Citrus Sinensis ID: 033182


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKILEFDPSNNQAKRTILRLQPLAEEKLEKMKEEMIGKLGNDFLLRFHFLLIKKL
cccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccc
cHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHccHcEEEEEcc
maelrsichsnrgicflklGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKIlefdpsnnqaKRTILRLQPLAEEKLEKMKEEMIGKLGNDFLLRFHFLLIKKL
maelrsichsnrgicflklGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKILEfdpsnnqakrtILRLQPLAEEKLEKMKEEMIGKLGNDFLLRFHFLLIKKL
MAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKILEFDPSNNQAKRTILRLQPLAeeklekmkeemigklgNDFLLRFHFLLIKKL
******ICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKILEFDP*******TILRL*************EMIGKLGNDFLLRFHFLLI***
*AELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKILEFDPSNNQAKRT*************************DFLLRFHFLLIKK*
MAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKILEFDPSNNQAKRTILRLQPLAEEKLEKMKEEMIGKLGNDFLLRFHFLLIKKL
MAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKILEFDPSNNQAKRTILRLQPLAEEKLEKMKEEMIGKLGNDFLLRFHFLLIKKL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKILEFDPSNNQAKRTILRLQPLAEEKLEKMKEEMIGKLGNDFLLRFHFLLIKKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
Q91Z38292 Tetratricopeptide repeat yes no 0.848 0.363 0.431 4e-17
Q99614292 Tetratricopeptide repeat yes no 0.848 0.363 0.439 2e-16
Q3ZBR5292 Tetratricopeptide repeat yes no 0.848 0.363 0.431 3e-16
Q15785309 Mitochondrial import rece no no 0.616 0.249 0.357 3e-10
A4K2V0309 Mitochondrial import rece no no 0.616 0.249 0.357 3e-10
O94826 608 Mitochondrial import rece no no 0.512 0.105 0.453 7e-10
Q9CZW5 611 Mitochondrial import rece no no 0.512 0.104 0.453 8e-10
Q75Q39 610 Mitochondrial import rece no no 0.512 0.104 0.453 8e-10
Q84JR9682 TPR repeat-containing thi no no 0.72 0.131 0.319 9e-10
Q07617 926 Sperm-associated antigen no no 0.784 0.105 0.363 8e-09
>sp|Q91Z38|TTC1_MOUSE Tetratricopeptide repeat protein 1 OS=Mus musculus GN=Ttc1 PE=2 SV=1 Back     alignment and function desciption
 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 73/116 (62%), Gaps = 10/116 (8%)

Query: 5   RSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQ 64
           RS+  SNR    +K  K E +I +C+KA++LNPTY++A++RRAE +EK +  +EA+    
Sbjct: 154 RSVLFSNRAAARMKQDKKETAITDCSKAIQLNPTYIRAILRRAELYEKTDKLDEALEDY- 212

Query: 65  DLMIVMKKILEFDPSNNQAKRTILRLQPLAEEKLEKMKEEMIGK---LGNDFLLRF 117
                 K +LE DPS +QA+   +RL    EE+ E++KEEM+GK   LGN  L  F
Sbjct: 213 ------KSVLEKDPSVHQAREACMRLPKQIEERNERLKEEMLGKLKDLGNLVLRPF 262





