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.41
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.4
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.38
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.33
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.32
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 97.31
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 97.31
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.3
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 97.3
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 97.3
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.29
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 97.28
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.28
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.27
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.27
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.27
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 97.26
4glp_A 310 Monocyte differentiation antigen CD14; alpha beta 97.25
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 97.24
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.24
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.21
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 97.21
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.21
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.2
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.18
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.16
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.15
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.15
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 97.15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 97.14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.13
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.1
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 97.09
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.08
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 97.07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.04
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.03
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 96.91
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 96.9
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 96.89
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 96.85
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.81
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 96.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.78
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 96.78
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.78
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 96.76
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 96.74
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 96.7
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 96.68
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 96.65
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 96.62
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.61
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.61
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 96.57
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 96.57
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 96.52
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 96.44
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.37
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 96.33
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.3
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.26
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 96.22
1o6v_A 466 Internalin A; bacterial infection, extracellular r 96.12
1o6v_A 466 Internalin A; bacterial infection, extracellular r 96.05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 95.91
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 95.58
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.55
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 95.13
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 95.01
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 94.78
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 94.53
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 94.52
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.09
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 93.28
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.75
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 92.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 92.19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 91.72
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 91.25
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 90.6
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 88.44
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 86.66
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 84.15
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.63  E-value=1e-15  Score=112.64  Aligned_cols=93  Identities=30%  Similarity=0.566  Sum_probs=79.6

Q ss_pred             cCChhHHHHHHHHHHhcCCCCCCCCCCCCCCCCCcc--cceeeeCCC---CCEEEEecCCCCcce--eCchhhcCCcccc
Q 032885           36 ASGNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCT--WFHITCNQD---NRVTRLDLGNSNLSG--RLVPELGKLEHLQ  108 (131)
Q Consensus        36 ~~~~~~~~~L~~~~~~l~~~~~~l~~W~~~~~~~C~--w~gv~C~~~---~~v~~l~l~~~~l~G--~ip~~l~~L~~L~  108 (131)
                      .|.++|..+|.+||+.+.+|. .+.+|... .++|.  |.||.|+..   ++|+.++++++++.|  .+|+.+.++++|+
T Consensus         2 ~c~~~~~~aL~~~k~~~~~~~-~l~~W~~~-~~~C~~~w~gv~C~~~~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~L~   79 (313)
T 1ogq_A            2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPT-TDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLN   79 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCG-GGTTCCTT-SCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCS
T ss_pred             CCCHHHHHHHHHHHHhcCCcc-cccCCCCC-CCCCcCCCcceEeCCCCCCceEEEEECCCCCccCCcccChhHhCCCCCC
Confidence            467889999999999998775 67899765 68998  999999853   799999999999999  9999999999999


Q ss_pred             eeeccC-CcccCCCCC------CCceeec
Q 032885          109 YLYVNQ-NLFLFISFH------NMYILNI  130 (131)
Q Consensus       109 ~L~L~~-N~l~G~~~~------~l~~L~l  130 (131)
                      +|++++ |+++|.+|.      +|+.|+|
T Consensus        80 ~L~L~~~n~l~~~~p~~l~~l~~L~~L~L  108 (313)
T 1ogq_A           80 FLYIGGINNLVGPIPPAIAKLTQLHYLYI  108 (313)
T ss_dssp             EEEEEEETTEESCCCGGGGGCTTCSEEEE
T ss_pred             eeeCCCCCcccccCChhHhcCCCCCEEEC
Confidence            999995 999987764      4566665
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-12
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 60.5 bits (145), Expect = 2e-12
 Identities = 27/94 (28%), Positives = 39/94 (41%), Gaps = 9/94 (9%)

Query: 40  SEGDALYALRRSLSDPDNVLQSWDPTLVNPC--TWFHITCNQDN---RVTRLDLGNSNLS 94
            +  AL  +++ L +P   L SW PT  + C  TW  + C+ D    RV  LDL   NL 
Sbjct: 6   QDKQALLQIKKDLGNP-TTLSSWLPT-TDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLP 63

Query: 95  GR--LVPELGKLEHLQYLYVNQNLFLFISFHNMY 126
               +   L  L +L +LY+     L        
Sbjct: 64  KPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAI 97

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.51
d1w8aa_ 192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.99
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 97.93
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.75
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 97.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.52
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.4
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.3
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.21
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.2
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.17
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.11
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.95
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 96.92
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 96.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.89
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.79
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.45
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 96.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 96.29
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 96.25
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.24
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 96.16
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.1
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 96.08
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 95.8
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 95.47
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 95.33
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 94.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 94.25
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 93.9
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 93.22
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 92.45
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 92.19
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 91.36
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 91.26
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 90.1
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 87.04
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 83.73
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.78  E-value=1.6e-19  Score=130.71  Aligned_cols=93  Identities=30%  Similarity=0.572  Sum_probs=80.0

Q ss_pred             CChhHHHHHHHHHHhcCCCCCCCCCCCCCCCCCcc--cceeeeCCC---CCEEEEecCCCCcce--eCchhhcCCcccce
Q 032885           37 SGNSEGDALYALRRSLSDPDNVLQSWDPTLVNPCT--WFHITCNQD---NRVTRLDLGNSNLSG--RLVPELGKLEHLQY  109 (131)
Q Consensus        37 ~~~~~~~~L~~~~~~l~~~~~~l~~W~~~~~~~C~--w~gv~C~~~---~~v~~l~l~~~~l~G--~ip~~l~~L~~L~~  109 (131)
                      |.++|+++|++||+.+.++. .+.+|... .|+|.  |.||+|+..   +||++|++++++++|  +||+++++|++|++
T Consensus         3 c~~~e~~aLl~~k~~~~~~~-~l~sW~~~-~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~   80 (313)
T d1ogqa_           3 CNPQDKQALLQIKKDLGNPT-TLSSWLPT-TDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNF   80 (313)
T ss_dssp             SCHHHHHHHHHHHHHTTCCG-GGTTCCTT-SCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSE
T ss_pred             CCHHHHHHHHHHHHHCCCCC-cCCCCCCC-CCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCccccc
Confidence            67899999999999998875 58899866 69994  999999863   489999999999998  68999999999999


Q ss_pred             eeccC-CcccCCCCC------CCceeecC
Q 032885          110 LYVNQ-NLFLFISFH------NMYILNIN  131 (131)
Q Consensus       110 L~L~~-N~l~G~~~~------~l~~L~ls  131 (131)
                      |+|++ |+++|.+|+      +|+.|||+
T Consensus        81 L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls  109 (313)
T d1ogqa_          81 LYIGGINNLVGPIPPAIAKLTQLHYLYIT  109 (313)
T ss_dssp             EEEEEETTEESCCCGGGGGCTTCSEEEEE
T ss_pred             cccccccccccccccccccccccchhhhc
Confidence            99997 899998875      44666653
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure