Citrus Sinensis ID: 032927

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPTRKYLWGASYG
cccccccccccccccccccEEEEEEEEEccccccccccccEEEEEEcccccEEEEEEEEEccccEEEEEEEEEccccccccEEEEEEcccccccccccccEEEEEEEcccccEEEEEcccccEEEEEEcc
ccccccccccccccHHHHcccEEEEEccccccccccccEEEEEEEEcccccEEEEEccccccccEEEEEEEEEEcccccccEEEEEEccccccccccccccEEEEEEccccEEEEEccccccEEEEEccc
MASKKEMEVVRGLDIKRYMGRWyeiasfpsrnqpkngadtratytlnedgtvhvrnetwsdgkrgsiegtaykadpksdeaklkvkfyvppffpiipvvgnywvlyiddnyqyaligeptrkylwgasyg
maskkemevvrgldikryMGRWYEIasfpsrnqpkngadtratytlnedgtvhvrnetwsdgkrgsiegtaykadpksdeaKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPTRKYLWGASYG
MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLkvkfyvppffpiipvvGNYWVLYIDDNYQYALIGEPTRKYLWGASYG
********VVRGLDIKRYMGRWYEIASF*****************************************************KLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPTRKYLWGA***
*****EM**VRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPTRKYLWGASYG
*********VRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPTRKYLWGASYG
*****EMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPTRKYLWGASY*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRGSIEGTAYKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPTRKYLWGASYG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q46036177 Outer membrane lipoprotei N/A no 0.846 0.621 0.392 3e-12
P0A901177 Outer membrane lipoprotei N/A no 0.861 0.632 0.365 4e-11
P0A902177 Outer membrane lipoprotei N/A no 0.861 0.632 0.365 4e-11
Q5URA7169 Putative lipocalin R877 O N/A no 0.838 0.644 0.353 2e-10
P51910189 Apolipoprotein D OS=Mus m yes no 0.815 0.560 0.355 6e-10
P05090189 Apolipoprotein D OS=Homo yes no 0.723 0.497 0.390 5e-09
P23593189 Apolipoprotein D OS=Rattu yes no 0.8 0.550 0.35 7e-09
Q32KY0189 Apolipoprotein D OS=Bos t yes no 0.753 0.518 0.385 1e-08
P37153189 Apolipoprotein D OS=Oryct yes no 0.723 0.497 0.380 2e-08
P51909189 Apolipoprotein D OS=Cavia yes no 0.723 0.497 0.4 2e-08
>sp|Q46036|BLC_CITFR Outer membrane lipoprotein blc OS=Citrobacter freundii PE=3 SV=1 Back     alignment and function desciption
 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 68/125 (54%), Gaps = 15/125 (12%)

Query: 5   KEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGAD-TRATYTLNEDGTVHVRNETWSDGK 63
           K + VV   D KRY+G WYEIA F  R +   G D   ATY+L +DG ++V N+ ++  +
Sbjct: 26  KGVTVVNNFDAKRYLGTWYEIARFDHRFE--RGLDKVTATYSLRDDGGINVINKGYNPDR 83

Query: 64  R--GSIEGTAY-KADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPT 120
                 EG AY   DP +  A LKV F+ P +       G Y V+ +D  Y++AL+  P 
Sbjct: 84  EMWQKTEGKAYFTGDPST--AALKVSFFGPFY-------GGYNVIALDREYRHALVCGPD 134

Query: 121 RKYLW 125
           R YLW
Sbjct: 135 RDYLW 139
Involved in the storage or transport of lipids necessary for membrane maintenance under stressful conditions. Displays a binding preference for lysophospholipids.
Citrobacter freundii (taxid: 546)
>sp|P0A901|BLC_ECOLI Outer membrane lipoprotein blc OS=Escherichia coli (strain K12) GN=blc PE=1 SV=1 Back     alignment and function description
>sp|P0A902|BLC_ECO57 Outer membrane lipoprotein blc OS=Escherichia coli O157:H7 GN=blc PE=3 SV=1 Back     alignment and function description
>sp|Q5URA7|YR877_MIMIV Putative lipocalin R877 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R877 PE=1 SV=1 Back     alignment and function description
>sp|P51910|APOD_MOUSE Apolipoprotein D OS=Mus musculus GN=Apod PE=2 SV=1 Back     alignment and function description
>sp|P05090|APOD_HUMAN Apolipoprotein D OS=Homo sapiens GN=APOD PE=1 SV=1 Back     alignment and function description
>sp|P23593|APOD_RAT Apolipoprotein D OS=Rattus norvegicus GN=Apod PE=1 SV=1 Back     alignment and function description
>sp|Q32KY0|APOD_BOVIN Apolipoprotein D OS=Bos taurus GN=APOD PE=2 SV=1 Back     alignment and function description
>sp|P37153|APOD_RABIT Apolipoprotein D OS=Oryctolagus cuniculus GN=APOD PE=2 SV=1 Back     alignment and function description
>sp|P51909|APOD_CAVPO Apolipoprotein D OS=Cavia porcellus GN=APOD PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
77744899186 temperature-induced lipocalin [Citrus si 0.961 0.672 1.0 1e-67
77744871185 temperature-induced lipocalin' [Populus 0.961 0.675 0.848 1e-58
77744905185 temperature-induced lipocalin [Populus t 0.961 0.675 0.84 6e-58
77744903185 temperature-induced lipocalin [Populus t 0.961 0.675 0.832 8e-58
255565025187 apolipoprotein d, putative [Ricinus comm 0.953 0.663 0.862 1e-57
118489127185 unknown [Populus trichocarpa x Populus d 0.961 0.675 0.84 2e-57
209967467185 temperature-induced lipocalin [Populus e 0.961 0.675 0.848 3e-57
224143988185 predicted protein [Populus trichocarpa] 0.961 0.675 0.84 6e-57
77744901185 temperature-induced lipocalin [Populus b 0.961 0.675 0.832 2e-56
297796725186 hypothetical protein ARALYDRAFT_918995 [ 0.961 0.672 0.824 4e-56
>gi|77744899|gb|ABB02403.1| temperature-induced lipocalin [Citrus sinensis] Back     alignment and taxonomy information
 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 125/125 (100%), Positives = 125/125 (100%)

Query: 1   MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS 60
           MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS
Sbjct: 1   MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS 60

Query: 61  DGKRGSIEGTAYKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPT 120
           DGKRGSIEGTAYKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPT
Sbjct: 61  DGKRGSIEGTAYKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPT 120