Mus musculus (taxid: 10090)
>sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens GN=TTC1 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBR5|TTC1_BOVIN Tetratricopeptide repeat protein 1 OS=Bos taurus GN=TTC1 PE=2 SV=1 Back     alignment and function description
>sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens GN=TOMM34 PE=1 SV=2 Back     alignment and function description
>sp|A4K2V0|TOM34_PONAB Mitochondrial import receptor subunit TOM34 OS=Pongo abelii GN=TOMM34 PE=2 SV=1 Back     alignment and function description
>sp|O94826|TOM70_HUMAN Mitochondrial import receptor subunit TOM70 OS=Homo sapiens GN=TOMM70A PE=1 SV=1 Back     alignment and function description
>sp|Q9CZW5|TOM70_MOUSE Mitochondrial import receptor subunit TOM70 OS=Mus musculus GN=Tomm70a PE=1 SV=2 Back     alignment and function description
>sp|Q75Q39|TOM70_RAT Mitochondrial import receptor subunit TOM70 OS=Rattus norvegicus GN=Tomm70a PE=1 SV=1 Back     alignment and function description
>sp|Q84JR9|TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana GN=TTL4 PE=2 SV=1 Back     alignment and function description
>sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens GN=SPAG1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
224142329 278 predicted protein [Populus trichocarpa] 0.864 0.388 0.754 1e-42
224091857188 predicted protein [Populus trichocarpa] 0.864 0.574 0.728 8e-41
125532422 344 hypothetical protein OsI_34095 [Oryza sa 0.864 0.313 0.686 1e-39
18087888 548 putative tetratricopeptide repeat protei 0.864 0.197 0.686 1e-39
222613040 344 hypothetical protein OsJ_31954 [Oryza sa 0.864 0.313 0.686 1e-39
115482622 236 Os10g0486900 [Oryza sativa Japonica Grou 0.864 0.457 0.686 2e-39
255585483 253 heat shock protein 70 (HSP70)-interactin 0.864 0.426 0.720 3e-39
211853238 261 tetratricopeptide repeat protein [Solanu 0.864 0.413 0.694 9e-39
359806795 268 uncharacterized protein LOC100808386 [Gl 0.864 0.402 0.703 9e-39
357159759 229 PREDICTED: tetratricopeptide repeat prot 0.864 0.471 0.686 1e-38
>gi|224142329|ref|XP_002324511.1| predicted protein [Populus trichocarpa] gi|222865945|gb|EEF03076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 97/118 (82%), Gaps = 10/118 (8%)

Query: 3   ELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAG 62
           ELRSICHSNRG+CFLKLGKFE++IKEC+KALELNP+YMKAL+RR EAHEKLEHFEEAIA 
Sbjct: 144 ELRSICHSNRGVCFLKLGKFEDTIKECSKALELNPSYMKALVRRGEAHEKLEHFEEAIAD 203

Query: 63  IQDLMIVMKKILEFDPSNNQAKRTILRLQPLAEEKLEKMKEEMIGKL---GNDFLLRF 117
                  MKKILE DPSN+QAKRTI RL+PLA  K EKM EEMIGKL   GN  L RF
Sbjct: 204 -------MKKILELDPSNDQAKRTIRRLEPLAAAKREKMNEEMIGKLKDMGNTLLGRF 254




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224091857|ref|XP_002309374.1| predicted protein [Populus trichocarpa] gi|222855350|gb|EEE92897.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|125532422|gb|EAY78987.1| hypothetical protein OsI_34095 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|18087888|gb|AAL59042.1|AC087182_25 putative tetratricopeptide repeat protein [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|222613040|gb|EEE51172.1| hypothetical protein OsJ_31954 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|115482622|ref|NP_001064904.1| Os10g0486900 [Oryza sativa Japonica Group] gi|110289293|gb|AAP54357.2| TPR Domain containing protein, expressed [Oryza sativa Japonica Group] gi|113639513|dbj|BAF26818.1| Os10g0486900 [Oryza sativa Japonica Group] gi|215686667|dbj|BAG88920.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|255585483|ref|XP_002533434.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223526722|gb|EEF28954.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|211853238|emb|CAP16663.1| tetratricopeptide repeat protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|359806795|ref|NP_001241306.1| uncharacterized protein LOC100808386 [Glycine max] gi|255639737|gb|ACU20162.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357159759|ref|XP_003578550.1| PREDICTED: tetratricopeptide repeat protein 1-like [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
TAIR|locus:2118776277 TPR1 "tetratricopeptide repeat 0.68 0.306 0.739 3e-30
UNIPROTKB|B6GVA2261 int106 "Tetratricopeptide repe 0.68 0.325 0.695 2.7e-29
MGI|MGI:1914077292 Ttc1 "tetratricopeptide repeat 0.632 0.270 0.430 7.6e-13
RGD|1359604292 Ttc1 "tetratricopeptide repeat 0.632 0.270 0.441 7.6e-13
UNIPROTKB|E1BWM0296 TTC1 "Uncharacterized protein" 0.632 0.266 0.441 8.1e-13
UNIPROTKB|Q99614292 TTC1 "Tetratricopeptide repeat 0.632 0.270 0.441 1.3e-12
UNIPROTKB|F1RR38292 TTC1 "Uncharacterized protein" 0.632 0.270 0.441 1.7e-12
UNIPROTKB|Q3ZBR5292 TTC1 "Tetratricopeptide repeat 0.632 0.270 0.430 2.2e-12
ZFIN|ZDB-GENE-041114-80330 ttc1 "tetratricopeptide repeat 0.632 0.239 0.406 4.6e-10
UNIPROTKB|Q15785309 TOMM34 "Mitochondrial import r 0.616 0.249 0.357 5e-10
TAIR|locus:2118776 TPR1 "tetratricopeptide repeat 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 334 (122.6 bits), Expect = 3.0e-30, P = 3.0e-30
 Identities = 68/92 (73%), Positives = 78/92 (84%)

Query:     3 ELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAG 62
             ELRSIC+ NRG+CFLKLGK EE+IKECTKALELNPTY KAL+RRAEAHEKLEHFE+A+  
Sbjct:   143 ELRSICYLNRGVCFLKLGKCEETIKECTKALELNPTYNKALVRRAEAHEKLEHFEDAVT- 201

Query:    63 IQDLMIVMKKILEFDPSNNQAKRTILRLQPLA 94
               DL    KKILE DPSN+QA++ I RL+PLA
Sbjct:   202 --DL----KKILELDPSNDQARKGIRRLEPLA 227




GO:0005634 "nucleus" evidence=ISM
GO:0005737 "cytoplasm" evidence=ISM
GO:0051879 "Hsp90 protein binding" evidence=IPI
UNIPROTKB|B6GVA2 int106 "Tetratricopeptide repeat protein" [Solanum lycopersicum (taxid:4081)] Back     alignment and assigned GO terms
MGI|MGI:1914077 Ttc1 "tetratricopeptide repeat domain 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1359604 Ttc1 "tetratricopeptide repeat domain 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWM0 TTC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q99614 TTC1 "Tetratricopeptide repeat protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR38 TTC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBR5 TTC1 "Tetratricopeptide repeat protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041114-80 ttc1 "tetratricopeptide repeat domain 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q15785 TOMM34 "Mitochondrial import receptor subunit TOM34" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-09
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-09
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 9e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-08
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 2e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 5e-06
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 4e-05
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 7e-05
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 1e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 5e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 0.001
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)- [FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 51.2 bits (123), Expect = 1e-09
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 6  SICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIA 61
          +  + N    + KLGK+EE++++  KALEL+P   KA      A+ KL  +EEA+ 
Sbjct: 34 ADAYYNLAAAYYKLGKYEEALEDYEKALELDPDNAKAYYNLGLAYYKLGKYEEALE 89


Length = 100

>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)- [FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
KOG4234271 consensus TPR repeat-containing protein [General f 99.78
KOG0553304 consensus TPR repeat-containing protein [General f 99.67
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.6
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.56
PRK15359144 type III secretion system chaperone protein SscB; 99.52
PRK15359144 type III secretion system chaperone protein SscB; 99.46
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.43
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.41
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.4
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.37
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.36
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.34
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.33
PRK11189 296 lipoprotein NlpI; Provisional 99.33
PRK10370198 formate-dependent nitrite reductase complex subuni 99.26
PF1337173 TPR_9: Tetratricopeptide repeat 99.24
KOG0553 304 consensus TPR repeat-containing protein [General f 99.23
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.23
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.23
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.21
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.2
PRK11189296 lipoprotein NlpI; Provisional 99.19
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.19
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.18
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.14
PRK12370 553 invasion protein regulator; Provisional 99.11
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.11
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.11
COG3063 250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.09
KOG1126638 consensus DNA-binding cell division cycle control 99.09
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 99.09
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.08
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.07
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.05
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.04
PRK12370 553 invasion protein regulator; Provisional 99.04
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.03
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.03
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.02
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.0
KOG0547 606 consensus Translocase of outer mitochondrial membr 98.97
PRK10370198 formate-dependent nitrite reductase complex subuni 98.97
KOG0547606 consensus Translocase of outer mitochondrial membr 98.96
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.95
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.93
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.92
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.91
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.91
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.9
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.89
PRK15331165 chaperone protein SicA; Provisional 98.89
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.88
PRK15331165 chaperone protein SicA; Provisional 98.87
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.85
KOG1126638 consensus DNA-binding cell division cycle control 98.85
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.85
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.85
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 98.84
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.83
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.82
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.82
PF12688120 TPR_5: Tetratrico peptide repeat 98.8
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.79
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.78
KOG1125579 consensus TPR repeat-containing protein [General f 98.78
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.78
PLN02789 320 farnesyltranstransferase 98.75
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 98.74
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.74
KOG1125579 consensus TPR repeat-containing protein [General f 98.74
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.74
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.72
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.71
KOG2076 895 consensus RNA polymerase III transcription factor 98.71
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.7
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.69
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.69
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.68
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.67
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.67
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.65
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.64
PRK10803263 tol-pal system protein YbgF; Provisional 98.64
PRK11788389 tetratricopeptide repeat protein; Provisional 98.64
PLN02789320 farnesyltranstransferase 98.63
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.63
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.63
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.63
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.62
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.61
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.59
PF1342844 TPR_14: Tetratricopeptide repeat 98.58
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.58
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.57
PRK11788 389 tetratricopeptide repeat protein; Provisional 98.57
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.54
PRK10803263 tol-pal system protein YbgF; Provisional 98.53
PF1343134 TPR_17: Tetratricopeptide repeat 98.52
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.5
PF1342844 TPR_14: Tetratricopeptide repeat 98.5
KOG2076 895 consensus RNA polymerase III transcription factor 98.49
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.48
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.48
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.44
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.42
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.41
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.41
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.4
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.39
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.38
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.35
KOG4234271 consensus TPR repeat-containing protein [General f 98.35
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.33
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.32
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.32
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.31
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.31
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.3
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.28
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.28
PF13512142 TPR_18: Tetratricopeptide repeat 98.27
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.25
KOG2003 840 consensus TPR repeat-containing protein [General f 98.23
KOG4555175 consensus TPR repeat-containing protein [Function 98.2
PRK11906458 transcriptional regulator; Provisional 98.2
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.19
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.15
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 98.15
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.14
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 98.13
KOG2003 840 consensus TPR repeat-containing protein [General f 98.11
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.11
PRK11906458 transcriptional regulator; Provisional 98.1
KOG4555175 consensus TPR repeat-containing protein [Function 98.1
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 98.1
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.09
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.07
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.06
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.06
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.05
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 98.04
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 98.04
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.01
PF13512142 TPR_18: Tetratricopeptide repeat 98.0
PRK10941269 hypothetical protein; Provisional 97.99
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 97.98
PRK14574 822 hmsH outer membrane protein; Provisional 97.98
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.98
PF12688120 TPR_5: Tetratrico peptide repeat 97.97
PF1337173 TPR_9: Tetratricopeptide repeat 97.97
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.96
PRK14574 822 hmsH outer membrane protein; Provisional 97.95
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.92
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.9
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.89
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.88
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.87
KOG3364149 consensus Membrane protein involved in organellar 97.87
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.86
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.85
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.85
KOG1129478 consensus TPR repeat-containing protein [General f 97.84
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.84
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.79
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.79
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.78
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.78
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.78
PRK10747398 putative protoheme IX biogenesis protein; Provisio 97.77
COG4105 254 ComL DNA uptake lipoprotein [General function pred 97.75
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.73
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 97.72
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.72
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.71
KOG1129478 consensus TPR repeat-containing protein [General f 97.7
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.69
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.66
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.65
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.64
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 97.64
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.63
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.62
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.6
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.58
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.58
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.58
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 97.56
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.56
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.55
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.53
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.52
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.5
COG4976 287 Predicted methyltransferase (contains TPR repeat) 97.47
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.42
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.41
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.41
KOG1310 758 consensus WD40 repeat protein [General function pr 97.37
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 97.24
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.05
PF1343134 TPR_17: Tetratricopeptide repeat 96.96
COG2912269 Uncharacterized conserved protein [Function unknow 96.87
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.8
KOG2471 696 consensus TPR repeat-containing protein [General f 96.73
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.73
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.7
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.67
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.66
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.65
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.64
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.64
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.61
PLN03077 857 Protein ECB2; Provisional 96.58
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.57
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.55
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 96.47
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.38
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.35
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.35
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.31
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.17
COG4700251 Uncharacterized protein conserved in bacteria cont 96.16
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.14
COG3629280 DnrI DNA-binding transcriptional activator of the 96.13
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.03
KOG2376 652 consensus Signal recognition particle, subunit Srp 95.97
COG4700251 Uncharacterized protein conserved in bacteria cont 95.93
COG5191 435 Uncharacterized conserved protein, contains HAT (H 95.91
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.88
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 95.71
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.71
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 95.68
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.68
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.67
KOG4340 459 consensus Uncharacterized conserved protein [Funct 95.65
KOG0495 913 consensus HAT repeat protein [RNA processing and m 95.63
KOG4814 872 consensus Uncharacterized conserved protein [Funct 95.62
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.57
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.57
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.49
KOG4507 886 consensus Uncharacterized conserved protein, conta 95.41
PLN03077857 Protein ECB2; Provisional 95.39
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 95.39
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 95.29
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 95.28
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 95.2
PLN03218 1060 maturation of RBCL 1; Provisional 95.2
COG3947361 Response regulator containing CheY-like receiver a 95.11
KOG3785 557 consensus Uncharacterized conserved protein [Funct 95.11
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.03
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.87
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.8
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.78
COG3071 400 HemY Uncharacterized enzyme of heme biosynthesis [ 94.75
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 94.59
KOG4340 459 consensus Uncharacterized conserved protein [Funct 94.58
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 94.54
KOG1915 677 consensus Cell cycle control protein (crooked neck 94.49
PLN03218 1060 maturation of RBCL 1; Provisional 94.46
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 94.4
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 94.32
COG4455 273 ImpE Protein of avirulence locus involved in tempe 94.16
PF0421269 MIT: MIT (microtubule interacting and transport) d 94.02
PRK04841903 transcriptional regulator MalT; Provisional 93.99
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.73
PRK04841 903 transcriptional regulator MalT; Provisional 93.66
smart0074577 MIT Microtubule Interacting and Trafficking molecu 93.61
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.6
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.42
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 93.41
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 93.38
KOG1310 758 consensus WD40 repeat protein [General function pr 93.21
KOG1586288 consensus Protein required for fusion of vesicles 93.15
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 93.11
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 93.08
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 92.97
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 92.63
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 92.38
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.36
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 92.33
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 92.25
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.21
COG2976207 Uncharacterized protein conserved in bacteria [Fun 92.12
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 91.94
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 91.7
KOG1941 518 consensus Acetylcholine receptor-associated protei 91.59
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 91.58
cd0265675 MIT MIT: domain contained within Microtubule Inter 91.43
PF13281 374 DUF4071: Domain of unknown function (DUF4071) 91.26
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 91.21
KOG1915 677 consensus Cell cycle control protein (crooked neck 91.07
KOG3364149 consensus Membrane protein involved in organellar 90.92
COG3118304 Thioredoxin domain-containing protein [Posttransla 90.87
KOG2610 491 consensus Uncharacterized conserved protein [Funct 90.58
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 90.5
KOG2471 696 consensus TPR repeat-containing protein [General f 90.29
KOG1585 308 consensus Protein required for fusion of vesicles 90.12
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 90.1
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 89.93
KOG1586288 consensus Protein required for fusion of vesicles 89.66
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 89.33
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 89.2
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 89.19
COG2976207 Uncharacterized protein conserved in bacteria [Fun 88.87
PF13281374 DUF4071: Domain of unknown function (DUF4071) 88.86
KOG1585 308 consensus Protein required for fusion of vesicles 88.66
COG4105254 ComL DNA uptake lipoprotein [General function pred 88.37
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 88.34
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 88.09
PF1304150 PPR_2: PPR repeat family 86.31
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 85.82
KOG2300629 consensus Uncharacterized conserved protein [Funct 85.5
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 85.25
PF1286294 Apc5: Anaphase-promoting complex subunit 5 85.15
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 84.71
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 84.14
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.94
KOG0529 421 consensus Protein geranylgeranyltransferase type I 83.92
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 83.63
PF1285434 PPR_1: PPR repeat 83.47
PF09986214 DUF2225: Uncharacterized protein conserved in bact 83.04
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 82.84
PRK10941269 hypothetical protein; Provisional 82.81
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 81.82
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 81.65
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 81.45
KOG4814 872 consensus Uncharacterized conserved protein [Funct 81.43
COG3947361 Response regulator containing CheY-like receiver a 81.24
KOG2581 493 consensus 26S proteasome regulatory complex, subun 80.81
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 80.7
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 80.54
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 80.02
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
Probab=99.78  E-value=3.2e-18  Score=118.95  Aligned_cols=113  Identities=55%  Similarity=0.747  Sum_probs=109.5

Q ss_pred             hHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHchhHHHHHHhHHHHHHHHHHHHhhCCCcHH
Q 033182            3 ELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKILEFDPSNNQ   82 (125)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~l~p~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~a~~l~p~~~~   82 (125)
                      ..++.+|.|+|.|+++++.++.|+.++.++|.++|.+-+++.+++.+|.++.+|++|+.+       |+++++.+|+..+
T Consensus       131 e~rsIly~Nraaa~iKl~k~e~aI~dcsKaiel~pty~kAl~RRAeayek~ek~eealeD-------yKki~E~dPs~~e  203 (271)
T KOG4234|consen  131 EERSILYSNRAAALIKLRKWESAIEDCSKAIELNPTYEKALERRAEAYEKMEKYEEALED-------YKKILESDPSRRE  203 (271)
T ss_pred             HHHHHHHhhhHHHHHHhhhHHHHHHHHHhhHhcCchhHHHHHHHHHHHHhhhhHHHHHHH-------HHHHHHhCcchHH
Confidence            568999999999999999999999999999999999999999999999999999999999       9999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhh---hhhhhhHHHHHhh
Q 033182           83 AKRTILRLQPLAEEKLEKMKEEMIGKL---GNDFLLRFHFLLI  122 (125)
Q Consensus        83 ~~~~l~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~  122 (125)
                      +...+.++-..+.++.++.+..++.++   ||.+++.||||+.
T Consensus       204 ar~~i~rl~~~i~ernEkmKee~m~kLKdlGN~iL~pFGlStd  246 (271)
T KOG4234|consen  204 AREAIARLPPKINERNEKMKEEMMEKLKDLGNFILSPFGLSTD  246 (271)
T ss_pred             HHHHHHhcCHHHHHHHHHHHHHHHHHHHHhhhhhccccccccc
Confidence            999999999999999999999999998   9999999999974



>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 3e-08
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 3e-08
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 5e-08
3lca_A 533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 1e-07
3fp2_A 537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 1e-07
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 2e-07
2gw1_A 514 Crystal Structure Of The Yeast Tom70 Length = 514 2e-07
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 3e-07
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-07
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 6e-07
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 2e-06
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 6e-06
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 8e-06
2c2l_A 281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 9e-06
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 1e-05
3upv_A126 Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 2e-05
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 2e-05
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 3e-05
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 3e-05
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 5e-05
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 7e-05
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-04
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 3e-04
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure

Iteration: 1

Score = 53.5 bits (127), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 28/77 (36%), Positives = 43/77 (55%), Gaps = 7/77 (9%) Query: 11 NRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVM 70 N G + K G ++++I+ KALEL+P KA RR A+ K +++AI Q Sbjct: 48 NLGNAYYKQGDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQ------ 101 Query: 71 KKILEFDPSNNQAKRTI 87 K LE DP+N +AK+ + Sbjct: 102 -KALELDPNNAKAKQNL 117
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|2GW1|A Chain A, Crystal Structure Of The Yeast Tom70 Length = 514 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 1e-28
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-24
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-24
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 4e-24
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-24
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 7e-24
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 7e-24
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 9e-24
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-23
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-23
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-22
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 7e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-21
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-17
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-14
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-12
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-11
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-10
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-08
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 3e-21
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-20
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-20
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-17
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-13
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-12
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-12
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-09
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-08
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-19
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 5e-19
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-18
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 2e-13
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 4e-13
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 3e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-07
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 8e-18
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-17
2gw1_A 514 Mitochondrial precursor proteins import receptor; 8e-13
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-12
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-11
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-10
2gw1_A 514 Mitochondrial precursor proteins import receptor; 8e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-07
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-05
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-05
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-17
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-12
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-11
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-11
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-07
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-06
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 7e-15
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 7e-10
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-14
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-13
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-11
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 1e-13
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 9e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-12
3u4t_A 272 TPR repeat-containing protein; structural genomics 3e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-09
3u4t_A 272 TPR repeat-containing protein; structural genomics 2e-09
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-08
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-12
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-12
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-11
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-11
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-11
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-10
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-12
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 5e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 5e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 4e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-12
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-12
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-11
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-11
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-08
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 4e-12
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 6e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-12
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-11
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-12
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 1e-11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 6e-11
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 8e-12
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-08
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-10
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-07
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-11
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-10
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-10
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-09
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 3e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-07
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-06
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 3e-11
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-10
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 1e-09
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-09
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 3e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-10
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-11
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 8e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-11
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 7e-06
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-05
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-11
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 6e-06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 4e-11
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-11
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-10
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-09
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-07
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-06
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-05
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-05
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-04
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-10
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-10
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-08
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-07
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-07
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 5e-06
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 1e-04
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 3e-10
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 7e-10
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-07
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-05
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-08
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-10
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 5e-10
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-07
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-09
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-09
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-08
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 8e-07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-05
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 8e-09
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 9e-08
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 3e-06
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 1e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 6e-07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 4e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 4e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-04
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-04
4g1t_A 472 Interferon-induced protein with tetratricopeptide 4e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-04
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
 Score =  100 bits (252), Expect = 1e-28
 Identities = 25/89 (28%), Positives = 49/89 (55%), Gaps = 7/89 (7%)

Query: 3   ELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAG 62
           + +++ H NR  C LKL  ++++  E +KA+E +   +KAL RR++A EKL   ++A   
Sbjct: 62  QDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVKALYRRSQALEKLGRLDQA--- 118

Query: 63  IQDLMIVMKKILEFDPSNNQAKRTILRLQ 91
           + DL    ++ +  +P N   +  +  + 
Sbjct: 119 VLDL----QRCVSLEPKNKVFQEALRNIS 143


>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.77
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.71
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.7
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.66
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.64
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.63
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.62
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.61
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.6
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.58
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.58
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.58
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.57
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.56
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.55
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.55
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.55
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.54
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.54
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.54
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.54
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.53
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.53
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.53
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.53
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.53
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.53
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.52
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.52
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.52
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.51
3k9i_A117 BH0479 protein; putative protein binding protein, 99.5
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.5
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.48
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.48
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.46
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.46
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.46
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.46
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.45
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.44
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.44
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.44
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.44
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.43
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.43
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.43
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.43
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.42
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.41
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.41
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.41
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.4
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.4
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.39
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.38
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.38
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 99.38
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.37
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.37
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.36
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.36
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.35
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.35
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.35
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.34
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.34
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.34
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.34
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.33
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.32
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.32
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.32
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.29
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.29
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.28
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 99.28
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.27
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.26
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.26
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.26
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.26
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.26
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.26
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 99.24
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.24
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.24
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.24
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.23
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.23
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.23
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.21
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.21
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.2
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.2
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.2
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.19
3k9i_A117 BH0479 protein; putative protein binding protein, 99.19
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.19
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.19
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.18
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.18
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.18
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.18
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.17
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.17
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.17
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 99.17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.17
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.16
3u4t_A272 TPR repeat-containing protein; structural genomics 99.16
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.15
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.15
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.15
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.14
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.14
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.14
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.13
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.13
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.13
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.12
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.12
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.11
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.11
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.1
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.1
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.09
3u4t_A 272 TPR repeat-containing protein; structural genomics 99.09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.06
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.04
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.03
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.02
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.99
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.98
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 98.98
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 98.96
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.92
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.92
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.91
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 98.9
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.88
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.82
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.81
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.8
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.76
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.75
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.75
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.75
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.75
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.74
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 98.74
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.73
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.72
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.72
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.72
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.71
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.71
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.7
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.69
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.69
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.68
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.67
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.66
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.66
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.65
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.65
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.65
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.65
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 98.64
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 98.64
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.63
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.62
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.61
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.61
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.59
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.58
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.58
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.57
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.56
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.55
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.53
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.53
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.52
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 98.5
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.5
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.46
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.44
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.4
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.37
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.35
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.31
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.27
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.24
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.21
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.09
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.06
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.04
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.0
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.95
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.87
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.86
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.86
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.81
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.78
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.78
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.71
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.71
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.68
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.66
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.58
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.56
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.5
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.46
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.45
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.4
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 97.33
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.16
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.01
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.93
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 96.89
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.87
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 96.77
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.52
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.43
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.28
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 95.93
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 95.57
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 94.66
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 94.4
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 94.33
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 93.59
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 93.36
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.3
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 92.63
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 92.47
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 92.04
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 91.79
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 90.82
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 90.3
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 89.33
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 88.55
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 85.99
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 84.72
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 84.71
2cfu_A658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 82.76
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 81.92
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 81.79
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.77  E-value=2e-17  Score=106.28  Aligned_cols=95  Identities=15%  Similarity=0.178  Sum_probs=91.0

Q ss_pred             ChhHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHchhHHHHHHhHHHHHHHHHHHHhhCCCc
Q 033182            1 MAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKILEFDPSN   80 (125)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~l~p~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~a~~l~p~~   80 (125)
                      |+|..+..+.++|..+++.|+|++|+..|++++.++|.++.+|+++|.++..+|++++|+..       |+++++++|++
T Consensus         8 inP~~a~~~~~~G~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~~~~~~A~~~-------~~~al~~~p~~   80 (126)
T 4gco_A            8 INPELAQEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDD-------CDTCIRLDSKF   80 (126)
T ss_dssp             CCHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHH-------HHHHHHHCTTC
T ss_pred             HCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHhhHHHhhccHHHHHHH-------HHHHHHhhhhh
Confidence            67999999999999999999999999999999999999999999999999999999999999       99999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q 033182           81 NQAKRTILRLQPLAEEKLEKMK  102 (125)
Q Consensus        81 ~~~~~~l~~~~~~~~~~~~~~~  102 (125)
                      ..++..++.++..+++..++..
T Consensus        81 ~~a~~~lg~~~~~~~~~~~A~~  102 (126)
T 4gco_A           81 IKGYIRKAACLVAMREWSKAQR  102 (126)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHH
T ss_pred             hHHHHHHHHHHHHCCCHHHHHH
Confidence            9999999999999988876665



>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 125
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 5e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-07
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-06
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 8e-07
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-05
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 6e-06
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-04
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.003
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 2e-04
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 3e-04
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 0.002
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 6e-04
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 0.004
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: BTAD-like
domain: Probable regulatory protein EmbR, middle domain
species: Mycobacterium tuberculosis [TaxId: 1773]
 Score = 46.8 bits (110), Expect = 5e-08
 Identities = 17/95 (17%), Positives = 33/95 (34%), Gaps = 2/95 (2%)

Query: 1   MAELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAI 60
           + E + + H+ +    +  G+    I E       +P       +   A+   +   +A+
Sbjct: 62  LVEDKVLAHTAKAEAEIACGRASAVIAELEALTFEHPYREPLWTQLITAYYLSDRQSDAL 121

Query: 61  AGIQDLMIVMKKILEFDPSN--NQAKRTILRLQPL 93
              + +   +   L  DP          ILR QPL
Sbjct: 122 GAYRRVKTTLADDLGIDPGPTLRALNERILRQQPL 156


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.72
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.71
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.71
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.66
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.63
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.62
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.61
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.57
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.55
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.53
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.52
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.51
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.49
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.45
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.41
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.36
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.35
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.33
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.33
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.32
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.31
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.28
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.26
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.26
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.25
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.22
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.16
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.13
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.13
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.07
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 99.02
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.94
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.9
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.8
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.66
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.65
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.65
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.51
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.27
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 98.27
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.14
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.11
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.97
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.85
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.81
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.64
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.04
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.7
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 96.42
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.04
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 93.31
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 91.78
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 87.29
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 86.33
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 80.24
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Cyclophilin 40
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.74  E-value=4e-17  Score=108.01  Aligned_cols=93  Identities=28%  Similarity=0.555  Sum_probs=87.6

Q ss_pred             hhHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHhcCCCChHHHHHHHHHHHHchhHHHHHHhHHHHHHHHHHHHhhCCCcH
Q 033182            2 AELRSICHSNRGICFLKLGKFEESIKECTKALELNPTYMKALIRRAEAHEKLEHFEEAIAGIQDLMIVMKKILEFDPSNN   81 (125)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~l~p~~~~~~~~~~~~~~~~~~~~~A~~~~~~~~~~~~~a~~l~p~~~   81 (125)
                      +|....+|.|+|.||+++|+|++|+..|+++++++|+++.+|+++|.++..+|++++|+..       |+++++++|++.
T Consensus        73 ~~~~~~~~~nla~~~~~~~~~~~Ai~~~~~al~~~p~~~~a~~~~g~~~~~l~~~~~A~~~-------~~~al~l~p~n~  145 (169)
T d1ihga1          73 QPVALSCVLNIGACKLKMSDWQGAVDSCLEALEIDPSNTKALYRRAQGWQGLKEYDQALAD-------LKKAQEIAPEDK  145 (169)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTTCHHHHHHH-------HHHHHHHCTTCH
T ss_pred             ChhhHHHHHHHHHHHHhhcccchhhhhhhhhhhhhhhhhhHHHhHHHHHHHccCHHHHHHH-------HHHHHHhCCCCH
Confidence            5778899999999999999999999999999999999999999999999999999999999       999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 033182           82 QAKRTILRLQPLAEEKLEKM  101 (125)
Q Consensus        82 ~~~~~l~~~~~~~~~~~~~~  101 (125)
                      .+...+..+...+....+.+
T Consensus       146 ~~~~~l~~~~~~l~~~~~~~  165 (169)
T d1ihga1         146 AIQAELLKVKQKIKAQKDKE  165 (169)
T ss_dssp             HHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            99999999988887666554



>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure