Citrus Sinensis ID: 032981


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MRAFGAFQRSSLLLRRRRANNEPYALVPSGSFCTDNGFETTSNGSSRVSIFDRHLKRKQRDRAAWLTRPNDSFVDAVAENLLDRLEDCRKTFPTALCLGGSLEAVRRLLRGRVVLQKENFEFWRCLLKL
cccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHcccccHHHHHHHHHHHHHcc
ccccHHHHHcHHHHHccccccccEEEEcccEEcccccccccccccccEEEEcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccEEEccccHHHHHHHHHccccccHHHHHHHHHHHcc
mrafgafqRSSLLLRRRrannepyalvpsgsfctdngfettsngssrvSIFDRHLKRKQRDRaawltrpndsfVDAVAENLLDRLEDCRKtfptalclggSLEAVRRLLRGRVVLQKENFEFWRCLLKL
mrafgafqrsslllrRRRANnepyalvpsgsfctdngfettsngssrvsifdrhLKRKQRdraawltrpndsfvDAVAENLLDRLEDCRKTFptalclggslEAVRRLLRGrvvlqkenfefwrcllkl
MRAFGAFQrsslllrrrrANNEPYALVPSGSFCTDNGFETTSNGSSRVSIFDRHLKRKQRDRAAWLTRPNDSFVDAVAENLLDRLEDCRKTFPTALCLGGSLEAvrrllrgrvvlQKENFEFWRCLLKL
************************ALV**GSFCT***************IF**********RAAWLTRPNDSFVDAVAENLLDRLEDCRKTFPTALCLGGSLEAVRRLLRGRVVLQKENFEFWRCLL**
*********S**LLRRRRANNEPYALV**********************IFDRHLKRKQRDRAAWLTRPNDSFVDAVAENLLDRLEDCRKTFPTALCLGGSLEAVRRLLRG**VLQKENFEFWRCLLKL
MRAFGAFQRSSLLLRRRRANNEPYALVPSGSFCTDNGFETTSNGSSRVSIFDRHLKRKQRDRAAWLTRPNDSFVDAVAENLLDRLEDCRKTFPTALCLGGSLEAVRRLLRGRVVLQKENFEFWRCLLKL
**********SLLLRRRRANNEPYALVPSGSFCTDNGF*****GSSRVSIFDRHLKRKQRDRAAWLTRPNDSFVDAVAENLLDRLEDCRKTFPTALCLGGSLEAVRRLLRGRVVLQKENFEFWRCLLKL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRAFGAFQRSSLLLRRRRANNEPYALVPSGSFCTDNGFETTSNGSSRVSIFDRHLKRKQRDRAAWLTRPNDSFVDAVAENLLDRLEDCRKTFPTALCLGGSLEAVRRLLRGRVVLQKENFEFWRCLLKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
O80543 355 Putative methyltransferas yes no 0.813 0.295 0.567 2e-26
>sp|O80543|Y1280_ARATH Putative methyltransferase At1g22800 OS=Arabidopsis thaliana GN=At1g22800 PE=2 SV=2 Back     alignment and function desciption
 Score =  117 bits (293), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/111 (56%), Positives = 79/111 (71%), Gaps = 6/111 (5%)

Query: 13  LLRR--RRANNEPYALVPSGSFCTDNGFETTS---NGSSRVSIFDRHLKRKQRDRAAWLT 67
           LL+R   ++  + +  + S SF T+  +         SS+V IFDR LKR  RDRAAWL+
Sbjct: 13  LLKRVPEKSTKQAHTFLASLSFSTEGAYGGDGEFQQNSSKVKIFDRDLKRIHRDRAAWLS 72

Query: 68  R-PNDSFVDAVAENLLDRLEDCRKTFPTALCLGGSLEAVRRLLRGRVVLQK 117
           R  NDSFVDAVA+NLLDRLEDC+K+FPTA CLGGSL AV+RLLRGR  ++K
Sbjct: 73  RQKNDSFVDAVADNLLDRLEDCKKSFPTAFCLGGSLGAVKRLLRGRGGIEK 123





Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
224135749121 predicted protein [Populus trichocarpa] 0.798 0.851 0.714 9e-31
225460187 339 PREDICTED: uncharacterized protein At1g2 0.759 0.289 0.683 1e-29
297741046 348 unnamed protein product [Vitis vinifera] 0.759 0.281 0.683 1e-29
449447597177 PREDICTED: putative methyltransferase At 0.837 0.610 0.646 1e-28
255574259 336 conserved hypothetical protein [Ricinus 0.720 0.276 0.653 2e-28
297845308 355 hypothetical protein ARALYDRAFT_889792 [ 0.806 0.292 0.598 4e-25
15219953 355 S-adenosyl-L-methionine-dependent methyl 0.813 0.295 0.567 2e-24
223975545 343 unknown [Zea mays] gi|413916686|gb|AFW56 0.713 0.268 0.608 5e-24
413916684154 hypothetical protein ZEAMMB73_760336 [Ze 0.713 0.597 0.608 5e-24
413916685181 hypothetical protein ZEAMMB73_760336 [Ze 0.713 0.508 0.608 6e-24
>gi|224135749|ref|XP_002327294.1| predicted protein [Populus trichocarpa] gi|222835664|gb|EEE74099.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  138 bits (347), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 75/105 (71%), Positives = 81/105 (77%), Gaps = 2/105 (1%)

Query: 10  SSLLLR-RRRANNEPYALVPSGSFCTDNGFETTSNGSS-RVSIFDRHLKRKQRDRAAWLT 67
           S LLLR RRRA  E   L+PS S+CT+    T     S RV IFDR LKRKQRDRAAWL 
Sbjct: 12  SQLLLRGRRRATKETDTLIPSISYCTNIDNNTIDGPQSPRVKIFDRELKRKQRDRAAWLM 71

Query: 68  RPNDSFVDAVAENLLDRLEDCRKTFPTALCLGGSLEAVRRLLRGR 112
           RP+D FVDAVA+NLLDRLEDC+KTFPTALCLGGS EAVRRLL GR
Sbjct: 72  RPSDPFVDAVADNLLDRLEDCKKTFPTALCLGGSSEAVRRLLHGR 116




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225460187|ref|XP_002279511.1| PREDICTED: uncharacterized protein At1g22800 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297741046|emb|CBI31358.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449447597|ref|XP_004141554.1| PREDICTED: putative methyltransferase At1g22800-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255574259|ref|XP_002528044.1| conserved hypothetical protein [Ricinus communis] gi|223532574|gb|EEF34362.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|297845308|ref|XP_002890535.1| hypothetical protein ARALYDRAFT_889792 [Arabidopsis lyrata subsp. lyrata] gi|297336377|gb|EFH66794.1| hypothetical protein ARALYDRAFT_889792 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15219953|ref|NP_173694.1| S-adenosyl-L-methionine-dependent methyltransferases-like protein [Arabidopsis thaliana] gi|84028281|sp|O80543.2|Y1280_ARATH RecName: Full=Putative methyltransferase At1g22800 gi|30102638|gb|AAP21237.1| At1g22800 [Arabidopsis thaliana] gi|110736002|dbj|BAE99975.1| hypothetical protein [Arabidopsis thaliana] gi|332192169|gb|AEE30290.1| S-adenosyl-L-methionine-dependent methyltransferases-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|223975545|gb|ACN31960.1| unknown [Zea mays] gi|413916686|gb|AFW56618.1| hypothetical protein ZEAMMB73_760336 [Zea mays] Back     alignment and taxonomy information
>gi|413916684|gb|AFW56616.1| hypothetical protein ZEAMMB73_760336 [Zea mays] Back     alignment and taxonomy information
>gi|413916685|gb|AFW56617.1| hypothetical protein ZEAMMB73_760336 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
TAIR|locus:2199650 355 AT1G22800 [Arabidopsis thalian 0.658 0.239 0.593 4.9e-21
UNIPROTKB|F1NUD7 305 F1NUD7 "Uncharacterized protei 0.395 0.167 0.471 0.00016
UNIPROTKB|E1C306 346 E1C306 "Uncharacterized protei 0.395 0.147 0.471 0.00019
UNIPROTKB|B3KR61 267 NDUFAF5 "HCG1811060, isoform C 0.496 0.239 0.388 0.0002
UNIPROTKB|Q5RBS1 345 NDUFAF5 "NADH dehydrogenase [u 0.496 0.185 0.388 0.00025
UNIPROTKB|Q5TEU4 345 NDUFAF5 "NADH dehydrogenase [u 0.496 0.185 0.388 0.00032
UNIPROTKB|F1SBJ3 345 NDUFAF5 "Uncharacterized prote 0.496 0.185 0.373 0.00067
MGI|MGI:1916737 343 Ndufaf5 "NADH dehydrogenase (u 0.496 0.186 0.373 0.00086
TAIR|locus:2199650 AT1G22800 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 247 (92.0 bits), Expect = 4.9e-21, P = 4.9e-21
 Identities = 54/91 (59%), Positives = 65/91 (71%)

Query:    19 ANNEPYALVPSGSFCTDNGF----ETTSNGSSRVSIFDRHLKRKQRDRAAWLTRP-NDSF 73
             +  + +  + S SF T+  +    E   N SS+V IFDR LKR  RDRAAWL+R  NDSF
Sbjct:    21 STKQAHTFLASLSFSTEGAYGGDGEFQQN-SSKVKIFDRDLKRIHRDRAAWLSRQKNDSF 79

Query:    74 VDAVAENLLDRLEDCRKTFPTALCLGGSLEA 104
             VDAVA+NLLDRLEDC+K+FPTA CLGGSL A
Sbjct:    80 VDAVADNLLDRLEDCKKSFPTAFCLGGSLGA 110




GO:0005739 "mitochondrion" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0019243 "methylglyoxal catabolic process to D-lactate" evidence=RCA
UNIPROTKB|F1NUD7 F1NUD7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C306 E1C306 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|B3KR61 NDUFAF5 "HCG1811060, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RBS1 NDUFAF5 "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TEU4 NDUFAF5 "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SBJ3 NDUFAF5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1916737 Ndufaf5 "NADH dehydrogenase (ubiquinone) complex I, assembly factor 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
KOG2940 325 consensus Predicted methyltransferase [General fun 99.5
PRK10258 251 biotin biosynthesis protein BioC; Provisional 99.05
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 98.31
TIGR02752 231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 97.38
PLN02233 261 ubiquinone biosynthesis methyltransferase 97.22
PRK05785 226 hypothetical protein; Provisional 97.21
PRK11088 272 rrmA 23S rRNA methyltransferase A; Provisional 96.99
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 96.88
PF13489 161 Methyltransf_23: Methyltransferase domain; PDB: 3J 96.8
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 96.72
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 96.67
PRK00216 239 ubiE ubiquinone/menaquinone biosynthesis methyltra 96.54
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 96.53
PRK07580 230 Mg-protoporphyrin IX methyl transferase; Validated 96.1
PLN02585 315 magnesium protoporphyrin IX methyltransferase 96.04
PF01209 233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 95.87
TIGR02021 219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 95.86
PRK15451 247 tRNA cmo(5)U34 methyltransferase; Provisional 95.77
TIGR00740 239 methyltransferase, putative. A simple BLAST search 95.75
COG2226 238 UbiE Methylase involved in ubiquinone/menaquinone 95.74
TIGR01934 223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 95.7
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 95.64
TIGR00477 195 tehB tellurite resistance protein TehB. Part of a 95.58
TIGR03587 204 Pse_Me-ase pseudaminic acid biosynthesis-associate 95.54
PF07021 193 MetW: Methionine biosynthesis protein MetW; InterP 95.5
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 95.46
PRK11188 209 rrmJ 23S rRNA methyltransferase J; Provisional 95.43
KOG1541 270 consensus Predicted protein carboxyl methylase [Ge 95.39
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 95.31
PRK08287 187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 95.27
PF05175 170 MTS: Methyltransferase small domain; InterPro: IPR 95.27
PLN02396 322 hexaprenyldihydroxybenzoate methyltransferase 95.15
COG4976 287 Predicted methyltransferase (contains TPR repeat) 95.1
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 94.99
smart00650 169 rADc Ribosomal RNA adenine dimethylases. 94.95
TIGR00537 179 hemK_rel_arch HemK-related putative methylase. The 94.89
PLN02244 340 tocopherol O-methyltransferase 94.88
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 94.88
KOG1271 227 consensus Methyltransferases [General function pre 94.86
TIGR02081 194 metW methionine biosynthesis protein MetW. This pr 94.85
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 94.82
PRK06202 232 hypothetical protein; Provisional 94.77
PRK11207 197 tellurite resistance protein TehB; Provisional 94.7
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 94.57
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 94.47
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 94.38
TIGR00478 228 tly hemolysin TlyA family protein. Hemolysins are 94.32
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 94.28
TIGR03438 301 probable methyltransferase. This model represents 94.23
TIGR00438 188 rrmJ cell division protein FtsJ. 94.2
TIGR00138 181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 94.06
PF01728 181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 94.03
TIGR00452 314 methyltransferase, putative. Known examples to dat 93.76
PRK07402 196 precorrin-6B methylase; Provisional 93.76
PRK04148134 hypothetical protein; Provisional 93.74
COG2227 243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 93.64
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 93.48
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 93.45
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 93.45
PRK00121 202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 93.45
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 93.38
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 93.3
PRK03522 315 rumB 23S rRNA methyluridine methyltransferase; Rev 93.02
PRK00107 187 gidB 16S rRNA methyltransferase GidB; Reviewed 92.89
PRK12335 287 tellurite resistance protein TehB; Provisional 92.87
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 92.72
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 92.71
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 92.69
PRK08317 241 hypothetical protein; Provisional 92.58
PF13679141 Methyltransf_32: Methyltransferase domain 92.51
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 92.4
KOG1270 282 consensus Methyltransferases [Coenzyme transport a 92.36
TIGR00091 194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 92.1
TIGR03534 251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 92.07
PLN02490 340 MPBQ/MSBQ methyltransferase 91.91
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 91.91
PLN02668 386 indole-3-acetate carboxyl methyltransferase 91.87
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 91.64
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 91.59
PLN02336 475 phosphoethanolamine N-methyltransferase 91.22
PLN02336 475 phosphoethanolamine N-methyltransferase 91.21
TIGR01983 224 UbiG ubiquinone biosynthesis O-methyltransferase. 91.21
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 91.17
PF03848 192 TehB: Tellurite resistance protein TehB; InterPro: 91.13
PRK04266 226 fibrillarin; Provisional 90.99
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 90.8
PRK14968 188 putative methyltransferase; Provisional 90.76
PRK09489 342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 90.76
TIGR02716 306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 90.58
PRK13168 443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 90.47
PRK15001 378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 90.19
PRK00811 283 spermidine synthase; Provisional 90.03
TIGR03533 284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 89.94
PRK11805 307 N5-glutamine S-adenosyl-L-methionine-dependent met 89.88
COG2890 280 HemK Methylase of polypeptide chain release factor 89.67
PRK14967 223 putative methyltransferase; Provisional 89.65
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 89.54
COG2813 300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 89.22
COG2263 198 Predicted RNA methylase [Translation, ribosomal st 89.16
TIGR03840 213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 88.95
TIGR00536 284 hemK_fam HemK family putative methylases. The gene 88.89
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 88.86
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 88.72
PF08003 315 Methyltransf_9: Protein of unknown function (DUF16 88.57
TIGR02085 374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 88.22
PRK05134 233 bifunctional 3-demethylubiquinone-9 3-methyltransf 88.2
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 88.06
PRK09328 275 N5-glutamine S-adenosyl-L-methionine-dependent met 87.98
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 87.67
PRK14966 423 unknown domain/N5-glutamine S-adenosyl-L-methionin 87.54
PLN02366 308 spermidine synthase 87.44
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 87.36
TIGR00479 431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 87.15
PRK00377 198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 87.15
PRK10901 427 16S rRNA methyltransferase B; Provisional 86.56
PRK10909 199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 86.37
TIGR03704 251 PrmC_rel_meth putative protein-(glutamine-N5) meth 86.15
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 86.14
PRK06922 677 hypothetical protein; Provisional 85.93
TIGR02143 353 trmA_only tRNA (uracil-5-)-methyltransferase. This 85.78
smart00138 264 MeTrc Methyltransferase, chemotaxis proteins. Meth 85.7
PF05401 201 NodS: Nodulation protein S (NodS); InterPro: IPR00 85.51
COG2242 187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 85.38
PRK04457 262 spermidine synthase; Provisional 85.33
PRK05031 362 tRNA (uracil-5-)-methyltransferase; Validated 85.12
KOG2904 328 consensus Predicted methyltransferase [General fun 85.04
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 84.87
PRK01581 374 speE spermidine synthase; Validated 84.77
KOG3191 209 consensus Predicted N6-DNA-methyltransferase [Tran 84.72
TIGR00417 270 speE spermidine synthase. the SpeE subunit of sper 84.51
PRK13255 218 thiopurine S-methyltransferase; Reviewed 84.29
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 84.22
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 83.68
PRK03612 521 spermidine synthase; Provisional 83.08
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 82.05
PF00891 241 Methyltransf_2: O-methyltransferase; InterPro: IPR 81.84
PRK11760 357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 81.73
PF02390 195 Methyltransf_4: Putative methyltransferase ; Inter 81.4
PRK14902 444 16S rRNA methyltransferase B; Provisional 81.04
PHA03412 241 putative methyltransferase; Provisional 80.92
PF05148 219 Methyltransf_8: Hypothetical methyltransferase; In 80.77
TIGR00563 426 rsmB ribosomal RNA small subunit methyltransferase 80.74
PTZ00146 293 fibrillarin; Provisional 80.14
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
Probab=99.50  E-value=1.2e-14  Score=119.83  Aligned_cols=85  Identities=51%  Similarity=0.801  Sum_probs=73.2

Q ss_pred             eecccccccccCCCccCCCCCCccCcCCHHHHHHHHhHhhhcCCC-ChHHHHHHHHHHHhhhHhhhccCCeEEEEccCcc
Q 032981           25 ALVPSGSFCTDNGFETTSNGSSRVSIFDRHLKRKQRDRAAWLTRP-NDSFVDAVAENLLDRLEDCRKTFPTALCLGGSLE  103 (129)
Q Consensus        25 ~~~~~r~~~~~~~~~~~~~~~~~~~IFDR~~vr~~r~RAA~~y~~-~~fLq~eVAerL~DRL~~IkR~f~~aLDLGcgtG  103 (129)
                      +++.+-+|+|.          +...||||+.++.||+||+...+. .+||++||+++|+||+.++++.|+.++||||+-|
T Consensus        15 ~~l~sls~~t~----------s~~~iFDR~~KR~qrdrAa~~~d~k~dylkeeig~rlaDrvfD~kk~fp~a~diGcs~G   84 (325)
T KOG2940|consen   15 TFLASLSFSTE----------SKVKIFDRDLKRIQRDRAAWLSDQKNDYLKEEIGDRLADRVFDCKKSFPTAFDIGCSLG   84 (325)
T ss_pred             HHHHHhhccch----------hhhHhhhhHHHHHHHhHHhhcchhhhhHHHHHHHHHHHHHHHHHhhhCcceeecccchh
Confidence            44555566554          446799999999999999987554 5999999999999999999999999999999999


Q ss_pred             HHHHHHhccCCcchhHH
Q 032981          104 AVRRLLRGRVVLQKENF  120 (129)
Q Consensus       104 ~l~~~L~~~g~v~~l~~  120 (129)
                      ++.+.|.+.+ |+++|+
T Consensus        85 ~v~rhl~~e~-vekli~  100 (325)
T KOG2940|consen   85 AVKRHLRGEG-VEKLIM  100 (325)
T ss_pred             hhhHHHHhcc-hhheee
Confidence            9999999864 888764



>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 97.29
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 97.18
3ege_A 261 Putative methyltransferase from antibiotic biosyn 97.0
3q87_B 170 N6 adenine specific DNA methylase; SAM-methyltrans 96.98
2p7i_A 250 Hypothetical protein; putative methyltransferase, 96.89
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 96.88
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 96.87
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 96.78
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 96.75
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 96.7
3ou2_A 218 SAM-dependent methyltransferase; O-methyltransfera 96.66
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 96.63
1ws6_A171 Methyltransferase; structural genomics, riken stru 96.59
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 96.52
3jwh_A 217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 96.5
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 96.5
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 96.45
1zx0_A 236 Guanidinoacetate N-methyltransferase; structural g 96.45
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 96.45
3grz_A 205 L11 mtase, ribosomal protein L11 methyltransferase 96.41
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 96.41
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 96.38
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 96.38
3jwg_A 219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 96.36
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 96.28
3e8s_A 227 Putative SAM dependent methyltransferase; NP_74470 96.27
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 96.27
3u81_A 221 Catechol O-methyltransferase; neurotransmitter deg 96.27
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 96.24
3gdh_A 241 Trimethylguanosine synthase homolog; M7G, CAP, dim 96.2
3p9n_A 189 Possible methyltransferase (methylase); RV2966C, a 96.15
4gek_A 261 TRNA (CMO5U34)-methyltransferase; structural genom 96.1
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 96.1
3dlc_A 219 Putative S-adenosyl-L-methionine-dependent methylt 96.09
3hm2_A 178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 96.07
3p2e_A 225 16S rRNA methylase; methyltransferase, transferase 96.05
2zfu_A 215 Nucleomethylin, cerebral protein 1; nucleolar prot 96.05
2fhp_A 187 Methylase, putative; alpha-beta-alpha sandwich, st 96.04
1ne2_A 200 Hypothetical protein TA1320; structural genomics, 96.03
3h2b_A 203 SAM-dependent methyltransferase; alpha-beta protei 96.01
2gs9_A 211 Hypothetical protein TT1324; methyl transferase, s 95.98
1wy7_A 207 Hypothetical protein PH1948; seven-stranded beta s 95.98
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 95.96
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 95.94
2yxd_A 183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 95.94
3opn_A 232 Putative hemolysin; structural genomics, PSI-2, pr 95.92
3e05_A 204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 95.92
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 95.92
2oxt_A 265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 95.9
3dou_A 191 Ribosomal RNA large subunit methyltransferase J; c 95.9
3f4k_A 257 Putative methyltransferase; structural genomics, P 95.89
3mti_A 185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 95.89
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 95.88
3e23_A 211 Uncharacterized protein RPA2492; alpha-beta protei 95.88
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 95.88
2wa2_A 276 Non-structural protein 5; transferase, S-adenosyl- 95.88
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 95.87
3ofk_A 216 Nodulation protein S; NODS, N-methyltransferase, S 95.86
2pxx_A 215 Uncharacterized protein MGC2408; structural genomi 95.78
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 95.75
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 95.74
2nyu_A 196 Putative ribosomal RNA methyltransferase 2; SAM, s 95.74
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 95.72
2qe6_A 274 Uncharacterized protein TFU_2867; putative methylt 95.7
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 95.7
2plw_A 201 Ribosomal RNA methyltransferase, putative; malaria 95.69
4dzr_A 215 Protein-(glutamine-N5) methyltransferase, release 95.68
1l3i_A 192 Precorrin-6Y methyltransferase/putative decarboxyl 95.65
2esr_A 177 Methyltransferase; structural genomics, hypothetic 95.64
1dus_A 194 MJ0882; hypothetical protein, methanococcus jannas 95.64
1nt2_A 210 Fibrillarin-like PRE-rRNA processing protein; adeM 95.58
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 95.57
1ej0_A 180 FTSJ; methyltransferase, adoMet, adenosyl methioni 95.54
3m33_A 226 Uncharacterized protein; structural genomics, PSI- 95.54
1r18_A 227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 95.51
3hnr_A 220 Probable methyltransferase BT9727_4108; structural 95.51
2ift_A 201 Putative methylase HI0767; NESG, Y767_haein, struc 95.51
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 95.51
2bm8_A 236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 95.5
2ex4_A 241 Adrenal gland protein AD-003; methyltransferase, s 95.5
3lcc_A 235 Putative methyl chloride transferase; halide methy 95.49
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 95.45
3id6_C 232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 95.45
2pbf_A 227 Protein-L-isoaspartate O-methyltransferase beta-A 95.41
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 95.4
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 95.4
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 95.39
1xtp_A 254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 95.36
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 95.33
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 95.3
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 95.3
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 95.3
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 95.29
3m70_A 286 Tellurite resistance protein TEHB homolog; structu 95.29
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 95.29
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 95.27
3mq2_A 218 16S rRNA methyltransferase; methyltranferase, ribo 95.26
1vbf_A 231 231AA long hypothetical protein-L-isoaspartate O- 95.26
1pjz_A 203 Thiopurine S-methyltransferase; polymorphism, S-ad 95.26
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 95.26
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 95.25
3njr_A 204 Precorrin-6Y methylase; methyltransferase, decarbo 95.21
2fpo_A 202 Methylase YHHF; structural genomics, putative meth 95.19
1i1n_A 226 Protein-L-isoaspartate O-methyltransferase; S-aden 95.17
3fzg_A 200 16S rRNA methylase; methyltransferase, plasmid, tr 95.16
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 95.13
2g72_A 289 Phenylethanolamine N-methyltransferase; HET: SAM F 95.09
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; R 95.06
3orh_A 236 Guanidinoacetate N-methyltransferase; structura ge 95.03
2kw5_A 202 SLR1183 protein; structural genomics, northeast st 95.03
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 94.97
3cc8_A 230 Putative methyltransferase; structural genomics, j 94.95
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 94.93
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 94.91
3ntv_A 232 MW1564 protein; rossmann fold, putative methyltran 94.87
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 94.82
1xdz_A 240 Methyltransferase GIDB; MCSG, protein structure in 94.81
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 94.8
2xvm_A 199 Tellurite resistance protein TEHB; antibiotic resi 94.79
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 94.78
1jsx_A 207 Glucose-inhibited division protein B; methyltransf 94.77
2gb4_A 252 Thiopurine S-methyltransferase; 18204406, thiopuri 94.76
1vlm_A 219 SAM-dependent methyltransferase; possible histamin 94.71
1xxl_A 239 YCGJ protein; structural genomics, protein structu 94.64
3duw_A 223 OMT, O-methyltransferase, putative; alternating of 94.59
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 94.56
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 94.55
3cgg_A 195 SAM-dependent methyltransferase; NP_600671.1, meth 94.54
3dxy_A 218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 94.51
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 94.5
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 94.46
1u2z_A 433 Histone-lysine N-methyltransferase, H3 lysine-79 s 94.44
1jg1_A 235 PIMT;, protein-L-isoaspartate O-methyltransferase; 94.43
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 94.43
2b3t_A 276 Protein methyltransferase HEMK; translation termin 94.42
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 94.4
1o9g_A 250 RRNA methyltransferase; antibiotic resistance, Se- 94.39
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 94.35
2h00_A 254 Methyltransferase 10 domain containing protein; st 94.33
2fca_A 213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 94.28
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 94.26
3i9f_A 170 Putative type 11 methyltransferase; structural gen 94.25
2a14_A 263 Indolethylamine N-methyltransferase; SGC,INMT, str 94.21
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 94.18
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 94.18
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 94.13
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 94.08
3tr6_A 225 O-methyltransferase; cellular processes; HET: SAH; 94.08
1fbn_A 230 MJ fibrillarin homologue; MJ proteins, ribosomal R 94.03
2r3s_A 335 Uncharacterized protein; methyltransferase domain, 94.02
3bzb_A 281 Uncharacterized protein; RED ALGA, protein structu 94.0
3adn_A 294 Spermidine synthase; aminopropyltransferase, polya 93.99
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 93.97
1yzh_A 214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 93.96
3ckk_A 235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 93.92
1fp1_D 372 Isoliquiritigenin 2'-O-methyltransferase; protein- 93.9
2gpy_A 233 O-methyltransferase; structural genomics, PSI, pro 93.85
2avd_A 229 Catechol-O-methyltransferase; structural genomics, 93.77
3bwc_A 304 Spermidine synthase; SAM, SGPP, structura genomics 93.76
1uwv_A 433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 93.74
2o07_A 304 Spermidine synthase; structural genomics, structur 93.72
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 93.72
2ipx_A 233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 93.68
3dmg_A 381 Probable ribosomal RNA small subunit methyltransf; 93.64
3tfw_A 248 Putative O-methyltransferase; PSI-biology, nysgrc, 93.64
1g8a_A 227 Fibrillarin-like PRE-rRNA processing protein; rRNA 93.61
3mcz_A 352 O-methyltransferase; adomet_mtases, S-adenosylmeth 93.55
3evf_A 277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 93.53
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 93.51
3eey_A 197 Putative rRNA methylase; rRNA methylation, S-adeno 93.48
2hnk_A 239 SAM-dependent O-methyltransferase; modified rossma 93.47
2i62_A 265 Nicotinamide N-methyltransferase; structural genom 93.45
2vdv_E 246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 93.44
3c3p_A 210 Methyltransferase; NP_951602.1, structural genomic 93.44
3tm4_A 373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 93.43
2i7c_A 283 Spermidine synthase; transferase, structural genom 93.42
1x19_A 359 CRTF-related protein; methyltransferase, bacterioc 93.34
3reo_A 368 (ISO)eugenol O-methyltransferase; directed evoluti 93.33
1nv8_A 284 HEMK protein; class I adoMet-dependent methyltrans 93.31
1xj5_A 334 Spermidine synthase 1; structural genomics, protei 93.21
3mb5_A 255 SAM-dependent methyltransferase; RNA methyltransfe 93.18
1zg3_A 358 Isoflavanone 4'-O-methyltransferase; rossman fold, 93.14
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 93.08
3evz_A 230 Methyltransferase; NYSGXRC, NEW YORK SGX research 93.08
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 93.08
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 93.05
1sui_A 247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 93.03
3p9c_A 364 Caffeic acid O-methyltransferase; S-adenosylmethio 93.0
3lst_A 348 CALO1 methyltransferase; calicheamicin, enediyne, 92.98
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 92.96
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 92.82
3c3y_A 237 Pfomt, O-methyltransferase; plant secondary metabo 92.8
3g89_A 249 Ribosomal RNA small subunit methyltransferase G; 1 92.76
2ip2_A 334 Probable phenazine-specific methyltransferase; pyo 92.71
3lpm_A 259 Putative methyltransferase; structural genomics, p 92.68
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 92.68
1fp2_A 352 Isoflavone O-methyltransferase; protein-product co 92.65
3ocj_A 305 Putative exported protein; structural genomics, PS 92.64
3r3h_A 242 O-methyltransferase, SAM-dependent; structural gen 92.63
1iy9_A 275 Spermidine synthase; rossmann fold, structural gen 92.61
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 92.59
2frn_A 278 Hypothetical protein PH0793; structural genomics, 92.38
1mjf_A 281 Spermidine synthase; spermidine synthetase, struct 92.29
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 92.29
2igt_A 332 SAM dependent methyltransferase; alpha-beta sandwi 92.26
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 92.23
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 92.19
1inl_A 296 Spermidine synthase; beta-barrel, rossman fold, st 92.1
2px2_A 269 Genome polyprotein [contains: capsid protein C (co 92.06
3gcz_A 282 Polyprotein; flavivirus, RNA capping, methyltransf 92.06
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 92.03
3gwz_A 369 MMCR; methyltransferase, mitomycin, S-adenosyl met 91.99
1yb2_A 275 Hypothetical protein TA0852; structural genomics, 91.98
2pjd_A 343 Ribosomal RNA small subunit methyltransferase C; g 91.87
3lcv_B 281 Sisomicin-gentamicin resistance methylase SGM; ant 91.86
3frh_A 253 16S rRNA methylase; methyltransferase domain, heli 91.85
4dcm_A 375 Ribosomal RNA large subunit methyltransferase G; 2 91.76
2pwy_A 258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 91.74
3cbg_A 232 O-methyltransferase; cyanobacterium; HET: SAH FER 91.72
2b25_A 336 Hypothetical protein; structural genomics, methyl 91.66
2b2c_A 314 Spermidine synthase; beta-alpha, transferase; 2.50 91.64
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 91.59
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 91.56
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 91.56
2pt6_A 321 Spermidine synthase; transferase, structural genom 91.52
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 91.29
3eld_A 300 Methyltransferase; flavivirus, RNA capping, guanyl 91.2
3dr5_A 221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 90.82
4df3_A 233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 90.69
2cmg_A 262 Spermidine synthase; transferase, putrescine amino 90.63
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 90.51
3i53_A 332 O-methyltransferase; CO-complex, rossmann-like fol 90.19
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 90.13
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 89.83
3bt7_A 369 TRNA (uracil-5-)-methyltransferase; methyluridine, 89.71
2yvl_A 248 TRMI protein, hypothetical protein; tRNA, methyltr 89.23
4a6d_A 353 Hydroxyindole O-methyltransferase; melatonin, circ 89.22
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 89.19
2f8l_A 344 Hypothetical protein LMO1582; structural genomics, 88.32
3lkz_A 321 Non-structural protein 5; flavivirus, methyltransf 88.31
1ixk_A 315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 88.22
3p8z_A 267 Mtase, non-structural protein 5; methyltransferase 87.51
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 87.3
1sqg_A 429 SUN protein, FMU protein; rossmann-fold, mixed bet 87.16
4auk_A 375 Ribosomal RNA large subunit methyltransferase M; Y 86.99
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 86.76
3a27_A 272 TYW2, uncharacterized protein MJ1557; wybutosine m 86.59
3tma_A 354 Methyltransferase; thump domain; 2.05A {Thermus th 86.49
2b78_A 385 Hypothetical protein SMU.776; structure genomics, 86.28
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 86.15
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 86.03
2r6z_A 258 UPF0341 protein in RSP 3' region; alpha-beta prote 85.95
4dmg_A 393 Putative uncharacterized protein TTHA1493; rRNA, m 85.66
3c0k_A 396 UPF0064 protein YCCW; PUA domain, adoMet dependent 85.48
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 84.68
2as0_A 396 Hypothetical protein PH1915; RNA methyltransferase 84.19
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 84.11
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 83.94
3ajd_A 274 Putative methyltransferase MJ0026; tRNA, M5C, ross 83.83
2yx1_A 336 Hypothetical protein MJ0883; methyl transferase, t 82.92
3ll7_A 410 Putative methyltransferase; methytransferase, stru 82.77
2yxl_A 450 PH0851 protein, 450AA long hypothetical FMU protei 82.34
3k6r_A 278 Putative transferase PH0793; structural genomics, 82.18
1wxx_A 382 TT1595, hypothetical protein TTHA1280; thermus the 80.76
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 80.26
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 80.14
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
Probab=97.29  E-value=0.00025  Score=55.39  Aligned_cols=42  Identities=14%  Similarity=0.092  Sum_probs=33.8

Q ss_pred             hHHHHHHHHHHHhhhHhhhccCCeEEEEccCccHHHHHHhcc
Q 032981           71 DSFVDAVAENLLDRLEDCRKTFPTALCLGGSLEAVRRLLRGR  112 (129)
Q Consensus        71 ~fLq~eVAerL~DRL~~IkR~f~~aLDLGcgtG~l~~~L~~~  112 (129)
                      .|+++.+.+++.+++......+.+|||||||+|.++..|.+.
T Consensus        14 ~~~k~~l~~~~~~~l~~~~~~~~~VLDlGcG~G~~~~~l~~~   55 (313)
T 3bgv_A           14 NWMKSVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKG   55 (313)
T ss_dssp             HHHHHHHHHHHHHHHHHTC--CCEEEEETCTTTTTHHHHHHT
T ss_pred             HHHHHHHHHHHHHHhhhccCCCCEEEEECCCCcHHHHHHHhc
Confidence            577888888888888876667889999999999998888653



>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 97.39
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 97.23
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [Tax 96.98
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 96.97
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 96.89
d1pjza_ 201 Thiopurine S-methyltransferase {Pseudomonas syring 96.81
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 96.71
d1vlma_ 208 Possible histamine N-methyltransferase TM1293 {The 96.63
d1im8a_ 225 Hypothetical protein HI0319 (YecO) {Haemophilus in 96.56
d2i6ga1 198 Putative methyltransferase TehB {Salmonella typhim 96.54
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 96.5
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 96.46
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 96.26
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 96.0
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 95.99
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 95.97
d1dusa_ 194 Hypothetical protein MJ0882 {Archaeon Methanococcu 95.88
d2a14a1 257 Indolethylamine N-methyltransferase, INMT {Human ( 95.84
d1i1na_ 224 Protein-L-isoaspartyl O-methyltransferase {Human ( 95.63
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 95.62
d1l3ia_ 186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 95.61
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 95.55
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 95.35
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 95.3
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 95.22
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 95.19
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 95.14
d1zx0a1 229 Guanidinoacetate methyltransferase {Human (Homo sa 95.14
d1ne2a_ 197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 94.94
d2ex4a1 222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 94.89
d1tw3a2 253 Carminomycin 4-O-methyltransferase {Streptomyces p 94.69
d1wy7a1 201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 94.69
d1r18a_ 223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 94.51
d1vbfa_ 224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 94.4
d2fcaa1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 94.25
d2bzga1 229 Thiopurine S-methyltransferase {Human (Homo sapien 94.24
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 94.19
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 93.99
d1nt2a_ 209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 93.91
d1g8sa_ 230 Fibrillarin homologue {Archaeon Methanococcus jann 93.9
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 93.74
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 93.54
d1xtpa_ 254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 93.47
d1yzha1 204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 93.36
d1u2za_ 406 Catalytic, N-terminal domain of histone methyltran 93.33
d1yuba_ 245 rRNA adenine dimethylase {Streptococcus pneumoniae 92.95
d1qzza2 256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 92.93
d1qyra_ 252 High level kasugamycin resistance protein KsgA {Es 92.83
d1nw3a_ 328 Catalytic, N-terminal domain of histone methyltran 92.74
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 92.33
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 91.93
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 91.57
d1fp1d2 244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 91.06
d2g72a1 263 Phenylethanolamine N-methyltransferase, PNMTase {H 90.96
d2ih2a1 223 DNA methylase TaqI, N-terminal domain {Thermus aqu 90.75
d1g8aa_ 227 Fibrillarin homologue {Archaeon Pyrococcus horikos 90.46
d2h00a1 250 Methyltransferase 10 domain containing protein MET 90.34
d1yb2a1 250 Hypothetical protein Ta0852 {Thermoplasma acidophi 90.27
d1o54a_ 266 Hypothetical protein TM0748 {Thermotoga maritima [ 89.87
d1kyza2 243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 89.6
d2b3ta1 274 N5-glutamine methyltransferase, HemK {Escherichia 89.5
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 89.33
d2p41a1 257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 89.24
d1ej0a_ 180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 88.65
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 88.08
d1i9ga_ 264 Probable methyltransferase Rv2118c {Mycobacterium 88.05
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 86.49
d2fpoa1 183 Methylase YhhF {Escherichia coli [TaxId: 562]} 86.12
d1fp2a2 244 Isoflavone O-methyltransferase {Alfalfa (Medicago 84.92
d2frna1 260 Hypothetical protein PH0793 {Pyrococcus horikoshii 83.32
d2cl5a1 214 Catechol O-methyltransferase, COMT {Rat (Rattus no 80.64
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical methyltransferase TM1389
species: Thermotoga maritima [TaxId: 2336]
Probab=97.39  E-value=0.00012  Score=52.38  Aligned_cols=28  Identities=29%  Similarity=0.231  Sum_probs=22.7

Q ss_pred             HhhhccCCeEEEEccCccHHHHHHhccC
Q 032981           86 EDCRKTFPTALCLGGSLEAVRRLLRGRV  113 (129)
Q Consensus        86 ~~IkR~f~~aLDLGcgtG~l~~~L~~~g  113 (129)
                      ........+|||+|||+|.++..|.+.+
T Consensus        37 ~~~~~~~~~vLDiGcG~G~~~~~l~~~~   64 (246)
T d2avna1          37 EEYLKNPCRVLDLGGGTGKWSLFLQERG   64 (246)
T ss_dssp             HHHCCSCCEEEEETCTTCHHHHHHHTTT
T ss_pred             HHhcCCCCEEEEECCCCchhcccccccc
Confidence            3445567899999999999999997654



>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure