Citrus Sinensis ID: 033121

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAAFESQEQMEVPTTTNDDLSLV
ccccHHHHHHHHHHHHHHHcccccccccEEEEEEEEccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
ccccHHHHHHHHHHHHHHHcccccccEEEEEEEEEcccHHHHccccccccccccccccccEEEcccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccccccccccc
MPLPNDEIIRRVAKQVLAlfpssqgleVIWSSVVKIGqslyhegpgkdpfrpdqktQVKNLFLagsytkqdyidimegaslsgrQASAYICNAREELVALRKQLAAFEsqeqmevptttnddlslv
MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHegpgkdpfrpdQKTQVKNLFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAafesqeqmevptttnddlslv
MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAAFESQEQMEVPTTTNDDLSLV
*******IIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYH**************QVKNLFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLA*********************
*PLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGASLSGRQASAYICN*******************************SLV
MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAAFESQ****************
*PLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAA********************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAAFESQEQMEVPTTTNDDLSLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query126 2.2.26 [Sep-21-2011]
Q9FV46587 Zeta-carotene desaturase, N/A no 0.960 0.206 0.785 5e-51
Q9SMJ3588 Zeta-carotene desaturase, N/A no 0.992 0.212 0.777 6e-51
O49901574 Zeta-carotene desaturase, N/A no 1.0 0.219 0.746 1e-49
Q9SE20588 Zeta-carotene desaturase, N/A no 0.992 0.212 0.746 1e-48
Q9ZTP4570 Zeta-carotene desaturase, N/A no 0.825 0.182 0.788 1e-43
Q38893558 Zeta-carotene desaturase, yes no 0.936 0.211 0.690 4e-42
Q31N27481 Probable zeta-carotene de yes no 0.746 0.195 0.585 3e-27
P74306489 Zeta-carotene desaturase N/A no 0.817 0.210 0.571 3e-25
Q9R6X4479 Zeta-carotene desaturase yes no 0.698 0.183 0.590 2e-24
P29273472 Phytoene dehydrogenase OS N/A no 0.690 0.184 0.384 4e-11
>sp|Q9FV46|ZDS_TARER Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Tagetes erecta PE=2 SV=1 Back     alignment and function desciption
 Score =  199 bits (505), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 99/126 (78%), Positives = 109/126 (86%), Gaps = 5/126 (3%)

Query: 1   MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKN 60
           MPLPN+EII RV+KQVLALFPSSQGLEV WSSVVKIGQSLY EGPGKDPFRPDQKT VKN
Sbjct: 467 MPLPNEEIISRVSKQVLALFPSSQGLEVTWSSVVKIGQSLYREGPGKDPFRPDQKTPVKN 526

Query: 61  LFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAAFESQEQMEVPTTTN 120
            FLAGSYTKQDYID MEGA+LSGRQASA+IC+A EEL ALRKQLAA +S + + V     
Sbjct: 527 FFLAGSYTKQDYIDSMEGATLSGRQASAFICDAGEELAALRKQLAAIQSIDSIGV----- 581

Query: 121 DDLSLV 126
           D++SLV
Sbjct: 582 DEMSLV 587
Catalyzes the conversion of zeta-carotene to lycopene via the intermediary of neurosporene. It carries out two consecutive desaturations (introduction of double bonds) at positions C-7 and C-7'.
Tagetes erecta (taxid: 13708)
EC: 1EC: .EC: 3EC: .EC: 5EC: .EC: 6
>sp|Q9SMJ3|ZDS_CAPAN Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Capsicum annuum GN=ZDS PE=1 SV=1 Back     alignment and function description
>sp|O49901|ZDS_NARPS Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Narcissus pseudonarcissus GN=ZDS1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SE20|ZDS_SOLLC Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Solanum lycopersicum GN=ZDS PE=2 SV=1 Back     alignment and function description
>sp|Q9ZTP4|ZDS_MAIZE Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Zea mays GN=ZDS1 PE=2 SV=1 Back     alignment and function description
>sp|Q38893|ZDS_ARATH Zeta-carotene desaturase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=ZDS1 PE=1 SV=3 Back     alignment and function description
>sp|Q31N27|ZDS_SYNE7 Probable zeta-carotene desaturase OS=Synechococcus elongatus (strain PCC 7942) GN=zds PE=3 SV=1 Back     alignment and function description
>sp|P74306|ZDS_SYNY3 Zeta-carotene desaturase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crtQ PE=3 SV=1 Back     alignment and function description
>sp|Q9R6X4|ZDS_NOSS1 Zeta-carotene desaturase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=crtQ PE=3 SV=2 Back     alignment and function description
>sp|P29273|CRTI_SYNY3 Phytoene dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pds PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
18073986 570 zeta-carotene desaturase [Citrus sinensi 1.0 0.221 0.936 3e-62
83637848 570 zeta-carotene desaturase [Citrus unshiu] 1.0 0.221 0.936 3e-62
13991921 570 zeta-carotene desaturase precursor [Citr 1.0 0.221 0.936 3e-62
15824043 570 zeta-carotene desaturase [Citrus unshiu] 1.0 0.221 0.936 3e-62
190576747 570 zeta carotene desaturase [Citrus maxima] 1.0 0.221 0.928 1e-61
197318637 299 zeta carotene desaturase [Citrus maxima] 1.0 0.421 0.912 3e-59
33313474 571 zeta-carotene desaturase ZDS2 [Malus x d 0.992 0.218 0.809 5e-50
33313470 568 zeta-carotene desaturase ZDS1 [Malus x d 0.992 0.220 0.809 5e-50
1583601 588 zeta carotene desaturase 0.992 0.212 0.785 1e-49
356535151 570 PREDICTED: zeta-carotene desaturase, chl 0.984 0.217 0.793 1e-49
>gi|18073986|emb|CAC85667.1| zeta-carotene desaturase [Citrus sinensis] Back     alignment and taxonomy information
 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 118/126 (93%), Positives = 120/126 (95%)

Query: 1   MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKN 60
           MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLY EGPGKDPFRPDQKT VKN
Sbjct: 445 MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYREGPGKDPFRPDQKTPVKN 504

Query: 61  LFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAAFESQEQMEVPTTTN 120
            FLAGSYTKQDYID MEGA+LSGRQASAYICNA EELVALRKQLAAFESQEQME PTTTN
Sbjct: 505 FFLAGSYTKQDYIDSMEGATLSGRQASAYICNAGEELVALRKQLAAFESQEQMEAPTTTN 564

Query: 121 DDLSLV 126
           D+LSLV
Sbjct: 565 DELSLV 570

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|83637848|gb|ABC33728.1| zeta-carotene desaturase [Citrus unshiu] Back     alignment and taxonomy information
>gi|13991921|gb|AAK51557.1|AF372617_1 zeta-carotene desaturase precursor [Citrus x paradisi] Back     alignment and taxonomy information
>gi|15824043|dbj|BAB68552.1| zeta-carotene desaturase [Citrus unshiu] Back     alignment and taxonomy information
>gi|190576747|gb|ACE79169.1| zeta carotene desaturase [Citrus maxima] Back     alignment and taxonomy information
>gi|197318637|gb|ACH67607.1| zeta carotene desaturase [Citrus maxima] Back     alignment and taxonomy information
>gi|33313474|gb|AAQ04225.1| zeta-carotene desaturase ZDS2 [Malus x domestica] Back     alignment and taxonomy information
>gi|33313470|gb|AAQ04224.1| zeta-carotene desaturase ZDS1 [Malus x domestica] Back     alignment and taxonomy information
>gi|1583601|prf||2121278A zeta carotene desaturase Back     alignment and taxonomy information
>gi|356535151|ref|XP_003536112.1| PREDICTED: zeta-carotene desaturase, chloroplastic/chromoplastic-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
TAIR|locus:2114789558 ZDS "zeta-carotene desaturase" 0.936 0.211 0.690 9.9e-39
TAIR|locus:2129515566 PDS3 "phytoene desaturase 3" [ 0.753 0.167 0.37 1.2e-08
TAIR|locus:2114789 ZDS "zeta-carotene desaturase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 414 (150.8 bits), Expect = 9.9e-39, P = 9.9e-39
 Identities = 87/126 (69%), Positives = 97/126 (76%)

Query:     1 MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKN 60
             M +PND+II +VA QV  LFPSS+GLEV WSSVVKI QSLY E PGKDPFRPDQKT +KN
Sbjct:   441 MRMPNDKIIEKVAMQVTELFPSSRGLEVTWSSVVKIAQSLYREAPGKDPFRPDQKTPIKN 500

Query:    61 LFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAAFESQEQMEVPTTTN 120
              FLAGSYTKQDYID MEGA+LSGRQAS+YIC+A EEL  L K+L    S     VP    
Sbjct:   501 FFLAGSYTKQDYIDSMEGATLSGRQASSYICDAGEELAELNKKL----SSSATAVP---- 552

Query:   121 DDLSLV 126
             D+LSLV
Sbjct:   553 DELSLV 558
GO:0005739 "mitochondrion" evidence=ISM
GO:0016117 "carotenoid biosynthetic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0016719 "carotene 7,8-desaturase activity" evidence=IEA;IDA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0016120 "carotene biosynthetic process" evidence=IDA
TAIR|locus:2129515 PDS3 "phytoene desaturase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
PLN02487569 PLN02487, PLN02487, zeta-carotene desaturase 1e-63
TIGR02732474 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot 2e-50
COG3349485 COG3349, COG3349, Uncharacterized conserved protei 2e-22
TIGR02731453 TIGR02731, phytoene_desat, phytoene desaturase 9e-19
TIGR03467411 TIGR03467, HpnE, squalene-associated FAD-dependent 9e-16
PLN02612567 PLN02612, PLN02612, phytoene desaturase 4e-15
pfam01593444 pfam01593, Amino_oxidase, Flavin containing amine 1e-10
>gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase Back     alignment and domain information 
 Score =  202 bits (516), Expect = 1e-63
 Identities = 84/109 (77%), Positives = 92/109 (84%)

Query: 1   MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKN 60
           MPL ND+I+ +V KQVL LFPSS+GLEV WSSVVKIGQSLY E PG DPFRPDQKT + N
Sbjct: 460 MPLSNDKIVEKVHKQVLELFPSSRGLEVTWSSVVKIGQSLYREAPGMDPFRPDQKTPISN 519

Query: 61  LFLAGSYTKQDYIDIMEGASLSGRQASAYICNAREELVALRKQLAAFES 109
            FLAGSYTKQDYID MEGA+LSGRQA+AYIC A EEL  LRK+LAA ES
Sbjct: 520 FFLAGSYTKQDYIDSMEGATLSGRQAAAYICEAGEELAGLRKKLAAEES 568

Length = 569
>gnl|CDD|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase Back     alignment and domain information
>gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase Back     alignment and domain information
>gnl|CDD|234221 TIGR03467, HpnE, squalene-associated FAD-dependent desaturase Back     alignment and domain information
>gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase Back     alignment and domain information
>gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 126
PLN02487569 zeta-carotene desaturase 99.87
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 99.83
PLN02612567 phytoene desaturase 99.72
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 99.7
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 99.67
PLN02268435 probable polyamine oxidase 99.59
PLN02676487 polyamine oxidase 99.55
PRK07233434 hypothetical protein; Provisional 99.52
PLN02568539 polyamine oxidase 99.45
PLN03000 881 amine oxidase 99.45
PLN02976 1713 amine oxidase 99.45
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 99.41
PLN02529 738 lysine-specific histone demethylase 1 99.37
PLN02328808 lysine-specific histone demethylase 1 homolog 99.36
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 99.28
COG1231450 Monoamine oxidase [Amino acid transport and metabo 99.2
COG3349485 Uncharacterized conserved protein [Function unknow 99.1
PLN02576496 protoporphyrinogen oxidase 99.03
PRK11883451 protoporphyrinogen oxidase; Reviewed 99.02
PRK12416463 protoporphyrinogen oxidase; Provisional 99.01
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.96
PRK07208479 hypothetical protein; Provisional 98.77
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 98.73
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.34
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.21
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.16
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.15
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 97.95
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 96.48
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 96.18
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 93.76
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 93.72
COG1233487 Phytoene dehydrogenase and related proteins [Secon 93.37
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 92.8
PRK12831464 putative oxidoreductase; Provisional 92.53
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 92.28
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 92.27
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 92.19
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 92.04
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 91.41
PLN02661357 Putative thiazole synthesis 91.36
PRK12771564 putative glutamate synthase (NADPH) small subunit; 90.69
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 90.66
PRK10262321 thioredoxin reductase; Provisional 90.52
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 90.52
PRK10157428 putative oxidoreductase FixC; Provisional 90.23
PRK12770352 putative glutamate synthase subunit beta; Provisio 90.0
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 89.95
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 89.93
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 89.82
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 89.74
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 89.39
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 89.35
PRK12814 652 putative NADPH-dependent glutamate synthase small 89.11
PRK13984604 putative oxidoreductase; Provisional 88.99
PRK12779 944 putative bifunctional glutamate synthase subunit b 88.83
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 88.65
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 88.38
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 88.21
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 87.83
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 87.77
PRK06175433 L-aspartate oxidase; Provisional 87.46
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 87.34
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 87.08
PRK09077536 L-aspartate oxidase; Provisional 86.99
PRK08274466 tricarballylate dehydrogenase; Validated 86.92
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 86.49
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 86.26
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 86.26
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 85.86
PRK08071510 L-aspartate oxidase; Provisional 85.7
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 85.63
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 85.61
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 85.58
PRK10015429 oxidoreductase; Provisional 85.42
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 85.34
PRK06116450 glutathione reductase; Validated 85.33
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 85.09
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 84.95
PRK07512513 L-aspartate oxidase; Provisional 84.88
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 84.57
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 84.41
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 84.37
PRK08401466 L-aspartate oxidase; Provisional 84.32
PRK12842574 putative succinate dehydrogenase; Reviewed 84.07
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 83.98
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 83.98
COG2081408 Predicted flavoproteins [General function predicti 83.93
PRK12839572 hypothetical protein; Provisional 83.44
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 83.42
PRK14727479 putative mercuric reductase; Provisional 83.35
PTZ00318424 NADH dehydrogenase-like protein; Provisional 83.33
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 83.25
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 82.54
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 82.38
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 82.3
PLN02815 594 L-aspartate oxidase 82.29
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 82.22
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 82.19
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 82.15
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 82.08
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 81.96
PRK13748561 putative mercuric reductase; Provisional 81.77
PRK07804541 L-aspartate oxidase; Provisional 81.65
PRK07121492 hypothetical protein; Validated 81.5
PF01134392 GIDA: Glucose inhibited division protein A; InterP 81.24
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 80.9
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 80.79
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 80.79
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 80.77
PRK06292460 dihydrolipoamide dehydrogenase; Validated 80.62
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 80.59
TIGR00275400 flavoprotein, HI0933 family. The model when search 80.51
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 80.44
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 80.38
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 80.34
PRK14694468 putative mercuric reductase; Provisional 80.33
PRK09564444 coenzyme A disulfide reductase; Reviewed 80.14
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 80.14
>PLN02487 zeta-carotene desaturase Back     alignment and domain information 
Probab=99.87  E-value=6.2e-22  Score=169.75  Aligned_cols=108  Identities=77%  Similarity=1.178  Sum_probs=101.0

Q ss_pred             CCCCHHHHHHHHHHHHHHhCCCCCCCCeeEEEEEEeCCccccCCCCCCCCCCCCCCCCCCEEEccccccCCCCCcHHHHH
Q 033121            1 MPLPNDEIIRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGAS   80 (126)
Q Consensus         1 ~~~sdeel~~~vl~~L~~~fp~~~~~~~~~~~v~r~~~a~~~~~pG~~~~rp~~~tp~~~L~lAGd~t~~~~patmeGAv   80 (126)
                      +.+++++|+++++++|.++||.+....+.+++++++++++|.+.||....||..+||++|||+|||||++.||+|||||+
T Consensus       460 ~~~~~~ei~~~~~~~L~~~~p~~~~~~v~~~~vv~~~~at~~~~pg~~~~RP~~~T~~~nl~LAGD~t~~~yPat~EgAv  539 (569)
T PLN02487        460 MPLSNDKIVEKVHKQVLELFPSSRGLEVTWSSVVKIGQSLYREAPGMDPFRPDQKTPISNFFLAGSYTKQDYIDSMEGAT  539 (569)
T ss_pred             cCCCHHHHHHHHHHHHHHhCcccccCceEEEEEEEccCceeccCCCccccCCCCCCCCCCEEEeCcccccCCcchHHHHH
Confidence            46899999999999999999987656788999999999999999999888999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhHHHHHHHHHHhh
Q 033121           81 LSGRQASAYICNAREELVALRKQLAAFE  108 (126)
Q Consensus        81 ~SG~~AA~~Il~~~~~~~~~~~~~~~~~  108 (126)
                      +||++||+.|++..+.+..+++++...+
T Consensus       540 ~SG~~AA~~i~~~~~~~~~~~~~~~~~~  567 (569)
T PLN02487        540 LSGRQAAAYICEAGEELAGLRKKLAAEE  567 (569)
T ss_pred             HHHHHHHHHHHHHhhhhhhhhhhhhccc
Confidence            9999999999999999999999987653

>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 6e-05
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 8e-05
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 4e-04
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 5e-04
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
 Score = 40.0 bits (94), Expect = 6e-05
 Identities = 15/93 (16%), Positives = 35/93 (37%), Gaps = 11/93 (11%)

Query: 1   MPLPNDEI---IRRVAKQVLALFPSSQGLEVIWSSVVKIGQSLYHEGPGKDPFRPDQKTQ 57
           M L N  +   I +  +++L +FP     E + + V + G  +     G        +  
Sbjct: 319 MALKNGNVKKAIEKGWEELLEIFP---EGEPLLAQVYRDGNPVNRTRAG-----LHIEWP 370

Query: 58  VKNLFLAGSYTKQDYIDIMEGASLSGRQASAYI 90
           +  + + G   +      ++G +L   +A   +
Sbjct: 371 LNEVLVVGDGYRPPGGIEVDGIALGVMKALEKL 403
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
2e1m_C181 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 99.58
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 99.5
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 99.5
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 99.48
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 99.46
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 99.43
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 99.42
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 99.41
4gut_A776 Lysine-specific histone demethylase 1B; histone de 99.4
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.32
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 99.31
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 99.25
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 99.23
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 99.21
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.18
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 99.15
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 99.14
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.95
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.95
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.92
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.88
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.77
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.65
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.64
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 98.12
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 98.07
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.83
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 96.88
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 95.84
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 95.72
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 95.58
3r9u_A315 Thioredoxin reductase; structural genomics, center 95.2
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 95.2
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 94.77
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 94.33
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 94.25
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 94.24
4fk1_A304 Putative thioredoxin reductase; structural genomic 94.21
2cul_A232 Glucose-inhibited division protein A-related PROT 94.21
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 94.16
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 93.94
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 93.8
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 93.8
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 93.78
2ywl_A180 Thioredoxin reductase related protein; uncharacter 93.69
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 93.66
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 93.51
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 93.49
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 93.17
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 92.7
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 92.7
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 92.64
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 92.47
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 92.34
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 91.57
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 91.39
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 91.16
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 90.73
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 90.35
2gqf_A401 Hypothetical protein HI0933; structural genomics, 89.74
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 89.28
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 89.22
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 89.22
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 88.49
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 88.35
4dna_A463 Probable glutathione reductase; structural genomic 87.96
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 87.93
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 87.76
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 87.73
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 87.04
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 86.72
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 86.63
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 86.59
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 86.53
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 86.46
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 86.45
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 86.34
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 86.09
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 86.03
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 85.95
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 85.76
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 85.42
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 85.42
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 85.07
1fec_A 490 Trypanothione reductase; redox-active center, oxid 85.03
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 84.99
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 84.78
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 84.73
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 84.6
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 84.5
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 84.3
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 84.16
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 83.64
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 83.53
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 83.45
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 83.36
1ojt_A482 Surface protein; redox-active center, glycolysis, 83.3
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 83.21
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 82.87
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 82.75
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 82.71
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 82.5
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 82.41
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 82.38
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 82.27
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 82.14
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 81.87
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 81.77
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 81.45
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 81.27
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 81.24
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 81.22
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 80.98
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 80.75
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 80.74
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 80.66
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 80.18
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 80.14
>2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
Probab=99.58  E-value=2e-16  Score=116.76  Aligned_cols=93  Identities=12%  Similarity=0.032  Sum_probs=73.3

Q ss_pred             CCCHHHHHHHHHHHHHHhCCCCCCCCeeEE--EEEEeCC-----ccccC-CCCCC-CCCCCCCCCCCCEEEccccccCCC
Q 033121            2 PLPNDEIIRRVAKQVLALFPSSQGLEVIWS--SVVKIGQ-----SLYHE-GPGKD-PFRPDQKTQVKNLFLAGSYTKQDY   72 (126)
Q Consensus         2 ~~sdeel~~~vl~~L~~~fp~~~~~~~~~~--~v~r~~~-----a~~~~-~pG~~-~~rp~~~tp~~~L~lAGd~t~~~~   72 (126)
                      .++++++++.++++|+++|+... ..+..+  .+++|..     +.|++ .||.. ..++.++.|.++||||||+|+. |
T Consensus        53 ~l~~~e~~~~~l~~L~~~~g~~~-~~~~~~~~~~~~W~~dp~~~Ga~s~~~pg~~~~~~~~l~~p~grl~FAGe~ts~-~  130 (181)
T 2e1m_C           53 SFDDAERYGYALENLQSVHGRRI-EVFYTGAGQTQSWLRDPYACGEAAVYTPHQMTAFHLDVVRPEGPVYFAGEHVSL-K  130 (181)
T ss_dssp             TSCTTTTHHHHHHHHHHHHCGGG-GGTEEEEEEEEESSSCTTTSSSEECCCTTHHHHHHHHHHSCBTTEEECSGGGTT-S
T ss_pred             cCCHHHHHHHHHHHHHHHhCCCc-HhhccCcceecccCCCCCCCCcccCcCCCchHHHHHHHhCCCCcEEEEEHHHcC-C
Confidence            46889999999999999994332 345567  8899965     44443 56643 2345667788999999999996 9


Q ss_pred             CCcHHHHHHHHHHHHHHHHHHHhh
Q 033121           73 IDIMEGASLSGRQASAYICNAREE   96 (126)
Q Consensus        73 patmeGAv~SG~~AA~~Il~~~~~   96 (126)
                      +++||||+.||++||++|++.+..
T Consensus       131 ~g~~eGAl~SG~raA~~i~~~l~~  154 (181)
T 2e1m_C          131 HAWIEGAVETAVRAAIAVNEAPVG  154 (181)
T ss_dssp             TTSHHHHHHHHHHHHHHHHTCCC-
T ss_pred             ccCHHHHHHHHHHHHHHHHHHhcc
Confidence            999999999999999999987654
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 126
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 9e-12
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 9e-05
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 58.4 bits (139), Expect = 9e-12
 Identities = 15/64 (23%), Positives = 25/64 (39%)

Query: 30  WSSVVKIGQSLYHEGPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGASLSGRQASAY 89
            +        L  +     P  P     +  LF AG +T ++Y   + GA LSG + +  
Sbjct: 383 AAGSSGNDYDLMAQPITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGR 442

Query: 90  ICNA 93
           I + 
Sbjct: 443 IADQ 446
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 99.38
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.66
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.91
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.89
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.63
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 96.07
d2v5za2112 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 95.94
d2ivda2108 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.93
d2dw4a3109 Lysine-specific histone demethylase 1, LSD1 {Human 95.89
d1b5qa2112 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.8
d1seza2112 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.55
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.58
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 93.71
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 93.51
d2iida2113 L-aminoacid oxidase {Malayan pit viper (Calloselas 93.11
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.08
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.91
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.88
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 92.22
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 92.06
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 91.36
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.32
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 90.84
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 90.1
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.99
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 89.48
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 87.93
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 87.93
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 86.77
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 86.38
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 85.77
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 84.75
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 84.36
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 83.28
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 83.16
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Lysine-specific histone demethylase 1, LSD1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.38  E-value=1.8e-13  Score=98.46  Aligned_cols=51  Identities=27%  Similarity=0.384  Sum_probs=38.3

Q ss_pred             CCCCCCCCCCCCCCCCCEEEccccccCCCCCcHHHHHHHHHHHHHHHHHHH
Q 033121           44 GPGKDPFRPDQKTQVKNLFLAGSYTKQDYIDIMEGASLSGRQASAYICNAR   94 (126)
Q Consensus        44 ~pG~~~~rp~~~tp~~~L~lAGd~t~~~~patmeGAv~SG~~AA~~Il~~~   94 (126)
                      +++....+|..++|++|||||||+|+..||++||||+.||++||++|++.+
T Consensus       397 p~~~~~~~~~~~~~~~~l~fAGe~t~~~~~g~~~GA~~SG~~aA~~Il~~~  447 (449)
T d2dw4a2         397 PITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQF  447 (449)
T ss_dssp             CBCC---------CCCCEEECSGGGCTTSCSSHHHHHHHHHHHHHHHHHHH
T ss_pred             CccccccchhhcCCCCCEEEEcCCcCCCCceehHHHHHHHHHHHHHHHHHh
Confidence            334455678889999999999999999999999999999999999999875
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure