Citrus Sinensis ID: 033271

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTRNWESAEWYMNASLFTPFQQLESLDLSLNNIAGCVENEGP
cccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccccccccccEEEccccccEEEEEccccccccccccccccccccccccccEEEccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccccccccccEEEcccccEEEEEEccccccccccccccccHHHccHHHHHHccccccccccccccccc
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQLKhffnddhclqnwvddenysdccqwegvecndtTGRVIELDLALTRNWESAEWYMnaslftpfqqlESLDLSLNNIagcvenegp
mcgskrvwVSELIFILLVVKGWWSEGCLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTRNWESAEWYMNASLFTPFQQLESLDLSLNNIAGCVENEGP
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTRNWESAEWYMNASLFTPFQQLESLDLSLNNIAGCVENEGP
*****RVWVSELIFILLVVKGWWSEGCLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTRNWESAEWYMNASLFTPFQQLESLDLSLNNIAGCV*****
*****RV*VSELIFILLVVKGWWSEGCLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTRNWE**EWYMNASLFTPFQQLESLDLSLNNIAGCVE****
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTRNWESAEWYMNASLFTPFQQLESLDLSLNNIAGCVENEGP
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTRNWESAEWYMNASLFTPFQQLESLDLSLNNIAG*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTRNWESAEWYMNASLFTPFQQLESLDLSLNNIAGCVENEGP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query123 2.2.26 [Sep-21-2011]
Q9C9H7 847 Receptor-like protein 12 no no 0.918 0.133 0.365 4e-08
Q05091 330 Polygalacturonase inhibit N/A no 0.813 0.303 0.300 6e-06
Q9FN37 1036 Phytosulfokine receptor 2 no no 0.829 0.098 0.333 0.0002
Q9LP24 1120 Probable leucine-rich rep no no 0.674 0.074 0.329 0.0002
Q9LRT1 1016 Probably inactive leucine no no 0.878 0.106 0.299 0.0006
Q9ZVR7 1008 Phytosulfokine receptor 1 no no 0.528 0.064 0.296 0.0007
>sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 Back     alignment and function desciption
 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 63/126 (50%), Gaps = 13/126 (10%)

Query: 1   MCGSKRVWVSE---LIFILLVVKGWWSEG---CLEQERSALLQLKHFFNDD---HCLQNW 51
           M  S R WV     +IF+ L+V    S     C + +R ALL+ +  F  +   H +  W
Sbjct: 2   MIRSHRHWVFSSRIIIFLSLLVHSLASSSPHFCRDDQRDALLEFRGEFPINASWHIMNQW 61

Query: 52  VDDENYS-DCCQWEGVECNDTTGRVIELDLALTRNWESAEWYMNASLFTPFQQLESLDLS 110
               N S DCC W GV CND +G+VI LD+  T  + +     N+SLF   Q L  LDL+
Sbjct: 62  RGPWNKSTDCCLWNGVTCNDKSGQVISLDIPNT--FLNNYLKTNSSLFK-LQYLRHLDLT 118

Query: 111 LNNIAG 116
             N+ G
Sbjct: 119 NCNLYG 124
Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.
Arabidopsis thaliana (taxid: 3702)
>sp|Q05091|PGIP_PYRCO Polygalacturonase inhibitor OS=Pyrus communis GN=PGIP PE=1 SV=1 Back     alignment and function description
>sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 Back     alignment and function description
>sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
255581263 912 serine-threonine protein kinase, plant-t 0.796 0.107 0.575 4e-25
224112245 876 predicted protein [Populus trichocarpa] 0.894 0.125 0.535 4e-24
255585991 743 serine-threonine protein kinase, plant-t 0.878 0.145 0.513 2e-23
224120284 929 predicted protein [Populus trichocarpa] 0.902 0.119 0.465 8e-23
255583082 711 serine-threonine protein kinase, plant-t 0.918 0.158 0.483 2e-22
224120450 935 predicted protein [Populus trichocarpa] 0.821 0.108 0.532 3e-22
224106952124 predicted protein [Populus trichocarpa] 0.886 0.879 0.522 9e-22
224142503177 predicted protein [Populus trichocarpa] 0.951 0.661 0.476 2e-21
224073436 1014 predicted protein [Populus trichocarpa] 0.878 0.106 0.469 2e-21
224145105 280 predicted protein [Populus trichocarpa] 0.910 0.4 0.491 4e-21
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/99 (57%), Positives = 73/99 (73%), Gaps = 1/99 (1%)