Query: 121 RKYLW 125
           RKYLW
Sbjct: 121 RKYLW 125

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|77744871|gb|ABB02389.1| temperature-induced lipocalin' [Populus balsamifera] gi|209967465|gb|ACJ02357.1| temperature-induced lipocalin [Populus tremula x Populus alba] Back     alignment and taxonomy information
>gi|77744905|gb|ABB02406.1| temperature-induced lipocalin [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|77744903|gb|ABB02405.1| temperature-induced lipocalin [Populus tremuloides] Back     alignment and taxonomy information
>gi|255565025|ref|XP_002523505.1| apolipoprotein d, putative [Ricinus communis] gi|223537212|gb|EEF38844.1| apolipoprotein d, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118489127|gb|ABK96370.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|209967467|gb|ACJ02358.1| temperature-induced lipocalin [Populus euphratica] Back     alignment and taxonomy information
>gi|224143988|ref|XP_002325147.1| predicted protein [Populus trichocarpa] gi|118489173|gb|ABK96393.1| unknown [Populus trichocarpa x Populus deltoides] gi|222866581|gb|EEF03712.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|77744901|gb|ABB02404.1| temperature-induced lipocalin [Populus balsamifera] Back     alignment and taxonomy information
>gi|297796725|ref|XP_002866247.1| hypothetical protein ARALYDRAFT_918995 [Arabidopsis lyrata subsp. lyrata] gi|297312082|gb|EFH42506.1| hypothetical protein ARALYDRAFT_918995 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
TAIR|locus:2155831186 TIL "temperature-induced lipoc 0.961 0.672 0.704 2.7e-45
UNIPROTKB|Q87UX2192 blc "Lipoprotein Blc" [Pseudom 0.946 0.640 0.352 2.6e-15
UNIPROTKB|Q4KJP2189 blc "Outer membrane lipoprotei 0.9 0.619 0.352 4.2e-15
UNIPROTKB|Q0BZJ9182 HNE_2399 "Lipocalin-like lipop 0.907 0.648 0.365 7.9e-14
UNIPROTKB|Q48PL5192 blc "Outer membrane lipoprotei 0.946 0.640 0.328 1e-13
UNIPROTKB|Q74AM6185 GSU2326 "Outer membrane lipopr 0.823 0.578 0.347 2.1e-13
TIGR_CMR|GSU_2326185 GSU_2326 "outer membrane lipop 0.823 0.578 0.347 2.1e-13
UNIPROTKB|P0A901177 blc [Escherichia coli K-12 (ta 0.830 0.610 0.336 6.6e-10
ZFIN|ZDB-GENE-070912-551189 si:dkey-52k20.7 "si:dkey-52k20 0.715 0.492 0.438 2.2e-09
DICTYBASE|DDB_G0269882182 DDB_G0269882 "lipocalin family 0.776 0.554 0.339 4.7e-09
TAIR|locus:2155831 TIL "temperature-induced lipocalin" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 476 (172.6 bits), Expect = 2.7e-45, P = 2.7e-45
 Identities = 88/125 (70%), Positives = 100/125 (80%)

Query:     1 MASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS 60
             M  KKEMEVV+GL+++RYMGRWYEIASFPSR QPKNG DTRATYTLN DGT+HV NETWS
Sbjct:     1 MTEKKEMEVVKGLNVERYMGRWYEIASFPSRFQPKNGVDTRATYTLNPDGTIHVLNETWS 60

Query:    61 DGKRGSIEGTAYKADPKSDEAKLXXXXXXXXXXXXXXXXGNYWVLYIDDNYQYALIGEPT 120
             +GKRG IEG+AYKADPKSDEAKL                G+YWVLYID +YQ+ALIG+P+
Sbjct:    61 NGKRGFIEGSAYKADPKSDEAKLKVKFYVPPFLPIIPVTGDYWVLYIDPDYQHALIGQPS 120

Query:   121 RKYLW 125
             R YLW
Sbjct:   121 RSYLW 125
GO:0005215 "transporter activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006810 "transport" evidence=IEA;ISS
GO:0009409 "response to cold" evidence=IEP
GO:0005739 "mitochondrion" evidence=IDA
GO:0005773 "vacuole" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009416 "response to light stimulus" evidence=IMP
GO:0009408 "response to heat" evidence=IMP
GO:0042538 "hyperosmotic salinity response" evidence=IMP
GO:0005829 "cytosol" evidence=RCA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
UNIPROTKB|Q87UX2 blc "Lipoprotein Blc" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KJP2 blc "Outer membrane lipoprotein Blc" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BZJ9 HNE_2399 "Lipocalin-like lipoprotein" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
UNIPROTKB|Q48PL5 blc "Outer membrane lipoprotein Blc" [Pseudomonas syringae pv. phaseolicola 1448A (taxid:264730)] Back     alignment and assigned GO terms
UNIPROTKB|Q74AM6 GSU2326 "Outer membrane lipoprotein, lipocalin family" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2326 GSU_2326 "outer membrane lipoprotein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P0A901 blc [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-551 si:dkey-52k20.7 "si:dkey-52k20.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269882 DDB_G0269882 "lipocalin family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
pfam08212140 pfam08212, Lipocalin_2, Lipocalin-like domain 8e-43
COG3040174 COG3040, Blc, Bacterial lipocalin [Cell envelope b 1e-27
PRK10477177 PRK10477, PRK10477, outer membrane lipoprotein Blc 4e-18
pfam00061140 pfam00061, Lipocalin, Lipocalin / cytosolic fatty- 0.001
>gnl|CDD|116798 pfam08212, Lipocalin_2, Lipocalin-like domain Back     alignment and domain information 
 Score =  137 bits (347), Expect = 8e-43
 Identities = 56/114 (49%), Positives = 69/114 (60%), Gaps = 10/114 (8%)

Query: 13  LDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETW-SDGKRGSIEGTA 71
           +D+ RYMG WYEIA  P R + +   D  ATYTL +DGT+ V N     DGK  + EG A
Sbjct: 1   VDLSRYMGTWYEIARLPMRFE-RGCVDVTATYTLRDDGTIAVTNRCRTPDGKWKTAEGKA 59

Query: 72  YKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPTRKYLW 125
             ADP S  AKLKV F+ P         G+YWVLY+D +Y +AL+G P R YLW
Sbjct: 60  KVADPGS-NAKLKVSFFGP-------FKGDYWVLYLDPDYSWALVGSPDRDYLW 105

Lipocalins are transporters for small hydrophobic molecules, such as lipids, steroid hormones, bilins, and retinoids. The structure is an eight-stranded beta barrel. Length = 140
>gnl|CDD|225582 COG3040, Blc, Bacterial lipocalin [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|182489 PRK10477, PRK10477, outer membrane lipoprotein Blc; Provisional Back     alignment and domain information
>gnl|CDD|215686 pfam00061, Lipocalin, Lipocalin / cytosolic fatty-acid binding protein family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
PF08212143 Lipocalin_2: Lipocalin-like domain; InterPro: IPR0 100.0
COG3040174 Blc Bacterial lipocalin [Cell envelope biogenesis, 100.0
PRK10477177 outer membrane lipoprotein Blc; Provisional 100.0
KOG4824224 consensus Apolipoprotein D/Lipocalin [Cell wall/me 99.97
PF00061144 Lipocalin: Lipocalin / cytosolic fatty-acid bindin 99.51
PF03973148 Triabin: Triabin; InterPro: IPR005657 This family 99.01
PF07137198 VDE: Violaxanthin de-epoxidase (VDE); InterPro: IP 98.1
PF02087178 Nitrophorin: Nitrophorin; InterPro: IPR002351 Nitr 97.76
PLN02372 455 violaxanthin de-epoxidase 97.55
PF11032186 ApoM: Apolipoprotein M (ApoM); InterPro: IPR022734 92.06
>PF08212 Lipocalin_2: Lipocalin-like domain; InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ] Back     alignment and domain information 
Probab=100.00  E-value=3.9e-37  Score=211.35  Aligned_cols=112  Identities=50%  Similarity=0.868  Sum_probs=94.4

Q ss_pred             CcccCcceeeEEEEEeCCCCCCCCCcceEEEEEEcCCCcEEEEEEEEe-CCeeeeEeeEEEEcCCCCCCceEEEEeeCCC
Q 032927           13 LDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS-DGKRGSIEGTAYKADPKSDEAKLKVKFYVPP   91 (130)
Q Consensus        13 fdl~~f~G~WYeiar~p~~~~~~~~~c~~~~y~~~~~g~~~v~~~~~~-~g~~~~~~g~~~~~~~~~~~~~~~v~f~~~~   91 (130)
                      |||+||+|+||||||+|+.+|++| .|++++|++.++|.|.|.|+|+. +|+...+.|+|++.++. .+|+|.|+|+..+
T Consensus         1 ~Dl~rY~G~WYEiar~p~~~q~~~-~~~~a~Yt~~~dg~i~V~n~~~~~~g~~~~~~g~a~~~~~~-~~~~l~V~f~~~~   78 (143)
T PF08212_consen    1 VDLDRYMGTWYEIARYPNFFQRGC-VCVTAEYTLRDDGTISVRNSCRRPDGKIKTIRGTATVVDPS-GPAKLKVRFPGIP   78 (143)
T ss_dssp             --CCCC-EEEEEEEEE--CCCTT--ECEEEEEEE-TTS-EEEEEEEEETTTCCCEEEEEEEESSBT-TSSEEEEESST--
T ss_pred             CChHHcCEeeeEEEEECCccccee-eeeeeeEEEcCCCEEEEEEEEEcCCCCEEEEEeEEEEcCCC-CccEEEEEEeccc
Confidence            799999999999999999999765 89999999999999999999996 89999999999998876 5899999995421


Q ss_pred             CCCcCcccccEEEEEEeCCCCEEEEEcCCCCEEEEEEcC
Q 032927           92 FFPIIPVVGNYWVLYIDDNYQYALIGEPTRKYLWGASYG  130 (130)
Q Consensus        92 ~~~~~~~~~~y~Vl~tDydY~yAiv~~~~~~~~WIlsR~  130 (130)
                          .+..++||||+|||||+++|++.++++++|||||.
T Consensus        79 ----~~~~~~YwVl~~D~dY~~~iv~~~~~~~~WILsR~  113 (143)
T PF08212_consen   79 ----FPPKGNYWVLYTDYDYSWAIVGSPDREYLWILSRT  113 (143)
T ss_dssp             -----TEEEEEEEEEEBTTSSEEEEEECCCCEEEEEESS
T ss_pred             ----cCCCcceEEEEEcCCccEEEEecCCCCEEEEEeCC
Confidence                15578999999999999999999999999999995

This is an eight stranded antiparallel beta-barrel with a repeated + 1 topology enclosing a internal ligand binding site [, ]. The name 'lipocalin' has been proposed [] for this protein family, but cytosolic fatty-acid binding proteins are also included. The sequences of most members of the family, the core or kernal lipocalins, are characterised by three short conserved stretches of residues, while others, the outlier lipocalin group, share only one or two of these [, ]. Proteins known to belong to this family include alpha-1-microglobulin (protein HC); alpha-1-acid glycoprotein (orosomucoid) []; aphrodisin; apolipoprotein D; beta-lactoglobulin; complement component C8 gamma chain []; crustacyanin []; epididymal-retinoic acid binding protein (E-RABP) []; insectacyanin; odorant-binding protein (OBP); human pregnancy-associated endometrial alpha-2 globulin; probasin (PB), a rat prostatic protein; prostaglandin D synthase (5.3.99.2 from EC) []; purpurin; Von Ebner's gland protein (VEGP) []; and lizard epididymal secretory protein IV (LESP IV) [].; GO: 0005488 binding; PDB: 3EBW_B 1QWD_A 2ACO_A 3MBT_A.
>COG3040 Blc Bacterial lipocalin [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10477 outer membrane lipoprotein Blc; Provisional Back     alignment and domain information
>KOG4824 consensus Apolipoprotein D/Lipocalin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF00061 Lipocalin: Lipocalin / cytosolic fatty-acid binding protein family fatty acid-binding protein signature lipocalin signature; InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ] Back     alignment and domain information
>PF03973 Triabin: Triabin; InterPro: IPR005657 This family contains saliva proteins from haematophagous insects that counteract vertebrate host haemostasis events such as coagulation, vasoconstriction and platelet aggregation [] Back     alignment and domain information
>PF07137 VDE: Violaxanthin de-epoxidase (VDE); InterPro: IPR010788 This family represents a conserved region approximately 350 residues long within plant violaxanthin de-epoxidase (VDE) Back     alignment and domain information
>PF02087 Nitrophorin: Nitrophorin; InterPro: IPR002351 Nitrophorins are haemoproteins found in saliva of blood-feeding insects [, ] Back     alignment and domain information
>PLN02372 violaxanthin de-epoxidase Back     alignment and domain information
>PF11032 ApoM: Apolipoprotein M (ApoM); InterPro: IPR022734 ApoM is a 25 kDa plasma protein associated with high-density lipoproteins (HDLs) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
2aco_A173 Xray Structure Of Blc Dimer In Complex With Vacceni 9e-09
1qwd_A177 Crystal Structure Of A Bacterial Lipocalin, The Blc 1e-08
3mbt_A168 Structure Of Monomeric Blc From E. Coli Length = 16 1e-08
2hzq_A174 Crystal Structure Of Human Apolipoprotein D (Apod) 1e-06
3ebw_A163 Crystal Structure Of Major Allergens, Per A 4 From 2e-04
>pdb|2ACO|A Chain A, Xray Structure Of Blc Dimer In Complex With Vaccenic Acid Length = 173 Back     alignment and structure 
Iteration: 1

 Score = 55.5 bits (132), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 11/121 (9%)
Query: 7   MEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSD--GKR 64
           + VV   D KRY+G WYEIA F  R + +      ATY+L +DG ++V N+ ++   G  
Sbjct: 24  VTVVNNFDAKRYLGTWYEIARFDHRFE-RGLEKVTATYSLRDDGGLNVINKGYNPDRGMW 82
Query: 65  GSIEGTAYKADPKSDEAKLXXXXXXXXXXXXXXXXGNYWVLYIDDNYQYALIGEPTRKYL 124
              EG AY     +  A                  G Y V+ +D  Y++AL+  P R YL
Sbjct: 83  QQSEGKAYFTGAPTRAA--------LKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYL 134
Query: 125 W 125
           W
Sbjct: 135 W 135
>pdb|1QWD|A Chain A, Crystal Structure Of A Bacterial Lipocalin, The Blc Gene Product From E. Coli Length = 177 Back     alignment and structure
>pdb|3MBT|A Chain A, Structure Of Monomeric Blc From E. Coli Length = 168 Back     alignment and structure
>pdb|2HZQ|A Chain A, Crystal Structure Of Human Apolipoprotein D (Apod) In Complex With Progesterone Length = 174 Back     alignment and structure
>pdb|3EBW|A Chain A, Crystal Structure Of Major Allergens, Per A 4 From Cockroaches Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
3fmz_A212 Retinol-binding protein 4; disease mutation, secre 2e-28
3ebw_A163 PER A 4 allergen; beta barrel, cockroach; HET: PE4 3e-28
1qwd_A177 Outer membrane lipoprotein BLC; bacterial lipocali 1e-26
1kt6_A183 RBP, plasma retinol-binding protein; transport pro 1e-26
2hzq_A174 Apolipoprotein D, APO-D, APOD; lipocalin, beta bar 9e-25
1z24_A189 Insecticyanin A form; blue biliprotein, INS-A, chr 4e-24
1kxo_A184 DIGA16; lipocalin, anticalin, genetical engineerin 8e-23
1i4u_A181 Crustacyanin; lipocalin fold, antiparallel beta ba 5e-21
1gka_B174 Crustacyanin A2 subunit; lipocalin, lobster, astax 5e-20
3bx8_A178 Engineered human lipocalin 2; protein design, liga 2e-15
3cbc_A198 Neutrophil gelatinase-associated lipocalin; sidero 3e-14
2l5p_A184 Lipocalin 12; beta barrel, transport protein; NMR 5e-13
1epa_A164 Epididymal retinoic acid-binding protein; 2.10A {R 3e-12
2xst_A161 Lipocalin 15; transport protein, LCN15, MSFL2541; 2e-11
3s26_A190 Neutrophil gelatinase-associated lipocalin; beta-b 2e-11
3o22_A162 Prostaglandin-H2 D-isomerase; lipocalin, prostagla 1e-08
1lf7_A182 Complement protein C8gamma; lipocalin, beta barrel 4e-08
1ew3_A159 Allergen EQU C 1; lipocalin, beta barrel; 2.30A {E 5e-08
1gm6_A175 SAL, salivary lipocalin; odorant-binding protein; 2e-06
2a2u_A181 Protein (alpha-2U-globulin); lipid binding protein 4e-06
3qkg_A193 Protein AMBP; beta barrel, binding protein, bound 5e-06
1beb_A162 Beta-lactoglobulin; lipocalin, MILK WHEY protein, 3e-05
3sao_A160 Extracellular fatty acid-binding protein; beta-bar 2e-04
1exs_A160 Beta-lactoglobulin; lipocalin fold, lipid-binding 6e-04
>3fmz_A Retinol-binding protein 4; disease mutation, secreted, sensory transduction, transport, vision, vitamin A, transport protein; HET: 2T1; 2.90A {Homo sapiens} Length = 212 Back     alignment and structure
 Score =  102 bits (254), Expect = 2e-28
 Identities = 24/131 (18%), Positives = 43/131 (32%), Gaps = 14/131 (10%)

Query: 6   EMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNE---TWSDG 62
              V    D  R+ G WY +A            +  A ++++E G +    +      + 
Sbjct: 37  SFRVKENFDKARFSGTWYAMAKKDPEGL-FLQDNIVAEFSVDETGQMSATAKGRVRLLNN 95

Query: 63  KRGSIEGTAYKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYID-DNYQYA------- 114
                +      D   D AK K+K++    F       ++W++  D D Y          
Sbjct: 96  WDVCADMVGTFTDT-EDPAKFKMKYWGVASFL-QKGNDDHWIVDTDYDTYAVQYSCRLLN 153

Query: 115 LIGEPTRKYLW 125
           L G     Y +
Sbjct: 154 LDGTCADSYSF 164
>3ebw_A PER A 4 allergen; beta barrel, cockroach; HET: PE4; 2.80A {Periplaneta americana} Length = 163 Back     alignment and structure
>1qwd_A Outer membrane lipoprotein BLC; bacterial lipocalin, lipid binding protein; 1.75A {Escherichia coli} SCOP: b.60.1.1 PDB: 2aco_A* 3mbt_A Length = 177 Back     alignment and structure
>1kt6_A RBP, plasma retinol-binding protein; transport protein; HET: RTL; 1.10A {Bos taurus} SCOP: b.60.1.1 PDB: 1erb_A* 1fem_A* 1fen_A* 1hbp_A* 1fel_A* 1kt4_A* 1kt3_A* 1kt7_A* 1hbq_A 1aqb_A* 1kt5_A* 1rlb_E* 1rbp_A* 1brq_A 1brp_A* 1jyd_A 1jyj_A 2wqa_E* 3bsz_E* 1qab_E* ... Length = 183 Back     alignment and structure
>2hzq_A Apolipoprotein D, APO-D, APOD; lipocalin, beta barrel, bilin-binding protein, transport protein; HET: STR; 1.80A {Homo sapiens} PDB: 2hzr_A Length = 174 Back     alignment and structure
>1z24_A Insecticyanin A form; blue biliprotein, INS-A, chromophore binding., lipid binding protein; HET: BLV; 2.60A {Manduca sexta} SCOP: b.60.1.1 Length = 189 Back     alignment and structure
>1kxo_A DIGA16; lipocalin, anticalin, genetical engineering, digoxigenin, ligand binding protein; 1.80A {Pieris brassicae} SCOP: b.60.1.1 PDB: 1lke_A* 1lnm_A* 1n0s_A* 1t0v_A 1bbp_A* Length = 184 Back     alignment and structure
>1i4u_A Crustacyanin; lipocalin fold, antiparallel beta barrel, transport protein; 1.15A {Synthetic} SCOP: b.60.1.1 PDB: 1obq_A 1obu_A 1s2p_A 1h91_A 1gka_A 1s44_A Length = 181 Back     alignment and structure
>1gka_B Crustacyanin A2 subunit; lipocalin, lobster, astaxanthin, bathochromic, coloration; HET: AXT D12 EPE; 3.23A {Homarus gammarus} SCOP: b.60.1.1 Length = 174 Back     alignment and structure
>3bx8_A Engineered human lipocalin 2; protein design, ligand binding protein, de novo protein, protein binding; HET: 1PE PE5; 2.00A {Homo sapiens} PDB: 3bx7_A* 3dtq_A 3dsz_A* 1l6m_A* 3tf6_A* 1x71_A* 1x89_A* 1x8u_A* 3fw4_A 3fw5_A 3k3l_A* 3pec_A* 3ped_A* 3tzs_A* 1ngl_A 1dfv_A* 1qqs_A* Length = 178 Back     alignment and structure
>3cbc_A Neutrophil gelatinase-associated lipocalin; siderocalin, NGAL, enterobactin, glycoprotein, pyrroli carboxylic acid, secreted; HET: DBS; 2.17A {Homo sapiens} PDB: 3hwg_A* 3hwf_A* 3hwe_A* 3u03_A* 3u0d_A* 3cmp_A* 3i0a_A* 3hwd_A 3t1d_A* 3by0_A* Length = 198 Back     alignment and structure
>2l5p_A Lipocalin 12; beta barrel, transport protein; NMR {Rattus norvegicus} Length = 184 Back     alignment and structure
>1epa_A Epididymal retinoic acid-binding protein; 2.10A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 1epb_A* Length = 164 Back     alignment and structure
>2xst_A Lipocalin 15; transport protein, LCN15, MSFL2541; 1.63A {Homo sapiens} Length = 161 Back     alignment and structure
>3s26_A Neutrophil gelatinase-associated lipocalin; beta-barrel, siderophore binding protein, N-linked glycosyla secreted, transport protein; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 2k23_A Length = 190 Back     alignment and structure
>3o22_A Prostaglandin-H2 D-isomerase; lipocalin, prostaglandin synthase; HET: OLA PLM; 1.40A {Homo sapiens} PDB: 3o19_A* 3o2y_A* 2wwp_A 2czt_A 2czu_A 2rq0_A 2e4j_A 2ktd_A* Length = 162 Back     alignment and structure
>1lf7_A Complement protein C8gamma; lipocalin, beta barrel, calyx, MAC, immune system; HET: CIT; 1.20A {Homo sapiens} SCOP: b.60.1.1 PDB: 1iw2_A* 2ovd_A* 2ove_A 2ova_A 2rd7_C 3ojy_C* 2qos_C Length = 182 Back     alignment and structure
>1ew3_A Allergen EQU C 1; lipocalin, beta barrel; 2.30A {Equus caballus} SCOP: b.60.1.1 Length = 159 Back     alignment and structure
>1gm6_A SAL, salivary lipocalin; odorant-binding protein; HET: NAG; 2.13A {Sus scrofa} SCOP: b.60.1.1 Length = 175 Back     alignment and structure
>2a2u_A Protein (alpha-2U-globulin); lipid binding protein; 2.50A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 2a2g_A Length = 181 Back     alignment and structure
>3qkg_A Protein AMBP; beta barrel, binding protein, bound chromophore, human plasm system; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>1beb_A Beta-lactoglobulin; lipocalin, MILK WHEY protein, bovine, retinol-binding; 1.80A {Bos taurus} SCOP: b.60.1.1 PDB: 3nq3_A* 1b0o_A 1bsq_A 1gx8_A* 1gx9_A* 1gxa_A* 2gj5_A* 2r56_A* 3npo_A 1b8e_A* 3nq9_A* 3qzj_A* 3qzk_A* 3ueu_A* 3uev_A* 3uew_A* 3uex_A* 4dq3_A* 4dq4_A* 1qg5_A ... Length = 162 Back     alignment and structure
>3sao_A Extracellular fatty acid-binding protein; beta-barrel, siderophore binding protein, transport protein; HET: NKN DBH; 1.80A {Gallus gallus} PDB: 1jzu_A 2kt4_B* 2lbv_A* Length = 160 Back     alignment and structure
>1exs_A Beta-lactoglobulin; lipocalin fold, lipid-binding protein; 2.39A {Sus scrofa} SCOP: b.60.1.1 Length = 160 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
3ebw_A163 PER A 4 allergen; beta barrel, cockroach; HET: PE4 100.0
1qwd_A177 Outer membrane lipoprotein BLC; bacterial lipocali 100.0
2hzq_A174 Apolipoprotein D, APO-D, APOD; lipocalin, beta bar 100.0
3fmz_A212 Retinol-binding protein 4; disease mutation, secre 100.0
1gka_B174 Crustacyanin A2 subunit; lipocalin, lobster, astax 99.98
1z24_A189 Insecticyanin A form; blue biliprotein, INS-A, chr 99.97
1kxo_A184 DIGA16; lipocalin, anticalin, genetical engineerin 99.97
1i4u_A181 Crustacyanin; lipocalin fold, antiparallel beta ba 99.97
1kt6_A183 RBP, plasma retinol-binding protein; transport pro 99.97
3bx8_A178 Engineered human lipocalin 2; protein design, liga 99.96
2xst_A161 Lipocalin 15; transport protein, LCN15, MSFL2541; 99.96
1beb_A162 Beta-lactoglobulin; lipocalin, MILK WHEY protein, 99.96
1gm6_A175 SAL, salivary lipocalin; odorant-binding protein; 99.96
3cbc_A198 Neutrophil gelatinase-associated lipocalin; sidero 99.96
1exs_A160 Beta-lactoglobulin; lipocalin fold, lipid-binding 99.96
1ew3_A159 Allergen EQU C 1; lipocalin, beta barrel; 2.30A {E 99.96
3s26_A190 Neutrophil gelatinase-associated lipocalin; beta-b 99.96
2a2u_A181 Protein (alpha-2U-globulin); lipid binding protein 99.95
2l5p_A184 Lipocalin 12; beta barrel, transport protein; NMR 99.95
1lf7_A182 Complement protein C8gamma; lipocalin, beta barrel 99.95
2ra6_A166 Trichosurin; lipocalin, beta barrel, glycoprotein, 99.95
3ebk_A176 Allergen BLA G 4; beta barrel, cockroach, glycopro 99.94
1bj7_A156 D 2; allergen, lipocalin; 1.80A {Bos taurus} SCOP: 99.94
1xki_A162 VON ebner'S gland protein; beta barrel, ligand bin 99.94
1epa_A164 Epididymal retinoic acid-binding protein; 2.10A {R 99.93
1dzk_A157 PIG OBP, odorant-binding protein; lipocalin, trans 99.93
2hlv_A160 Odorant-binding protein; domain swapping, transpor 99.93
3o22_A162 Prostaglandin-H2 D-isomerase; lipocalin, prostagla 99.93
1e5p_A151 Aphrodisin; lipocalin, pheromone, hamster,; HET: M 99.92
3qkg_A193 Protein AMBP; beta barrel, binding protein, bound 99.91
3kff_A162 MUP 4, major urinary protein 4; pheromone, lipocal 99.9
1avg_I142 Triabin; bovine thrombin, thrombin inhibitor, comp 99.89
3sao_A160 Extracellular fatty acid-binding protein; beta-bar 99.88
3l4r_A170 Allergen DOG 2, minor allergen CAN F 2; lipocalin 99.88
1pm1_X180 Nitrophorin 2, NP2, prolixin-S; beta barrel, lipoc 99.85
1x8p_A184 Nitrophorin 4, NP4; lipocalin, beta barrel, ferric 99.81
4ge1_A197 Biogenic amine-binding protein; lipocalin binding 99.71
3kq0_A192 Alpha-1-acid glycoprotein 1; plasma protein, polym 99.67
3fiq_A157 OBP1, RCG36470, odorant-binding protein 1F; lipoca 99.44
3cqn_A185 Violaxanthin DE-epoxidase, chloroplast; lipocalin, 99.0
3bx6_A192 Alpha-1-acid glycoprotein; plasma protein, acute p 98.67
>3ebw_A PER A 4 allergen; beta barrel, cockroach; HET: PE4; 2.80A {Periplaneta americana} Back     alignment and structure
Probab=100.00  E-value=3.8e-38  Score=219.47  Aligned_cols=120  Identities=21%  Similarity=0.368  Sum_probs=105.4

Q ss_pred             CCCCCCccccCCcccCcceeeEEEEEeCCCCCCCCCcceEEEEEEcCCCcEEEEEEEEeCCeee-eEeeEEEEcCCCCCC
Q 032927            2 ASKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWSDGKRG-SIEGTAYKADPKSDE   80 (130)
Q Consensus         2 ~~~~~~~~~~~fdl~~f~G~WYeiar~p~~~~~~~~~c~~~~y~~~~~g~~~v~~~~~~~g~~~-~~~g~~~~~~~~~~~   80 (130)
                      +.||.++++++||++||+|+||||||+|+.+|+++.+|++++|++.+||.|+|.|++ .+|+++ .+.|+|+++++. .+
T Consensus         2 ~~Cp~v~~~~~fdl~ry~G~WYeiar~~~~fe~~~~~~~~a~Y~l~~dg~i~V~n~~-~~g~~~~~~~G~a~~~~~~-~~   79 (163)
T 3ebw_A            2 DSCQIGTSFTGLDMTKYVGTWYELFRTPNSDEEDFTNCEYDKYTLDENGVIQVTSVA-YTNSIRGFITSTGTVPSWT-ED   79 (163)
T ss_dssp             CSCCCCCCCCCCCTTTTCEEEEEEEECCCSTTSSCCSCEEEEEEECTTSCEEEEEEE-ECSTTSSEEEEEEECCCBC-SS
T ss_pred             CCCcCCCccCCCChHHhCEEeEEEEEeCcccccCcCccceEEEEECCCCeEEEEEEe-eCCeEEEEEEEEEEeCCCC-CC
Confidence            689999999999999999999999999999998754899999999999999999999 688999 999999998765 68


Q ss_pred             ceEEEEeeCCCCCCcCcccccEEEEEEeCCCCEEEEE-----cCCCCEEEEEEcC
Q 032927           81 AKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIG-----EPTRKYLWGASYG  130 (130)
Q Consensus        81 ~~~~v~f~~~~~~~~~~~~~~y~Vl~tDydY~yAiv~-----~~~~~~~WIlsR~  130 (130)
                      | |+|+|. +    .+|+.++||||+|||+ +|||++     .++.+++|||||.
T Consensus        80 ~-l~v~f~-~----~~~~~~~y~Vl~tDY~-~Ya~v~~c~~~~~~~~~~wilsR~  127 (163)
T 3ebw_A           80 T-FDIAYG-D----DETWSSTYFMVGTDYQ-TYSIVAGCLDNDYSRHLYWIASHE  127 (163)
T ss_dssp             E-EEEBC-----------CEEEEEEEECSS-SCEEEEEEETTEEEEEEEEEEESS
T ss_pred             c-eEEEec-c----CCCccccEEEEEeCCC-CEEEEEEecCCCccceEEEEEeCC
Confidence            8 999984 1    1456789999999999 999995     6788999999995
>1qwd_A Outer membrane lipoprotein BLC; bacterial lipocalin, lipid binding protein; 1.75A {Escherichia coli} SCOP: b.60.1.1 PDB: 2aco_A* 3mbt_A Back     alignment and structure
>2hzq_A Apolipoprotein D, APO-D, APOD; lipocalin, beta barrel, bilin-binding protein, transport protein; HET: STR; 1.80A {Homo sapiens} PDB: 2hzr_A Back     alignment and structure
>3fmz_A Retinol-binding protein 4; disease mutation, secreted, sensory transduction, transport, vision, vitamin A, transport protein; HET: 2T1; 2.90A {Homo sapiens} Back     alignment and structure
>1gka_B Crustacyanin A2 subunit; lipocalin, lobster, astaxanthin, bathochromic, coloration; HET: AXT D12 EPE; 3.23A {Homarus gammarus} SCOP: b.60.1.1 Back     alignment and structure
>1z24_A Insecticyanin A form; blue biliprotein, INS-A, chromophore binding., lipid binding protein; HET: BLV; 2.60A {Manduca sexta} SCOP: b.60.1.1 Back     alignment and structure
>1kxo_A DIGA16; lipocalin, anticalin, genetical engineering, digoxigenin, ligand binding protein; 1.80A {Pieris brassicae} SCOP: b.60.1.1 PDB: 1lke_A* 1lnm_A* 1n0s_A* 1t0v_A 1bbp_A* Back     alignment and structure
>1i4u_A Crustacyanin; lipocalin fold, antiparallel beta barrel, transport protein; 1.15A {Synthetic} SCOP: b.60.1.1 PDB: 1obq_A 1obu_A 1s2p_A 1h91_A 1gka_A 1s44_A Back     alignment and structure
>1kt6_A RBP, plasma retinol-binding protein; transport protein; HET: RTL; 1.10A {Bos taurus} SCOP: b.60.1.1 PDB: 1erb_A* 1fem_A* 1fen_A* 1hbp_A* 1fel_A* 1kt4_A* 1kt3_A* 1kt7_A* 1hbq_A 1aqb_A* 1kt5_A* 1rlb_E* 1rbp_A* 1brq_A 1brp_A* 1jyd_A 1jyj_A 2wqa_E* 3bsz_E* 1qab_E* ... Back     alignment and structure
>3bx8_A Engineered human lipocalin 2; protein design, ligand binding protein, de novo protein, protein binding; HET: 1PE PE5; 2.00A {Homo sapiens} PDB: 3bx7_A* 3dtq_A 3dsz_A* 1l6m_A* 3tf6_A* 1x71_A* 1x89_A* 1x8u_A* 3fw4_A 3fw5_A 3k3l_A* 3pec_A* 3ped_A* 3tzs_A* 1ngl_A 1dfv_A* 1qqs_A* Back     alignment and structure
>2xst_A Lipocalin 15; transport protein, LCN15, MSFL2541; 1.63A {Homo sapiens} Back     alignment and structure
>1beb_A Beta-lactoglobulin; lipocalin, MILK WHEY protein, bovine, retinol-binding; 1.80A {Bos taurus} SCOP: b.60.1.1 PDB: 3nq3_A* 1b0o_A 1bsq_A 1gx8_A* 1gx9_A* 1gxa_A* 2gj5_A* 2r56_A* 3npo_A 1b8e_A* 3nq9_A* 3qzj_A* 3qzk_A* 3ueu_A* 3uev_A* 3uew_A* 3uex_A* 4dq3_A* 4dq4_A* 1qg5_A ... Back     alignment and structure
>1gm6_A SAL, salivary lipocalin; odorant-binding protein; HET: NAG; 2.13A {Sus scrofa} SCOP: b.60.1.1 Back     alignment and structure
>3cbc_A Neutrophil gelatinase-associated lipocalin; siderocalin, NGAL, enterobactin, glycoprotein, pyrroli carboxylic acid, secreted; HET: DBS; 2.17A {Homo sapiens} PDB: 3hwg_A* 3hwf_A* 3hwe_A* 3u03_A* 3u0d_A* 3cmp_A* 3i0a_A* 3hwd_A 3t1d_A* 3by0_A* Back     alignment and structure
>1exs_A Beta-lactoglobulin; lipocalin fold, lipid-binding protein; 2.39A {Sus scrofa} SCOP: b.60.1.1 Back     alignment and structure
>1ew3_A Allergen EQU C 1; lipocalin, beta barrel; 2.30A {Equus caballus} SCOP: b.60.1.1 Back     alignment and structure
>3s26_A Neutrophil gelatinase-associated lipocalin; beta-barrel, siderophore binding protein, N-linked glycosyla secreted, transport protein; HET: NAG BMA MAN; 1.80A {Mus musculus} SCOP: b.60.1.1 PDB: 2k23_A Back     alignment and structure
>2a2u_A Protein (alpha-2U-globulin); lipid binding protein; 2.50A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 2a2g_A Back     alignment and structure
>2l5p_A Lipocalin 12; beta barrel, transport protein; NMR {Rattus norvegicus} Back     alignment and structure
>1lf7_A Complement protein C8gamma; lipocalin, beta barrel, calyx, MAC, immune system; HET: CIT; 1.20A {Homo sapiens} SCOP: b.60.1.1 PDB: 1iw2_A* 2ovd_A* 2ove_A 2ova_A 2rd7_C 3ojy_C* 2qos_C Back     alignment and structure
>2ra6_A Trichosurin; lipocalin, beta barrel, glycoprotein, MILK protein, secreted, transport, transport protein; 1.50A {Trichosurus vulpecula} PDB: 2r73_A 2r74_A Back     alignment and structure
>3ebk_A Allergen BLA G 4; beta barrel, cockroach, glycoprotein, secreted; 1.90A {Blattella germanica} Back     alignment and structure
>1bj7_A D 2; allergen, lipocalin; 1.80A {Bos taurus} SCOP: b.60.1.1 Back     alignment and structure
>1xki_A VON ebner'S gland protein; beta barrel, ligand binding protein, transport protein; 1.80A {Homo sapiens} SCOP: b.60.1.1 PDB: 3eyc_A Back     alignment and structure
>1epa_A Epididymal retinoic acid-binding protein; 2.10A {Rattus norvegicus} SCOP: b.60.1.1 PDB: 1epb_A* Back     alignment and structure
>1dzk_A PIG OBP, odorant-binding protein; lipocalin, transport, olfaction, sensory transduction; HET: PRZ; 1.48A {Sus scrofa} SCOP: b.60.1.1 PDB: 1dzj_A* 1dzm_A* 1dzp_A* 1e00_A* 1e02_A* 1e06_A* 1hqp_A* 1a3y_A Back     alignment and structure
>2hlv_A Odorant-binding protein; domain swapping, transport protein; HET: LIK; 1.65A {Bos taurus} PDB: 1gt1_A* 1gt3_A* 1gt4_A* 1gt5_A* 1hn2_A* 1obp_A 1g85_A 1pbo_A* Back     alignment and structure
>3o22_A Prostaglandin-H2 D-isomerase; lipocalin, prostaglandin synthase; HET: OLA PLM; 1.40A {Homo sapiens} PDB: 3o19_A* 3o2y_A* 2wwp_A 2czt_A 2czu_A 2rq0_A 2e4j_A 2ktd_A* Back     alignment and structure
>1e5p_A Aphrodisin; lipocalin, pheromone, hamster,; HET: MSE; 1.63A {Mesocricetus auratus} SCOP: b.60.1.1 Back     alignment and structure
>3qkg_A Protein AMBP; beta barrel, binding protein, bound chromophore, human plasm system; 2.30A {Homo sapiens} Back     alignment and structure
>3kff_A MUP 4, major urinary protein 4; pheromone, lipocalin, beta barrel, DI bond, pheromone-binding, secreted, transport, transport Pro; 0.96A {Mus musculus} SCOP: b.60.1.1 PDB: 3kfg_A 3kfh_A 3kfi_A 2l9c_A 2lb6_A 1i06_A 1i05_A* 1i04_A 1mup_A 1znd_A 1qy0_A* 1qy2_A* 1qy1_A 1zne_A 1zng_A 1znh_A 1znk_A* 1znl_A* 2dm5_A* 2ozq_A ... Back     alignment and structure
>1avg_I Triabin; bovine thrombin, thrombin inhibitor, complex (blood coagulation/inhibitor); 2.60A {Triatoma pallidipennis} SCOP: b.60.1.3 Back     alignment and structure
>3sao_A Extracellular fatty acid-binding protein; beta-barrel, siderophore binding protein, transport protein; HET: NKN DBH; 1.80A {Gallus gallus} SCOP: b.60.1.1 PDB: 1jzu_A 2kt4_B* 2lbv_A* Back     alignment and structure
>3l4r_A Allergen DOG 2, minor allergen CAN F 2; lipocalin allergen, disulfide bond, secreted, TRAN lipid binding protein; 1.45A {Canis familiaris} Back     alignment and structure
>1pm1_X Nitrophorin 2, NP2, prolixin-S; beta barrel, lipocalin, imidazole, ferric heme, blood clotting inhibitor; HET: HEM; 1.10A {Rhodnius prolixus} SCOP: b.60.1.1 PDB: 2all_X* 2amm_X* 2hys_A* 1euo_A* 1pee_A* 1t68_X* 2acp_X* 2ah7_X* 2al0_X* 2gtf_X* 2a3f_X* 2eu7_X* 2asn_X* Back     alignment and structure
>1x8p_A Nitrophorin 4, NP4; lipocalin, beta barrel, ferric heme, ligand binding protein; HET: HEM; 0.85A {Rhodnius prolixus} SCOP: b.60.1.1 PDB: 1d3s_A* 1eqd_A* 1erx_A* 1ike_A* 1ikj_A* 1d2u_A* 1ml7_A* 1np4_A* 1u0x_A* 1x8n_A* 1koi_A* 1x8o_A* 1x8q_A* 1ywa_A* 1ywb_A* 1ywc_A* 1ywd_A* 2at4_X* 2at5_X* 2at6_X* ... Back     alignment and structure
>4ge1_A Biogenic amine-binding protein; lipocalin binding protein, serotonin, norepinephrine, saliva amine-binding protein; HET: TSS; 2.15A {Rhodnius prolixus} PDB: 4get_A* 4hfo_A Back     alignment and structure
>3kq0_A Alpha-1-acid glycoprotein 1; plasma protein, polymorphism, acute phase protein, secreted, pyrrolidone carboxylic acid, lipocalin; 1.80A {Homo sapiens} PDB: 3apu_A* 3apv_A* 3apw_A* 3apx_A* Back     alignment and structure
>3fiq_A OBP1, RCG36470, odorant-binding protein 1F; lipocalin, oderant-binding protein, transport protein; 1.60A {Rattus norvegicus} SCOP: b.60.1.0 Back     alignment and structure
>3cqn_A Violaxanthin DE-epoxidase, chloroplast; lipocalin, enzyme, xanthophyll cycle, non photochemical quenching, NPQ, antheraxanthin, zeaxanthin; 2.00A {Arabidopsis thaliana} PDB: 3cqr_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d1qwda_167 b.60.1.1 (A:) Outer membrane lipoprotein Blc {Esch 1e-23
d1kt7a_175 b.60.1.1 (A:) Retinol binding protein {Cow (Bos ta 1e-23
d1i4ua_181 b.60.1.1 (A:) Alpha-crustacyanin {European lobster 3e-21
d1lf7a_171 b.60.1.1 (A:) Complement protein C8gamma {Human (H 5e-21
d1x71a1174 b.60.1.1 (A:4-177) Neutrophil gelatinase-associate 2e-20
d1z24a1189 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm 8e-20
d1kxoa_171 b.60.1.1 (A:) Bilin-binding protein {Cabbage butte 1e-18
d1epba_160 b.60.1.1 (A:) Retinoic acid-binding protein {Rat ( 2e-17
d1avgi_142 b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug ( 3e-17
d1pm1x_180 b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius 9e-17
d1exsa_160 b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) 4e-15
d1ew3a_159 b.60.1.1 (A:) Lipocalin allergen {Horse (Equus cab 5e-15
d1gm6a_158 b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) 9e-15
d1beba_156 b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) 1e-14
d1gkab_174 b.60.1.1 (B:) Alpha-crustacyanin {European lobster 5e-14
d1jzua_157 b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturni 5e-14
d2a2ua_158 b.60.1.1 (A:) Major urinary protein/alpha-2u-globu 7e-14
d1x8qa_184 b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [Ta 2e-11
d1znda1157 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u- 3e-11
d1bj7a_150 b.60.1.1 (A:) Lipocalin allergen {Cow (Bos taurus) 3e-10
d1xkia_139 b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tea 2e-06
d1gt1a_158 b.60.1.1 (A:) Odorant-binding protein {Cow (Bos ta 5e-04
>d1qwda_ b.60.1.1 (A:) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]} Length = 167 Back     information, alignment and structure

class: All beta proteins
fold: Lipocalins
superfamily: Lipocalins
family: Retinol binding protein-like
domain: Outer membrane lipoprotein Blc
species: Escherichia coli [TaxId: 562]

 Score = 87.9 bits (217), Expect = 1e-23
 Identities = 45/121 (37%), Positives = 63/121 (52%), Gaps = 11/121 (9%)

Query: 7   MEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS--DGKR 64
           + VV   D KRY+G WYEIA F  R + +      ATY+L +DG ++V N+ ++   G  
Sbjct: 19  VTVVNNFDAKRYLGTWYEIARFDHRFE-RGLEKVTATYSLRDDGGLNVINKGYNPDRGMW 77

Query: 65  GSIEGTAYKADPKSDEAKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPTRKYL 124
              EG AY        A LKV F+ P +       G Y V+ +D  Y++AL+  P R YL
Sbjct: 78  QQSEGKAYFTGA-PTRAALKVSFFGPFY-------GGYNVIALDREYRHALVCGPDRDYL 129

Query: 125 W 125
           W
Sbjct: 130 W 130
>d1kt7a_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 175 Back     information, alignment and structure
>d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Length = 181 Back     information, alignment and structure
>d1lf7a_ b.60.1.1 (A:) Complement protein C8gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1x71a1 b.60.1.1 (A:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 189 Back     information, alignment and structure
>d1kxoa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]} Length = 171 Back     information, alignment and structure
>d1epba_ b.60.1.1 (A:) Retinoic acid-binding protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 160 Back     information, alignment and structure
>d1avgi_ b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (Triatoma pallidipennis) [TaxId: 30077]} Length = 142 Back     information, alignment and structure
>d1pm1x_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]} Length = 180 Back     information, alignment and structure
>d1exsa_ b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]} Length = 160 Back     information, alignment and structure
>d1ew3a_ b.60.1.1 (A:) Lipocalin allergen {Horse (Equus caballus), equ c 1 [TaxId: 9796]} Length = 159 Back     information, alignment and structure
>d1gm6a_ b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]} Length = 158 Back     information, alignment and structure
>d1beba_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]} Length = 156 Back     information, alignment and structure
>d1gkab_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Length = 174 Back     information, alignment and structure
>d1jzua_ b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturnix coturnix) [TaxId: 9091]} Length = 157 Back     information, alignment and structure
>d2a2ua_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 158 Back     information, alignment and structure
>d1x8qa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]} Length = 184 Back     information, alignment and structure
>d1znda1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]} Length = 157 Back     information, alignment and structure
>d1bj7a_ b.60.1.1 (A:) Lipocalin allergen {Cow (Bos taurus), bos d 2 [TaxId: 9913]} Length = 150 Back     information, alignment and structure
>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1gt1a_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]} Length = 158 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1qwda_167 Outer membrane lipoprotein Blc {Escherichia coli [ 100.0
d1kxoa_171 Bilin-binding protein {Cabbage butterfly (Pieris b 99.98
d1kt7a_175 Retinol binding protein {Cow (Bos taurus) [TaxId: 99.98
d1i4ua_181 Alpha-crustacyanin {European lobster (Homarus gamm 99.97
d1gkab_174 Alpha-crustacyanin {European lobster (Homarus gamm 99.97
d1z24a1189 Insecticyanin {Tobacco hornworm (Manduca sexta) [T 99.97
d1x71a1174 Neutrophil gelatinase-associated lipocalin (NGAL) 99.96
d1avgi_142 Thrombin inhibitor {Triatomine bug (Triatoma palli 99.94
d1lf7a_171 Complement protein C8gamma {Human (Homo sapiens) [ 99.94
d1exsa_160 beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823] 99.93
d1ew3a_159 Lipocalin allergen {Horse (Equus caballus), equ c 99.93
d1beba_156 beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913] 99.93
d1epba_160 Retinoic acid-binding protein {Rat (Rattus norvegi 99.92
d1gm6a_158 Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823] 99.92
d1pm1x_180 Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [Tax 99.9
d2a2ua_158 Major urinary protein/alpha-2u-globulin {Rat (Ratt 99.89
d1znda1157 Major urinary protein/alpha-2u-globulin {Mouse (Mu 99.88
d1jzua_157 Lipocalin q83 {Common quail (Coturnix coturnix) [T 99.87
d1x8qa_184 Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]} 99.84
d1bj7a_150 Lipocalin allergen {Cow (Bos taurus), bos d 2 [Tax 99.72
d1xkia_139 Von Ebner's gland protein (VEGP, tear lipocalin) { 99.7
d1gt1a_158 Odorant-binding protein {Cow (Bos taurus) [TaxId: 99.65
d1dzka_148 Odorant-binding protein {Pig (Sus scrofa) [TaxId: 99.13
d1e5pa_149 Aphrodisin, a sex pheromone {Golden hamster (Mesoc 98.96
>d1qwda_ b.60.1.1 (A:) Outer membrane lipoprotein Blc {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Lipocalins
superfamily: Lipocalins
family: Retinol binding protein-like
domain: Outer membrane lipoprotein Blc
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=3.2e-33  Score=192.41  Aligned_cols=119  Identities=39%  Similarity=0.669  Sum_probs=106.8

Q ss_pred             CCCCCccccCCcccCcceeeEEEEEeCCCCCCCCCcceEEEEEEcCCCcEEEEEEEEe--CCeeeeEeeEEEEcCCCCCC
Q 032927            3 SKKEMEVVRGLDIKRYMGRWYEIASFPSRNQPKNGADTRATYTLNEDGTVHVRNETWS--DGKRGSIEGTAYKADPKSDE   80 (130)
Q Consensus         3 ~~~~~~~~~~fdl~~f~G~WYeiar~p~~~~~~~~~c~~~~y~~~~~g~~~v~~~~~~--~g~~~~~~g~~~~~~~~~~~   80 (130)
                      .||++++++|||++||+|+|||||++|+.++.+| .|+++.|++.++|.+.|.+++..  ++....+.|.+++.+.. .+
T Consensus        15 p~~~v~~v~nFDl~rf~G~WYeia~~p~~~~~~~-~~~~~~y~~~~~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~-~~   92 (167)
T d1qwda_          15 PPRGVTVVNNFDAKRYLGTWYEIARFDHRFERGL-EKVTATYSLRDDGGLNVINKGYNPDRGMWQQSEGKAYFTGAP-TR   92 (167)
T ss_dssp             CTTCEEEESSCCHHHHCEEEEEEEECCCGGGTTC-EEEEEEEEECTTSCEEEEEEEEETTTTEEEEEEEEEEESSCT-TS
T ss_pred             CCCCCccCCCCCHHHcCeEeeEEEEcCCchhcCc-eeeEEEeeecCCCcEEEEEEEEcCCCCceEEeeeeEEeeCCC-CC
Confidence            3678999999999999999999999999999876 89999999999999999999876  56678899999988765 67


Q ss_pred             ceEEEEeeCCCCCCcCcccccEEEEEEeCCCCEEEEEcCCCCEEEEEEcC
Q 032927           81 AKLKVKFYVPPFFPIIPVVGNYWVLYIDDNYQYALIGEPTRKYLWGASYG  130 (130)
Q Consensus        81 ~~~~v~f~~~~~~~~~~~~~~y~Vl~tDydY~yAiv~~~~~~~~WIlsR~  130 (130)
                      +++.+.+..       +...+|+|+.+|+||+|||++.++++++|||||.
T Consensus        93 ~~~~~~~~~-------~~~~~y~v~~~d~dY~~~iv~~~~~~~~wIlsR~  135 (167)
T d1qwda_          93 AALKVSFFG-------PFYGGYNVIALDREYRHALVCGPDRDYLWILSRT  135 (167)
T ss_dssp             CEEEEEEET-------TEEEEEEEEEEBTTSSEEEEECSSTTCEEEEESS
T ss_pred             cEEEEeccC-------ccCCceEEEEEccCCCEEEEEecCCceEEEEEcC
Confidence            899988742       4578999999999999999999999999999995
>d1kxoa_ b.60.1.1 (A:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]} Back     information, alignment and structure
>d1kt7a_ b.60.1.1 (A:) Retinol binding protein {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i4ua_ b.60.1.1 (A:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Back     information, alignment and structure
>d1gkab_ b.60.1.1 (B:) Alpha-crustacyanin {European lobster (Homarus gammarus) [TaxId: 6707]} Back     information, alignment and structure
>d1z24a1 b.60.1.1 (A:1-189) Insecticyanin {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Back     information, alignment and structure
>d1x71a1 b.60.1.1 (A:4-177) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avgi_ b.60.1.3 (I:) Thrombin inhibitor {Triatomine bug (Triatoma pallidipennis) [TaxId: 30077]} Back     information, alignment and structure
>d1lf7a_ b.60.1.1 (A:) Complement protein C8gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exsa_ b.60.1.1 (A:) beta-Lactoglobulin {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ew3a_ b.60.1.1 (A:) Lipocalin allergen {Horse (Equus caballus), equ c 1 [TaxId: 9796]} Back     information, alignment and structure
>d1beba_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1epba_ b.60.1.1 (A:) Retinoic acid-binding protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gm6a_ b.60.1.1 (A:) Salivary lipocalin {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pm1x_ b.60.1.1 (X:) Nitrophorin 2 (prolixin-s) {Rhodnius prolixus [TaxId: 13249]} Back     information, alignment and structure
>d2a2ua_ b.60.1.1 (A:) Major urinary protein/alpha-2u-globulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1znda1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jzua_ b.60.1.1 (A:) Lipocalin q83 {Common quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d1x8qa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]} Back     information, alignment and structure
>d1bj7a_ b.60.1.1 (A:) Lipocalin allergen {Cow (Bos taurus), bos d 2 [TaxId: 9913]} Back     information, alignment and structure
>d1xkia_ b.60.1.1 (A:) Von Ebner's gland protein (VEGP, tear lipocalin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gt1a_ b.60.1.1 (A:) Odorant-binding protein {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dzka_ b.60.1.1 (A:) Odorant-binding protein {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e5pa_ b.60.1.1 (A:) Aphrodisin, a sex pheromone {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure