Citrus Sinensis ID: 032935
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 130 | ||||||
| 359386154 | 165 | group B HMG-box protein [Citrus sinensis | 0.984 | 0.775 | 1.0 | 9e-66 | |
| 224112525 | 176 | high mobility group family [Populus tric | 0.984 | 0.727 | 0.796 | 7e-50 | |
| 225448398 | 166 | PREDICTED: high mobility group B protein | 0.984 | 0.771 | 0.804 | 9e-48 | |
| 225448400 | 156 | PREDICTED: high mobility group B protein | 0.984 | 0.820 | 0.804 | 2e-47 | |
| 118484946 | 171 | unknown [Populus trichocarpa] | 0.984 | 0.748 | 0.726 | 5e-45 | |
| 224098541 | 179 | high mobility group family [Populus tric | 0.984 | 0.715 | 0.726 | 5e-45 | |
| 255571919 | 190 | DNA-binding protein MNB1B, putative [Ric | 0.984 | 0.673 | 0.781 | 2e-44 | |
| 449461783 | 169 | PREDICTED: high mobility group B protein | 0.984 | 0.757 | 0.705 | 2e-40 | |
| 312281849 | 185 | unnamed protein product [Thellungiella h | 0.946 | 0.664 | 0.658 | 1e-36 | |
| 359486418 | 151 | PREDICTED: high mobility group B protein | 0.869 | 0.748 | 0.703 | 2e-36 |
| >gi|359386154|gb|AEV43366.1| group B HMG-box protein [Citrus sinensis] | Back alignment and taxonomy information |
|---|
Score = 254 bits (649), Expect = 9e-66, Method: Compositional matrix adjust.
Identities = 128/128 (100%), Positives = 128/128 (100%)
Query: 1 MKVTRGKGAVKKDKNEVVKPVEDRAAGKRKAVLKASRSSNKRTKNVKSAKKDPNKPKRPP 60
MKVTRGKGAVKKDKNEVVKPVEDRAAGKRKAVLKASRSSNKRTKNVKSAKKDPNKPKRPP
Sbjct: 1 MKVTRGKGAVKKDKNEVVKPVEDRAAGKRKAVLKASRSSNKRTKNVKSAKKDPNKPKRPP 60
Query: 61 SAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEKAPFEAKAAKRKLDYEKL 120
SAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEKAPFEAKAAKRKLDYEKL
Sbjct: 61 SAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEKAPFEAKAAKRKLDYEKL 120
Query: 121 MTAYNKKQ 128
MTAYNKKQ
Sbjct: 121 MTAYNKKQ 128
|
Source: Citrus sinensis Species: Citrus sinensis Genus: Citrus Family: Rutaceae Order: Sapindales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224112525|ref|XP_002316220.1| high mobility group family [Populus trichocarpa] gi|222865260|gb|EEF02391.1| high mobility group family [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225448398|ref|XP_002269398.1| PREDICTED: high mobility group B protein 1 isoform 1 [Vitis vinifera] gi|147854340|emb|CAN83423.1| hypothetical protein VITISV_023376 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225448400|ref|XP_002270185.1| PREDICTED: high mobility group B protein 1 isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|118484946|gb|ABK94338.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224098541|ref|XP_002311212.1| high mobility group family [Populus trichocarpa] gi|222851032|gb|EEE88579.1| high mobility group family [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255571919|ref|XP_002526902.1| DNA-binding protein MNB1B, putative [Ricinus communis] gi|223533801|gb|EEF35533.1| DNA-binding protein MNB1B, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449461783|ref|XP_004148621.1| PREDICTED: high mobility group B protein 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|312281849|dbj|BAJ33790.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|359486418|ref|XP_003633441.1| PREDICTED: high mobility group B protein 1 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 130 | ||||||
| TAIR|locus:505006135 | 144 | HMGB2 "high mobility group B2" | 0.761 | 0.687 | 0.474 | 1e-20 | |
| TAIR|locus:2053893 | 138 | HMGB4 "high mobility group B4" | 0.769 | 0.724 | 0.44 | 9.5e-18 | |
| TAIR|locus:2128003 | 125 | HMGB5 "high mobility group B5" | 0.692 | 0.72 | 0.404 | 1.4e-14 | |
| TAIR|locus:2154433 | 241 | HMGB6 "high-mobility group box | 0.753 | 0.406 | 0.396 | 5.6e-13 | |
| UNIPROTKB|F1N927 | 214 | HMGB1 "High mobility group pro | 0.907 | 0.551 | 0.351 | 4.5e-11 | |
| UNIPROTKB|Q9YH06 | 215 | HMG1 "High mobility group 1 pr | 0.907 | 0.548 | 0.351 | 4.5e-11 | |
| UNIPROTKB|P40618 | 202 | HMGB3 "High mobility group pro | 0.592 | 0.381 | 0.410 | 1.2e-10 | |
| ZFIN|ZDB-GENE-030131-341 | 205 | hmgb1a "high-mobility group bo | 0.884 | 0.560 | 0.338 | 1.5e-10 | |
| RGD|1589841 | 214 | LOC690940 "similar to High mob | 0.9 | 0.546 | 0.325 | 2e-10 | |
| RGD|1593466 | 214 | LOC689398 "similar to High mob | 0.9 | 0.546 | 0.325 | 2e-10 |
| TAIR|locus:505006135 HMGB2 "high mobility group B2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 244 (91.0 bits), Expect = 1.0e-20, P = 1.0e-20
Identities = 47/99 (47%), Positives = 64/99 (64%)
Query: 29 RKAVLKASRSSNKRTKNVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVG 88
R + L ++ K K+A KDPNKPKRP SAFFVF+E+FR+ +K+E+P K+V+ VG
Sbjct: 11 RSSKLSVTKKPAKGAGRGKAAAKDPNKPKRPASAFFVFMEDFRETFKKENPKNKSVATVG 70
Query: 89 KAGGEKWKSLTDXXXXXXXXXXXXXXLDYEKLMTAYNKK 127
KA G+KWKSL+D ++YEK + AYNKK
Sbjct: 71 KAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAYNKK 109
|
|
| TAIR|locus:2053893 HMGB4 "high mobility group B4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2128003 HMGB5 "high mobility group B5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2154433 HMGB6 "high-mobility group box 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N927 HMGB1 "High mobility group protein B1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9YH06 HMG1 "High mobility group 1 protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P40618 HMGB3 "High mobility group protein B3" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-341 hmgb1a "high-mobility group box 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1589841 LOC690940 "similar to High mobility group protein 1 (HMG-1) (High mobility group protein B1) (Amphoterin) (Heparin-binding protein p30)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1593466 LOC689398 "similar to High mobility group protein 1 (HMG-1) (High mobility group protein B1) (Amphoterin) (Heparin-binding protein p30)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 130 | |||
| pfam00505 | 69 | pfam00505, HMG_box, HMG (high mobility group) box | 3e-16 | |
| cd00084 | 66 | cd00084, HMG-box, High Mobility Group (HMG)-box is | 6e-15 | |
| cd01390 | 66 | cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class | 2e-14 | |
| smart00398 | 70 | smart00398, HMG, high mobility group | 2e-12 | |
| COG5648 | 211 | COG5648, NHP6B, Chromatin-associated proteins cont | 7e-11 | |
| PTZ00199 | 94 | PTZ00199, PTZ00199, high mobility group protein; P | 6e-09 | |
| pfam09011 | 69 | pfam09011, DUF1898, Domain of unknown function (DU | 8e-08 | |
| cd01388 | 72 | cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I | 2e-07 | |
| cd01389 | 77 | cd01389, MATA_HMG-box, MATA_HMG-box, class I membe | 3e-04 |
| >gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box | Back alignment and domain information |
|---|
Score = 67.3 bits (165), Expect = 3e-16
Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
Query: 56 PKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEKAPFEAKAAKRKL 115
PKRP SAFF+F +E R K E+P +K + + K GEKWK+L++ EK P+E KA K K
Sbjct: 1 PKRPLSAFFLFSQEQRAKLKAENPGLK-NAEISKILGEKWKNLSEEEKKPYEEKAEKEKA 59
Query: 116 DYEKLMTAYN 125
YEK AY
Sbjct: 60 RYEKAYPAYK 69
|
Length = 69 |
| >gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors | Back alignment and domain information |
|---|
| >gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|197700 smart00398, HMG, high mobility group | Back alignment and domain information |
|---|
| >gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|185511 PTZ00199, PTZ00199, high mobility group protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|204115 pfam09011, DUF1898, Domain of unknown function (DUF1898) | Back alignment and domain information |
|---|
| >gnl|CDD|238684 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238685 cd01389, MATA_HMG-box, MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| PTZ00199 | 94 | high mobility group protein; Provisional | 99.93 | |
| cd01389 | 77 | MATA_HMG-box MATA_HMG-box, class I member of the H | 99.86 | |
| cd01388 | 72 | SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of | 99.85 | |
| PF00505 | 69 | HMG_box: HMG (high mobility group) box; InterPro: | 99.84 | |
| PF09011 | 73 | HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi | 99.83 | |
| smart00398 | 70 | HMG high mobility group. | 99.83 | |
| cd01390 | 66 | HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II | 99.83 | |
| COG5648 | 211 | NHP6B Chromatin-associated proteins containing the | 99.81 | |
| KOG0381 | 96 | consensus HMG box-containing protein [General func | 99.78 | |
| cd00084 | 66 | HMG-box High Mobility Group (HMG)-box is found in | 99.76 | |
| KOG0527 | 331 | consensus HMG-box transcription factor [Transcript | 99.71 | |
| KOG0526 | 615 | consensus Nucleosome-binding factor SPN, POB3 subu | 99.68 | |
| KOG4715 | 410 | consensus SWI/SNF-related matrix-associated actin- | 99.24 | |
| KOG3248 | 421 | consensus Transcription factor TCF-4 [Transcriptio | 99.13 | |
| KOG0528 | 511 | consensus HMG-box transcription factor SOX5 [Trans | 99.07 | |
| KOG2746 | 683 | consensus HMG-box transcription factor Capicua and | 98.46 | |
| PF14887 | 85 | HMG_box_5: HMG (high mobility group) box 5; PDB: 1 | 98.28 | |
| COG5648 | 211 | NHP6B Chromatin-associated proteins containing the | 97.29 | |
| PF06382 | 183 | DUF1074: Protein of unknown function (DUF1074); In | 97.13 | |
| PF04690 | 170 | YABBY: YABBY protein; InterPro: IPR006780 YABBY pr | 96.65 | |
| PF08073 | 55 | CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 | 96.18 | |
| PF06244 | 122 | DUF1014: Protein of unknown function (DUF1014); In | 94.55 | |
| PF04769 | 201 | MAT_Alpha1: Mating-type protein MAT alpha 1; Inter | 91.64 | |
| TIGR03481 | 198 | HpnM hopanoid biosynthesis associated membrane pro | 90.83 | |
| KOG3223 | 221 | consensus Uncharacterized conserved protein [Funct | 89.89 | |
| PRK15117 | 211 | ABC transporter periplasmic binding protein MlaC; | 89.25 |
| >PTZ00199 high mobility group protein; Provisional | Back alignment and domain information |
|---|
Probab=99.93 E-value=8.4e-26 Score=153.89 Aligned_cols=84 Identities=44% Similarity=0.689 Sum_probs=78.4
Q ss_pred cccccccCCCCCCCCCCCCChHHHHHHHHHHHHHHhCCCCc-cHHHHHHHHHHhhcCCChhhhHHHHHHHHHHHHHHHHH
Q 032935 42 RTKNVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVK-AVSAVGKAGGEKWKSLTDAEKAPFEAKAAKRKLDYEKL 120 (130)
Q Consensus 42 ~~~k~~k~~kdp~~PKRP~say~lF~~e~r~~~k~~~P~~~-~~~ei~k~i~~~Wk~ls~~eK~~Y~~~a~~~k~~y~~e 120 (130)
.+++++++.+||+.|+||+|||||||+++|..|..+||+++ +|.+|+++||++|++||+++|.+|+++|..++.+|..+
T Consensus 9 ~~k~~~k~~kdp~~PKrP~sAY~~F~~~~R~~i~~~~P~~~~~~~evsk~ige~Wk~ls~eeK~~y~~~A~~dk~rY~~e 88 (94)
T PTZ00199 9 LVRKNKRKKKDPNAPKRALSAYMFFAKEKRAEIIAENPELAKDVAAVGKMVGEAWNKLSEEEKAPYEKKAQEDKVRYEKE 88 (94)
T ss_pred cccccCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHCcCCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHHHH
Confidence 34556677899999999999999999999999999999985 48999999999999999999999999999999999999
Q ss_pred HHHHh
Q 032935 121 MTAYN 125 (130)
Q Consensus 121 ~~~Y~ 125 (130)
|.+|+
T Consensus 89 ~~~Y~ 93 (94)
T PTZ00199 89 KAEYA 93 (94)
T ss_pred HHHHh
Confidence 99996
|
|
| >cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin | Back alignment and domain information |
|---|
| >PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins | Back alignment and domain information |
|---|
| >smart00398 HMG high mobility group | Back alignment and domain information |
|---|
| >cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0381 consensus HMG box-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors | Back alignment and domain information |
|---|
| >KOG0527 consensus HMG-box transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG0526 consensus Nucleosome-binding factor SPN, POB3 subunit [Transcription; Replication, recombination and repair; Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG3248 consensus Transcription factor TCF-4 [Transcription] | Back alignment and domain information |
|---|
| >KOG0528 consensus HMG-box transcription factor SOX5 [Transcription] | Back alignment and domain information |
|---|
| >KOG2746 consensus HMG-box transcription factor Capicua and related proteins [Transcription] | Back alignment and domain information |
|---|
| >PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A | Back alignment and domain information |
|---|
| >COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta | Back alignment and domain information |
|---|
| >PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] | Back alignment and domain information |
|---|
| >PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] | Back alignment and domain information |
|---|
| >PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM | Back alignment and domain information |
|---|
| >KOG3223 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15117 ABC transporter periplasmic binding protein MlaC; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 130 | ||||
| 1j3c_A | 79 | Solution Structure Of The C-Terminal Domain Of The | 4e-09 | ||
| 2yrq_A | 173 | Solution Structure Of The Tandem Hmg Box Domain Fro | 5e-09 | ||
| 2gzk_A | 159 | Structure Of A Complex Of Tandem Hmg Boxes And Dna | 8e-09 | ||
| 1hme_A | 77 | Structure Of The Hmg Box Motif In The B-Domain Of H | 8e-09 | ||
| 1j3d_A | 78 | Solution Structure Of The C-Terminal Domain Of The | 1e-08 | ||
| 1nhm_A | 81 | The Structure Of The Hmg Box And Its Interaction Wi | 4e-07 | ||
| 2yqi_A | 81 | Solution Structure Of The Second Hmg-Box Domain Fro | 8e-07 | ||
| 1hsm_A | 79 | The Structure Of The Hmg Box And Its Interaction Wi | 2e-06 | ||
| 2lhj_A | 97 | Nmr Structure Of The High Mobility Group Protein-Li | 2e-06 | ||
| 1j5n_A | 93 | Solution Structure Of The Non-Sequence-Specific Hmg | 4e-06 | ||
| 1cg7_A | 93 | Hmg Protein Nhp6a From Saccharomyces Cerevisiae Len | 4e-06 | ||
| 1e7j_A | 74 | Hmg-D Complexed To A Bulge Dna Length = 74 | 5e-06 | ||
| 1qrv_A | 73 | Crystal Structure Of The Complex Of Hmg-D And Dna L | 5e-06 | ||
| 1hma_A | 73 | The Solution Structure And Dynamics Of The Dna Bind | 5e-06 | ||
| 3nm9_A | 73 | Hmgd(M13a)-Dna Complex Length = 73 | 1e-05 | ||
| 1wxl_A | 73 | Solution Structure Of The Hmg-Box Domain In The Ssr | 2e-05 |
| >pdb|1J3C|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 79 | Back alignment and structure |
|
| >pdb|2YRQ|A Chain A, Solution Structure Of The Tandem Hmg Box Domain From Human High Mobility Group Protein B1 Length = 173 | Back alignment and structure |
| >pdb|2GZK|A Chain A, Structure Of A Complex Of Tandem Hmg Boxes And Dna Length = 159 | Back alignment and structure |
| >pdb|1HME|A Chain A, Structure Of The Hmg Box Motif In The B-Domain Of Hmg1 Length = 77 | Back alignment and structure |
| >pdb|1J3D|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 78 | Back alignment and structure |
| >pdb|1NHM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 81 | Back alignment and structure |
| >pdb|2YQI|A Chain A, Solution Structure Of The Second Hmg-Box Domain From High Mobility Group Protein B3 Length = 81 | Back alignment and structure |
| >pdb|1HSM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 79 | Back alignment and structure |
| >pdb|2LHJ|A Chain A, Nmr Structure Of The High Mobility Group Protein-Like Protein Nhp1 From Babesia Bovis T2bo (Baboa.00841.A) Length = 97 | Back alignment and structure |
| >pdb|1J5N|A Chain A, Solution Structure Of The Non-Sequence-Specific Hmgb Protein Nhp6a In Complex With Sry Dna Length = 93 | Back alignment and structure |
| >pdb|1CG7|A Chain A, Hmg Protein Nhp6a From Saccharomyces Cerevisiae Length = 93 | Back alignment and structure |
| >pdb|1E7J|A Chain A, Hmg-D Complexed To A Bulge Dna Length = 74 | Back alignment and structure |
| >pdb|1QRV|A Chain A, Crystal Structure Of The Complex Of Hmg-D And Dna Length = 73 | Back alignment and structure |
| >pdb|1HMA|A Chain A, The Solution Structure And Dynamics Of The Dna Binding Domain Of Hmg-D From Drosophila Melanogaster Length = 73 | Back alignment and structure |
| >pdb|3NM9|A Chain A, Hmgd(M13a)-Dna Complex Length = 73 | Back alignment and structure |
| >pdb|1WXL|A Chain A, Solution Structure Of The Hmg-Box Domain In The Ssrp1 Subunit Of Fact Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 130 | |||
| 1hme_A | 77 | High mobility group protein fragment-B; DNA-bindin | 1e-23 | |
| 1aab_A | 83 | High mobility group protein; HMG-BOX, DNA-binding; | 5e-22 | |
| 2crj_A | 92 | SWI/SNF-related matrix-associated actin- dependent | 7e-22 | |
| 2lhj_A | 97 | High mobility group protein homolog NHP1; structur | 2e-21 | |
| 1cg7_A | 93 | Protein (NON histone protein 6 A); HMG BOX, DNA be | 3e-20 | |
| 2co9_A | 102 | Thymus high mobility group box protein TOX; TOX pr | 4e-20 | |
| 2eqz_A | 86 | High mobility group protein B3; HMG-box domain, mo | 9e-20 | |
| 1k99_A | 99 | Upstream binding factor 1; alpha-helix, L-shape, D | 1e-19 | |
| 3nm9_A | 73 | HMG-D, high mobility group protein D; DNA bending, | 2e-18 | |
| 1wgf_A | 90 | Upstream binding factor 1; transcription factor, D | 2e-18 | |
| 1wxl_A | 73 | Single-strand recognition protein; FACT, SSRP1, HM | 3e-18 | |
| 2yrq_A | 173 | High mobility group protein B1; HMG box domain, DN | 1e-17 | |
| 2yrq_A | 173 | High mobility group protein B1; HMG box domain, DN | 6e-11 | |
| 1ckt_A | 71 | High mobility group 1 protein; high-mobility group | 3e-17 | |
| 2gzk_A | 159 | Sex-determining region on Y / HMGB1; protein-DNA c | 2e-16 | |
| 2gzk_A | 159 | Sex-determining region on Y / HMGB1; protein-DNA c | 2e-14 | |
| 2cs1_A | 92 | PMS1 protein homolog 1; DNA mismatch repair protei | 2e-15 | |
| 3fgh_A | 67 | Transcription factor A, mitochondrial; HMG domain, | 6e-15 | |
| 3tq6_A | 214 | Transcription factor A, mitochondrial; transcripti | 4e-13 | |
| 3tq6_A | 214 | Transcription factor A, mitochondrial; transcripti | 4e-09 | |
| 2e6o_A | 87 | HMG box-containing protein 1; HMG-box domain, HMG- | 4e-12 | |
| 3tmm_A | 238 | Transcription factor A, mitochondrial; HMG, high m | 2e-11 | |
| 3tmm_A | 238 | Transcription factor A, mitochondrial; HMG, high m | 1e-08 | |
| 1wz6_A | 82 | HMG-box transcription factor BBX; bobby SOX homolo | 2e-11 | |
| 4a3n_A | 71 | Transcription factor SOX-17; 2.40A {Homo sapiens} | 8e-10 | |
| 4euw_A | 106 | Transcription factor SOX-9; protein-DNA complex, H | 2e-09 | |
| 1hry_A | 76 | Human SRY; DNA, DNA-binding protein, DNA binding p | 1e-08 | |
| 3f27_D | 83 | Transcription factor SOX-17; protein-DNA complex, | 4e-08 | |
| 1gt0_D | 80 | Transcription factor SOX-2; POU factors, SOX prote | 7e-08 | |
| 3u2b_C | 79 | Transcription factor SOX-4; HMG domain, transcript | 8e-08 | |
| 1i11_A | 81 | Transcription factor SOX-5; HMG BOX, DNA bending, | 2e-07 | |
| 2d7l_A | 81 | WD repeat and HMG-box DNA binding protein 1; high | 3e-07 | |
| 1j46_A | 85 | SRY, sex-determining region Y protein; MALE sex de | 4e-07 | |
| 2lef_A | 86 | LEF-1 HMG, protein (lymphoid enhancer-binding fact | 7e-07 | |
| 1v63_A | 101 | Nucleolar transcription factor 1; DNA binding, str | 5e-06 | |
| 1v64_A | 108 | Nucleolar transcription factor 1; DNA binding, str | 6e-06 |
| >1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 | Back alignment and structure |
|---|
Score = 86.1 bits (214), Expect = 1e-23
Identities = 39/77 (50%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
Query: 51 KDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEKAPFEAKA 110
KDPN PKRPPSAFF+F E+R K EHP + + V K GE W + +K P+E KA
Sbjct: 2 KDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLS-IGDVAKKLGEMWNNTAADDKQPYEKKA 60
Query: 111 AKRKLDYEKLMTAYNKK 127
AK K YEK + AY K
Sbjct: 61 AKLKEKYEKDIAAYRAK 77
|
| >1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 | Back alignment and structure |
|---|
| >2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 | Back alignment and structure |
|---|
| >2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 | Back alignment and structure |
|---|
| >1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 | Back alignment and structure |
|---|
| >2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 | Back alignment and structure |
|---|
| >2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 | Back alignment and structure |
|---|
| >3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 | Back alignment and structure |
|---|
| >1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 | Back alignment and structure |
|---|
| >1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 | Back alignment and structure |
|---|
| >2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 | Back alignment and structure |
|---|
| >2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 | Back alignment and structure |
|---|
| >1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 | Back alignment and structure |
|---|
| >2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 | Back alignment and structure |
|---|
| >2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 | Back alignment and structure |
|---|
| >2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 | Back alignment and structure |
|---|
| >4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 | Back alignment and structure |
|---|
| >3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 | Back alignment and structure |
|---|
| >1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 | Back alignment and structure |
|---|
| >3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 | Back alignment and structure |
|---|
| >1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 | Back alignment and structure |
|---|
| >2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 | Back alignment and structure |
|---|
| >2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 | Back alignment and structure |
|---|
| >1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Length = 101 | Back alignment and structure |
|---|
| >1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 108 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| 2eqz_A | 86 | High mobility group protein B3; HMG-box domain, mo | 99.94 | |
| 2co9_A | 102 | Thymus high mobility group box protein TOX; TOX pr | 99.94 | |
| 1k99_A | 99 | Upstream binding factor 1; alpha-helix, L-shape, D | 99.93 | |
| 1hme_A | 77 | High mobility group protein fragment-B; DNA-bindin | 99.92 | |
| 2lhj_A | 97 | High mobility group protein homolog NHP1; structur | 99.92 | |
| 1cg7_A | 93 | Protein (NON histone protein 6 A); HMG BOX, DNA be | 99.92 | |
| 2crj_A | 92 | SWI/SNF-related matrix-associated actin- dependent | 99.92 | |
| 1aab_A | 83 | High mobility group protein; HMG-BOX, DNA-binding; | 99.91 | |
| 1wgf_A | 90 | Upstream binding factor 1; transcription factor, D | 99.91 | |
| 2cs1_A | 92 | PMS1 protein homolog 1; DNA mismatch repair protei | 99.91 | |
| 2e6o_A | 87 | HMG box-containing protein 1; HMG-box domain, HMG- | 99.91 | |
| 1hry_A | 76 | Human SRY; DNA, DNA-binding protein, DNA binding p | 99.91 | |
| 3nm9_A | 73 | HMG-D, high mobility group protein D; DNA bending, | 99.9 | |
| 1ckt_A | 71 | High mobility group 1 protein; high-mobility group | 99.9 | |
| 1wxl_A | 73 | Single-strand recognition protein; FACT, SSRP1, HM | 99.9 | |
| 1j46_A | 85 | SRY, sex-determining region Y protein; MALE sex de | 99.89 | |
| 2gzk_A | 159 | Sex-determining region on Y / HMGB1; protein-DNA c | 99.89 | |
| 1wz6_A | 82 | HMG-box transcription factor BBX; bobby SOX homolo | 99.89 | |
| 4a3n_A | 71 | Transcription factor SOX-17; 2.40A {Homo sapiens} | 99.89 | |
| 3f27_D | 83 | Transcription factor SOX-17; protein-DNA complex, | 99.88 | |
| 1gt0_D | 80 | Transcription factor SOX-2; POU factors, SOX prote | 99.88 | |
| 4euw_A | 106 | Transcription factor SOX-9; protein-DNA complex, H | 99.88 | |
| 2lef_A | 86 | LEF-1 HMG, protein (lymphoid enhancer-binding fact | 99.88 | |
| 1v64_A | 108 | Nucleolar transcription factor 1; DNA binding, str | 99.88 | |
| 3u2b_C | 79 | Transcription factor SOX-4; HMG domain, transcript | 99.88 | |
| 2yrq_A | 173 | High mobility group protein B1; HMG box domain, DN | 99.88 | |
| 1l8y_A | 91 | Upstream binding factor 1; HUBF, HMG box 5, DNA bi | 99.88 | |
| 1i11_A | 81 | Transcription factor SOX-5; HMG BOX, DNA bending, | 99.87 | |
| 2yrq_A | 173 | High mobility group protein B1; HMG box domain, DN | 99.87 | |
| 3fgh_A | 67 | Transcription factor A, mitochondrial; HMG domain, | 99.86 | |
| 1v63_A | 101 | Nucleolar transcription factor 1; DNA binding, str | 99.85 | |
| 2d7l_A | 81 | WD repeat and HMG-box DNA binding protein 1; high | 99.84 | |
| 3tmm_A | 238 | Transcription factor A, mitochondrial; HMG, high m | 99.82 | |
| 3tq6_A | 214 | Transcription factor A, mitochondrial; transcripti | 99.81 | |
| 2cto_A | 93 | Novel protein; high mobility group box domain, hel | 99.81 | |
| 2yuk_A | 90 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.8 | |
| 3tq6_A | 214 | Transcription factor A, mitochondrial; transcripti | 99.78 | |
| 3tmm_A | 238 | Transcription factor A, mitochondrial; HMG, high m | 99.77 | |
| 2gzk_A | 159 | Sex-determining region on Y / HMGB1; protein-DNA c | 99.74 |
| >2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.94 E-value=4.2e-26 Score=151.36 Aligned_cols=81 Identities=32% Similarity=0.570 Sum_probs=76.2
Q ss_pred ccccCCCCCCCCCCCCChHHHHHHHHHHHHHHhCCCCc-cHHHHHHHHHHhhcCCChhhhHHHHHHHHHHHHHHHHHHHH
Q 032935 45 NVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVK-AVSAVGKAGGEKWKSLTDAEKAPFEAKAAKRKLDYEKLMTA 123 (130)
Q Consensus 45 k~~k~~kdp~~PKRP~say~lF~~e~r~~~k~~~P~~~-~~~ei~k~i~~~Wk~ls~~eK~~Y~~~a~~~k~~y~~e~~~ 123 (130)
++++..+||++|+||+||||||++++|..|+.+||+++ +|.+|+++||++|++||+++|.+|+++|..++++|..+|.+
T Consensus 5 ~~~~~~kdp~~PKrP~say~lF~~~~r~~~k~~~p~~~~~~~eisk~lg~~Wk~ls~~eK~~y~~~A~~~k~~y~~e~~~ 84 (86)
T 2eqz_A 5 SSGMAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKD 84 (86)
T ss_dssp CSSCSSCCSSSCCCCCCHHHHHHHHHHHHHHHHCTTSCCCHHHHHHHHHHHHHSSCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHCCCCCCcHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 34567899999999999999999999999999999996 47999999999999999999999999999999999999999
Q ss_pred Hh
Q 032935 124 YN 125 (130)
Q Consensus 124 Y~ 125 (130)
|+
T Consensus 85 Y~ 86 (86)
T 2eqz_A 85 YG 86 (86)
T ss_dssp HC
T ss_pred cC
Confidence 94
|
| >2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A | Back alignment and structure |
|---|
| >2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} | Back alignment and structure |
|---|
| >1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A | Back alignment and structure |
|---|
| >2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* | Back alignment and structure |
|---|
| >3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* | Back alignment and structure |
|---|
| >1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A | Back alignment and structure |
|---|
| >1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A | Back alignment and structure |
|---|
| >2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 | Back alignment and structure |
|---|
| >1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 | Back alignment and structure |
|---|
| >3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A | Back alignment and structure |
|---|
| >1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B | Back alignment and structure |
|---|
| >4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} | Back alignment and structure |
|---|
| >2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A | Back alignment and structure |
|---|
| >1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 130 | ||||
| d1hsma_ | 79 | a.21.1.1 (A:) High mobility group protein 1, HMG1 | 4e-14 | |
| d1lwma_ | 93 | a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces | 1e-13 | |
| d1wgfa_ | 90 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 6e-13 | |
| d1qrva_ | 73 | a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI | 6e-13 | |
| d1k99a_ | 91 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 1e-12 | |
| d1ckta_ | 71 | a.21.1.1 (A:) High mobility group protein 1, HMG1 | 2e-12 | |
| d1i11a_ | 70 | a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: | 4e-12 | |
| d1gt0d_ | 80 | a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: | 5e-12 | |
| d1j46a_ | 85 | a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 | 4e-11 | |
| d1v63a_ | 101 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 3e-10 | |
| d2lefa_ | 86 | a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE | 6e-09 | |
| d1v64a_ | 108 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 3e-07 |
| >d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HMG-box superfamily: HMG-box family: HMG-box domain: High mobility group protein 1, HMG1 species: Hamster (Cricetulus griseus) [TaxId: 10029]
Score = 61.0 bits (148), Expect = 4e-14
Identities = 36/74 (48%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
Query: 54 NKPKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEKAPFEAKAAKR 113
N PKRPPSAFF+F E+R K EHP + + V K GE W + +K P+E KAAK
Sbjct: 1 NAPKRPPSAFFLFCSEYRPKIKGEHPGLS-IGDVAKKLGEMWNNTAADDKQPYEKKAAKL 59
Query: 114 KLDYEKLMTAYNKK 127
K YEK + AY K
Sbjct: 60 KEKYEKDIAAYRAK 73
|
| >d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 | Back information, alignment and structure |
|---|
| >d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 | Back information, alignment and structure |
|---|
| >d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
| >d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 130 | |||
| d1lwma_ | 93 | NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T | 99.92 | |
| d1k99a_ | 91 | Nucleolar transcription factor 1 (Upstream binding | 99.91 | |
| d1hsma_ | 79 | High mobility group protein 1, HMG1 {Hamster (Cric | 99.9 | |
| d1gt0d_ | 80 | Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.88 | |
| d1j46a_ | 85 | SRY {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1ckta_ | 71 | High mobility group protein 1, HMG1 {Rat (Rattus n | 99.88 | |
| d1qrva_ | 73 | HMG-D {Drosophila melanogaster [TaxId: 7227]} | 99.88 | |
| d1i11a_ | 70 | Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} | 99.87 | |
| d2lefa_ | 86 | Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus | 99.85 | |
| d1wgfa_ | 90 | Nucleolar transcription factor 1 (Upstream binding | 99.85 | |
| d1v64a_ | 108 | Nucleolar transcription factor 1 (Upstream binding | 99.83 | |
| d1v63a_ | 101 | Nucleolar transcription factor 1 (Upstream binding | 99.82 | |
| d1l8ya_ | 84 | Nucleolar transcription factor 1 (Upstream binding | 96.63 |
| >d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HMG-box superfamily: HMG-box family: HMG-box domain: NHP6a species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.92 E-value=4.9e-25 Score=146.92 Aligned_cols=85 Identities=45% Similarity=0.701 Sum_probs=79.5
Q ss_pred ccccccCCCCCCCCCCCCChHHHHHHHHHHHHHHhCCCCccHHHHHHHHHHhhcCCChhhhHHHHHHHHHHHHHHHHHHH
Q 032935 43 TKNVKSAKKDPNKPKRPPSAFFVFLEEFRKVYKQEHPNVKAVSAVGKAGGEKWKSLTDAEKAPFEAKAAKRKLDYEKLMT 122 (130)
Q Consensus 43 ~~k~~k~~kdp~~PKRP~say~lF~~e~r~~~k~~~P~~~~~~ei~k~i~~~Wk~ls~~eK~~Y~~~a~~~k~~y~~e~~ 122 (130)
+++..+..+||+.|+||+|||+||+.++|..|+.+||++ ++.+|++.||++|++||+++|.+|.+.|..++.+|..+|.
T Consensus 8 ~k~~~k~~k~p~~PKrP~saf~lF~~e~r~~ik~~~p~~-~~~ei~k~l~~~W~~ls~~eK~~y~~~a~~~k~~y~~e~~ 86 (93)
T d1lwma_ 8 KKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDI-TFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKE 86 (93)
T ss_dssp TSCCCSCCCCSSCCCCCCCHHHHHHHHHHHHHHHHCTTS-CHHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CCccccCCCCcCCCCCCCCHHHHHHHHHHHHHHHhCCCC-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHHH
Confidence 345556778999999999999999999999999999999 6899999999999999999999999999999999999999
Q ss_pred HHhhhc
Q 032935 123 AYNKKQ 128 (130)
Q Consensus 123 ~Y~~k~ 128 (130)
.|+.+.
T Consensus 87 ~y~~~l 92 (93)
T d1lwma_ 87 LYNATL 92 (93)
T ss_dssp HHHHHH
T ss_pred HHHhcc
Confidence 999864
|
| >d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8ya_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|