Query: 25  EGCLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTR 84
           +GCL++ER+ALLQLK FF+    LQ W+  E+  DCCQWE VEC+  TGRV  LDL  TR
Sbjct: 21  KGCLDKERAALLQLKPFFDSTLALQKWLGAEDNLDCCQWERVECSSITGRVTRLDLDTTR 80

Query: 85  NWESAE-WYMNASLFTPFQQLESLDLSLNNIAGCVENEG 122
            ++S+  WY+NASLF PF++L+SL L  N+I  CVENEG
Sbjct: 81  AYQSSRNWYLNASLFLPFEELKSLSLKGNSIVDCVENEG 119

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224112245|ref|XP_002332815.1| predicted protein [Populus trichocarpa] gi|222833209|gb|EEE71686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255585991|ref|XP_002533665.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223526433|gb|EEF28711.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224120284|ref|XP_002331010.1| predicted protein [Populus trichocarpa] gi|222872940|gb|EEF10071.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255583082|ref|XP_002532308.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223527977|gb|EEF30060.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224120450|ref|XP_002331051.1| predicted protein [Populus trichocarpa] gi|222872981|gb|EEF10112.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106952|ref|XP_002333590.1| predicted protein [Populus trichocarpa] gi|224156041|ref|XP_002337668.1| predicted protein [Populus trichocarpa] gi|222837498|gb|EEE75877.1| predicted protein [Populus trichocarpa] gi|222869526|gb|EEF06657.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142503|ref|XP_002324596.1| predicted protein [Populus trichocarpa] gi|222866030|gb|EEF03161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224145105|ref|XP_002336200.1| predicted protein [Populus trichocarpa] gi|222832534|gb|EEE71011.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
TAIR|locus:2037308 976 RLP14 "AT1G74180" [Arabidopsis 0.813 0.102 0.391 1.4e-15
TAIR|locus:2040075 935 RLP21 "AT2G25470" [Arabidopsis 0.658 0.086 0.439 7.5e-14
TAIR|locus:2155909 908 RLP56 "AT5G49290" [Arabidopsis 0.756 0.102 0.403 3.3e-12
TAIR|locus:2119535 725 RLP48 "receptor like protein 4 0.910 0.154 0.365 5.5e-11
TAIR|locus:2078112 868 RLP32 "receptor like protein 3 0.723 0.102 0.388 7.6e-11
TAIR|locus:2074633 943 RLP35 "AT3G11080" [Arabidopsis 0.707 0.092 0.390 1.1e-10
TAIR|locus:2825384 847 RLP12 "AT1G71400" [Arabidopsis 0.918 0.133 0.373 1.4e-10
TAIR|locus:2019662 965 RLP15 "AT1G74190" [Arabidopsis 0.910 0.116 0.32 1.4e-10
TAIR|locus:2096339 786 RLP30 "receptor like protein 3 0.634 0.099 0.382 4.4e-09
TAIR|locus:2129246 891 RLP50 "receptor like protein 5 0.837 0.115 0.366 6.6e-09
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 200 (75.5 bits), Expect = 1.4e-15, Sum P(2) = 1.4e-15
 Identities = 45/115 (39%), Positives = 70/115 (60%)

Query:     3 GSKRVWVSELIFILLVVKGWWSEGCLEQERSALLQLKHFFND-------DHCLQNWVDDE 55
             G   +WV   + +L+ ++G+  + C+E+ER ALL+LK +          D  L  W +D 
Sbjct:     8 GQNLIWV---MLLLVQLRGY--KCCIEKERKALLELKKYMISKTADWGLDSVLPTWTNDT 62

Query:    56 NYSDCCQWEGVECNDTTGRVIELDLALTRNWESAEWYMNASLFTPFQQLESLDLS 110
               S+CC+WEG++CN T+GR+IEL +  T   ES+   +N SL  PF++L SL+LS
Sbjct:    63 K-SNCCRWEGLKCNQTSGRIIELSIGQTNFKESS--LLNLSLLHPFEELRSLNLS 114
GO:0007165 "signal transduction" evidence=IC
GO:0009507 "chloroplast" evidence=IDA
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119535 RLP48 "receptor like protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078112 RLP32 "receptor like protein 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074633 RLP35 "AT3G11080" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2825384 RLP12 "AT1G71400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096339 RLP30 "receptor like protein 30" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129246 RLP50 "receptor like protein 50" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.02810011
hypothetical protein (876 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 4e-07
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information 
 Score = 43.5 bits (103), Expect = 4e-07
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 28 LEQERSALLQLKHFFNDDH--CLQNWVDDENYSDCCQWEGVECN 69
          L  +R ALL  K   N D    L +W  + + SD C W GV C+
Sbjct: 1  LNDDRDALLAFKSSLNGDPSGALSSW--NPSSSDPCSWTGVTCD 42

Leucine Rich Repeats pfam00560 are short sequence motifs present in a number of proteins with diverse functions and cellular locations. Leucine Rich Repeats are often flanked by cysteine rich domains. This domain is often found at the N-terminus of tandem leucine rich repeats. Length = 42

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.51
PLN03150 623 hypothetical protein; Provisional 99.12
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 99.02
PLN03150 623 hypothetical protein; Provisional 97.58
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.56
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.46
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 96.94
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.73
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.09
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.08
KOG4237 498 consensus Extracellular matrix protein slit, conta 94.82
smart0037026 LRR Leucine-rich repeats, outliers. 94.73
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.73
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 93.45
KOG0472565 consensus Leucine-rich repeat protein [Function un 93.4
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 92.97
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 92.94
KOG0472 565 consensus Leucine-rich repeat protein [Function un 92.48
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 90.18
KOG0617 264 consensus Ras suppressor protein (contains leucine 90.12
KOG2982 418 consensus Uncharacterized conserved protein [Funct 88.88
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 88.61
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 87.6
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 85.96
KOG0617 264 consensus Ras suppressor protein (contains leucine 85.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 85.75
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 84.61
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 84.07
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 83.76
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 82.02
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 81.28
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=99.51  E-value=5.4e-14  Score=115.04  Aligned_cols=84  Identities=29%  Similarity=0.559  Sum_probs=66.7

Q ss_pred             CHHHHHHHHHHHHhCC-CCCCCCCCCCCCCCCCCceeceeEecCCCCcEEEEEcCCCCcccccccccCCcCCcCCCCCcE
Q 033271           28 LEQERSALLQLKHFFN-DDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTRNWESAEWYMNASLFTPFQQLES  106 (123)
Q Consensus        28 ~~~~~~aL~~~k~~l~-~~~~l~~W~~~~~~~~~C~w~gv~C~~~~~~v~~l~L~~~~l~~~G~~~~~p~~l~~l~~L~~  106 (123)
                      .+.|+.+|++||+.+. +...+.+|+   ...++|.|.||.|++ .++|+.|+|+++++  .|.+   +..+..+++|+.
T Consensus        27 ~~~~~~~l~~~~~~~~~~~~~~~~w~---~~~~~c~w~gv~c~~-~~~v~~L~L~~~~i--~~~~---~~~~~~l~~L~~   97 (968)
T PLN00113         27 HAEELELLLSFKSSINDPLKYLSNWN---SSADVCLWQGITCNN-SSRVVSIDLSGKNI--SGKI---SSAIFRLPYIQT   97 (968)
T ss_pred             CHHHHHHHHHHHHhCCCCcccCCCCC---CCCCCCcCcceecCC-CCcEEEEEecCCCc--cccC---ChHHhCCCCCCE
Confidence            4589999999999987 555678897   567899999999986 57899999999987  6655   556667777777


Q ss_pred             EeCCCCeeeeecCC
Q 033271          107 LDLSLNNIAGCVEN  120 (123)
Q Consensus       107 LdLs~N~l~G~IP~  120 (123)
                      |||++|+++|.||.
T Consensus        98 L~Ls~n~~~~~ip~  111 (968)
T PLN00113         98 INLSNNQLSGPIPD  111 (968)
T ss_pred             EECCCCccCCcCCh
Confidence            77777777777665

>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-20
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score = 83.4 bits (207), Expect = 3e-20
 Identities = 24/91 (26%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query: 26  GCLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTRN 85
             L +E   L+  K    D + L +W  +    + C ++GV C     +V  +DL+ ++ 
Sbjct: 8   QSLYREIHQLISFKDVLPDKNLLPDWSSN---KNPCTFDGVTCR--DDKVTSIDLS-SKP 61

Query: 86  WESAEWYMNASLFTPFQQLESLDLSLNNIAG 116
                  +++SL      LESL LS ++I G
Sbjct: 62  LNVGFSAVSSSLL-SLTGLESLFLSNSHING 91
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.6
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.59
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.39
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.38
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 98.81
3e6j_A 229 Variable lymphocyte receptor diversity region; var 98.05
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 97.97
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.74
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.71
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.66
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.63
2o6s_A 208 Variable lymphocyte receptor B; leucine-rich repea 97.62
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.6
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 97.46
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 97.38
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.38
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.35
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 97.32
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.3
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.29
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.22
3m19_A 251 Variable lymphocyte receptor A diversity region; a 97.18
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 97.11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.0
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 96.91
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.88
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.85
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 96.83
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 96.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 96.81
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 96.8
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 96.76
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 96.74
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 96.68
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 96.65
3e6j_A229 Variable lymphocyte receptor diversity region; var 96.52
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.48
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 96.47
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 96.46
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.42
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 96.42
4ezg_A197 Putative uncharacterized protein; internalin-A, le 96.41
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 96.38
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 96.36
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 96.34
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 96.34
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 96.33
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 96.32
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 96.24
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 96.24
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 96.18
3m19_A 251 Variable lymphocyte receptor A diversity region; a 96.18
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 96.18
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.11
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 96.11
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 96.1
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 96.09
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 96.07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 96.01
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 96.0
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 96.0
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.0
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 96.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 95.99
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 95.97
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 95.94
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 95.88
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 95.86
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 95.86
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 95.84
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 95.84
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 95.82
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 95.81
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 95.79
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 95.75
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 95.7
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 95.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 95.68
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 95.65
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 95.64
4glp_A 310 Monocyte differentiation antigen CD14; alpha beta 95.62
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 95.6
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 95.58
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 95.52
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 95.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 95.45
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 95.44
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 95.43
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 95.32
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 95.31
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 95.31
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 95.28
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 95.27
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 95.25
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 95.25
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 95.19
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 95.17
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 95.14
4ezg_A197 Putative uncharacterized protein; internalin-A, le 95.11
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 95.08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 95.03
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 95.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 94.98
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 94.91
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 94.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 94.87
4fmz_A347 Internalin; leucine rich repeat, structural genomi 94.81
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 94.8
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 94.78
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 94.77
1ds9_A 198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 94.67
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 94.65
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.37
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 94.19
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 93.88
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 93.63
1o6v_A466 Internalin A; bacterial infection, extracellular r 93.61
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 93.31
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 93.12
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 92.96
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 92.87
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 92.7
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 92.61
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 92.47
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 92.16
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 92.09
1o6v_A466 Internalin A; bacterial infection, extracellular r 91.86
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 91.77
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 91.61
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 91.41
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 90.85
4fmz_A347 Internalin; leucine rich repeat, structural genomi 90.66
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 90.6
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 90.56
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 89.05
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 88.74
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 82.5
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 82.31
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 80.01
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=99.60  E-value=2.2e-15  Score=119.43  Aligned_cols=87  Identities=28%  Similarity=0.440  Sum_probs=71.4

Q ss_pred             CCCHHHHHHHHHHHHhCC-CCCCCCCCCCCCCCCCCceeceeEecCCCCcEEEEEcCCCCcccccc---cc---------
Q 033271           26 GCLEQERSALLQLKHFFN-DDHCLQNWVDDENYSDCCQWEGVECNDTTGRVIELDLALTRNWESAE---WY---------   92 (123)
Q Consensus        26 ~~~~~~~~aL~~~k~~l~-~~~~l~~W~~~~~~~~~C~w~gv~C~~~~~~v~~l~L~~~~l~~~G~---~~---------   92 (123)
                      ...++|++||++||+.+. +. .+.+|+   .+.+||+|.||+|+  .++|+.|+|+++++  .|.   +.         
T Consensus         8 ~~~~~~~~all~~k~~~~~~~-~l~~W~---~~~~~C~w~gv~C~--~~~v~~L~L~~~~l--~g~~~~l~~~l~~L~~L   79 (768)
T 3rgz_A            8 QSLYREIHQLISFKDVLPDKN-LLPDWS---SNKNPCTFDGVTCR--DDKVTSIDLSSKPL--NVGFSAVSSSLLSLTGL   79 (768)
T ss_dssp             CCHHHHHHHHHHHHTTCSCTT-SSTTCC---TTSCGGGSTTEEEE--TTEEEEEECTTSCC--CEEHHHHHHHTTTCTTC
T ss_pred             cCCHHHHHHHHHHHhhCCCcc-cccCCC---CCCCCcCCcceEEC--CCcEEEEECCCCCc--CCccCccChhHhccCcc
Confidence            345789999999999998 44 789998   56789999999998  58999999999887  664   20         


Q ss_pred             -----------cCCcCCcCCCCCcEEeCCCCeeeeecCC
Q 033271           93 -----------MNASLFTPFQQLESLDLSLNNIAGCVEN  120 (123)
Q Consensus        93 -----------~~p~~l~~l~~L~~LdLs~N~l~G~IP~  120 (123)
                                 -.|+.++.+++|++|||++|+++|.||.
T Consensus        80 ~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~  118 (768)
T 3rgz_A           80 ESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTT  118 (768)
T ss_dssp             CEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGG
T ss_pred             cccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCC
Confidence                       0135688889999999999999998886
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 123
d1ogqa_ 313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 7e-08
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 47.1 bits (110), Expect = 7e-08
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 27 CLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCCQ--WEGVECNDTTG--RVIELDL 80
          C  Q++ ALLQ+K    +   L +W+     +DCC   W GV C+  T   RV  LDL
Sbjct: 3  CNPQDKQALLQIKKDLGNPTTLSSWLPT---TDCCNRTWLGVLCDTDTQTYRVNNLDL 57

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.79
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.34
d1w8aa_ 192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.48
d1p9ag_266 von Willebrand factor binding domain of glycoprote 96.79
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.77
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.73
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.64
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 96.54
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 96.46
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 96.35
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 95.98
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 95.73
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 95.67
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 95.12
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 94.99
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 94.96
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 94.94
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 94.83
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 94.53
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 94.41
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 93.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 93.35
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 93.25
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 92.96
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 92.92
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 92.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 92.59
d1h6ua2 227 Internalin H {Listeria monocytogenes [TaxId: 1639] 91.09
d1m9la_ 198 Outer arm dynein light chain 1 {Green algae (Chlam 90.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 90.08
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 85.16
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.79  E-value=4.6e-20  Score=130.54  Aligned_cols=90  Identities=31%  Similarity=0.531  Sum_probs=76.1

Q ss_pred             CCCHHHHHHHHHHHHhCCCCCCCCCCCCCCCCCCCc--eeceeEecCC--CCcEEEEEcCCCCcccccccccCCcCCcCC
Q 033271           26 GCLEQERSALLQLKHFFNDDHCLQNWVDDENYSDCC--QWEGVECNDT--TGRVIELDLALTRNWESAEWYMNASLFTPF  101 (123)
Q Consensus        26 ~~~~~~~~aL~~~k~~l~~~~~l~~W~~~~~~~~~C--~w~gv~C~~~--~~~v~~l~L~~~~l~~~G~~~~~p~~l~~l  101 (123)
                      .|.++|++||++||+.+.++..+.+|.   .+.|||  .|.||+|+..  ..||++|+|+++++  .|...+ |+.+++|
T Consensus         2 ~c~~~e~~aLl~~k~~~~~~~~l~sW~---~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l--~g~~~l-p~~l~~L   75 (313)
T d1ogqa_           2 LCNPQDKQALLQIKKDLGNPTTLSSWL---PTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNL--PKPYPI-PSSLANL   75 (313)
T ss_dssp             CSCHHHHHHHHHHHHHTTCCGGGTTCC---TTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCC--SSCEEC-CGGGGGC
T ss_pred             CCCHHHHHHHHHHHHHCCCCCcCCCCC---CCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCC--CCCCCC-ChHHhcC
Confidence            488999999999999998556788998   677999  4999999863  34899999999988  663211 7889999


Q ss_pred             CCCcEEeCCC-CeeeeecCCC
Q 033271          102 QQLESLDLSL-NNIAGCVENE  121 (123)
Q Consensus       102 ~~L~~LdLs~-N~l~G~IP~~  121 (123)
                      ++|++|||++ |+|+|+||++
T Consensus        76 ~~L~~L~Ls~~N~l~g~iP~~   96 (313)
T d1ogqa_          76 PYLNFLYIGGINNLVGPIPPA   96 (313)
T ss_dssp             TTCSEEEEEEETTEESCCCGG
T ss_pred             ccccccccccccccccccccc
Confidence            9999999996 8999999975
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure