Citrus Sinensis ID: 033331


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MATFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGGNSDELRRRIWDWCRRGKLPEHHNGPRGS
ccccccccHHcccccccccccccccEEEEcccEEEEcccccccccccccccEEEEEcccHHHHHHHHHHHHHHHccccccccccccHHHccccccHHHHHHHHHHHHHccccccccccccc
ccHHHHHHHHHccccccccccccccccEEccccEEEcccccccccccccccEEEEEcccHHHHHHHHHHHHHHHccccccccccHcHHHHcccccHHHHHHHHHHHHHccccccccccccc
MATFSAITSvifapslkpslsnnviaerTSNLKMAiggwrknrfpslktnrfcvscsakpeTVQKVCEIVRRQlalpaeteltseskfsalggnsdeLRRRIWDWcrrgklpehhngprgs
matfsaitsvifapslkpslsnNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLalpaeteltseskfsalggnsdelRRRIWDWcrrgklpehhngprgs
MATFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGGNSDELRRRIWDWCRRGKLPEHHNGPRGS
*****AITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALP********************LRRRIWDWCRR*************
**************************************************RFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGGNSDELRRRIWDWCRRGKLP*********
MATFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGGNSDELRRRIWDWCRRGKLP*********
*****************************SNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGGNSDELRRRIWDWCRRGKLPE********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGGNSDELRRRIWDWCRRGKLPEHHNGPRGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
P93092136 Acyl carrier protein 1, c N/A no 0.702 0.625 0.431 4e-12
P52413143 Acyl carrier protein 3, c N/A no 0.785 0.664 0.434 4e-11
P52411140 Acyl carrier protein 1, c N/A no 0.561 0.485 0.5 5e-11
P52414139 Acyl carrier protein 4, c N/A no 0.561 0.489 0.507 9e-11
Q9SW21137 Acyl carrier protein 4, c yes no 0.438 0.386 0.611 1e-10
P15543132 Acyl carrier protein 3, c N/A no 0.487 0.446 0.524 1e-09
P25701136 Acyl carrier protein 2, c no no 0.380 0.338 0.565 4e-09
P52412137 Acyl carrier protein 2, c N/A no 0.462 0.408 0.517 8e-09
P25702136 Acyl carrier protein 3, c no no 0.380 0.338 0.543 1e-08
P07088134 Acyl carrier protein SF2, N/A no 0.380 0.343 0.5 4e-08
>sp|P93092|ACP1_CASGL Acyl carrier protein 1, chloroplastic OS=Casuarina glauca GN=ACP1 PE=2 SV=1 Back     alignment and function desciption
 Score = 70.1 bits (170), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 57/95 (60%), Gaps = 10/95 (10%)

Query: 3  TFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLK--TNRFCVSCSAKP 60
          T ++I+   F  SL PS        R SNL+      +   F  L+  + RF V C+AKP
Sbjct: 5  TGTSISMASFKASLAPS--------RVSNLRSVSLPIKGKSFAPLRMRSARFVVCCAAKP 56

Query: 61 ETVQKVCEIVRRQLALPAETELTSESKFSALGGNS 95
          ETV+KVC IV++QLALP ++ +T ESKF+ LG +S
Sbjct: 57 ETVEKVCAIVKKQLALPDDSAVTGESKFATLGADS 91




Carrier of the growing fatty acid chain in fatty acid biosynthesis.
Casuarina glauca (taxid: 3522)
>sp|P52413|ACP3_CUPLA Acyl carrier protein 3, chloroplastic OS=Cuphea lanceolata GN=ACL1.3 PE=2 SV=1 Back     alignment and function description
>sp|P52411|ACP1_CUPLA Acyl carrier protein 1, chloroplastic OS=Cuphea lanceolata GN=ACL1.1 PE=2 SV=1 Back     alignment and function description
>sp|P52414|ACP4_CUPLA Acyl carrier protein 4, chloroplastic OS=Cuphea lanceolata GN=ACL1 PE=3 SV=1 Back     alignment and function description
>sp|Q9SW21|ACP4_ARATH Acyl carrier protein 4, chloroplastic OS=Arabidopsis thaliana GN=ACP4 PE=1 SV=1 Back     alignment and function description
>sp|P15543|ACP3_HORVU Acyl carrier protein 3, chloroplastic OS=Hordeum vulgare GN=ACL1.3 PE=1 SV=2 Back     alignment and function description
>sp|P25701|ACP2_ARATH Acyl carrier protein 2, chloroplastic OS=Arabidopsis thaliana GN=ACP2 PE=1 SV=2 Back     alignment and function description
>sp|P52412|ACP2_CUPLA Acyl carrier protein 2, chloroplastic OS=Cuphea lanceolata GN=ACL1.2 PE=2 SV=1 Back     alignment and function description
>sp|P25702|ACP3_ARATH Acyl carrier protein 3, chloroplastic OS=Arabidopsis thaliana GN=ACP3 PE=1 SV=2 Back     alignment and function description
>sp|P07088|ACP_BRACM Acyl carrier protein SF2, chloroplastic OS=Brassica campestris GN=Acl1.1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
225425224139 PREDICTED: acyl carrier protein 4, chlor 0.768 0.669 0.652 9e-24
356527612142 PREDICTED: acyl carrier protein 1, chlor 0.776 0.661 0.552 2e-19
255540085137 acyl carrier protein, putative [Ricinus 0.768 0.678 0.547 3e-17
224119790138 predicted protein [Populus trichocarpa] 0.752 0.659 0.572 1e-16
357520563137 Acyl carrier protein [Medicago truncatul 0.768 0.678 0.515 2e-15
356513457143 PREDICTED: acyl carrier protein 4, chlor 0.776 0.657 0.515 3e-15
388516599136 unknown [Lotus japonicus] 0.752 0.669 0.531 3e-15
255630845131 unknown [Glycine max] 0.776 0.717 0.515 3e-15
284808851140 acyl carrier protein 4 [Arachis hypogaea 0.702 0.607 0.511 1e-14
284808855140 acyl carrier protein 4 [Arachis hypogaea 0.702 0.607 0.511 1e-14
>gi|225425224|ref|XP_002267614.1| PREDICTED: acyl carrier protein 4, chloroplastic [Vitis vinifera] gi|296088168|emb|CBI35660.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  114 bits (284), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 73/95 (76%), Gaps = 2/95 (2%)

Query: 1  MATFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKP 60
          MA  SA TSV F  SLK  L +  I  + S+LKM   GW K+ FPSL+T+RF VSCSAKP
Sbjct: 1  MAAVSA-TSVTFGSSLKL-LKSRQITGKASSLKMVTVGWTKSGFPSLRTSRFRVSCSAKP 58

Query: 61 ETVQKVCEIVRRQLALPAETELTSESKFSALGGNS 95
          ETVQKVCEIV++QLALPAE+ELT ESKF+ALG +S
Sbjct: 59 ETVQKVCEIVKKQLALPAESELTPESKFAALGADS 93




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356527612|ref|XP_003532402.1| PREDICTED: acyl carrier protein 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255540085|ref|XP_002511107.1| acyl carrier protein, putative [Ricinus communis] gi|223550222|gb|EEF51709.1| acyl carrier protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224119790|ref|XP_002318163.1| predicted protein [Populus trichocarpa] gi|222858836|gb|EEE96383.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357520563|ref|XP_003630570.1| Acyl carrier protein [Medicago truncatula] gi|355524592|gb|AET05046.1| Acyl carrier protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356513457|ref|XP_003525430.1| PREDICTED: acyl carrier protein 4, chloroplastic [Glycine max] Back     alignment and taxonomy information
>gi|388516599|gb|AFK46361.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255630845|gb|ACU15785.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|284808851|gb|ADB94673.1| acyl carrier protein 4 [Arachis hypogaea] gi|284808861|gb|ADB94678.1| acyl carrier protein 4 [Arachis hypogaea] gi|288551670|gb|ADC53305.1| acyl carrier protein [Arachis hypogaea] Back     alignment and taxonomy information
>gi|284808855|gb|ADB94675.1| acyl carrier protein 4 [Arachis hypogaea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
TAIR|locus:2199461136 ACP2 "AT1G54580" [Arabidopsis 0.735 0.654 0.373 6.6e-10
TAIR|locus:2199517136 ACP3 "acyl carrier protein 3" 0.479 0.426 0.483 7.6e-09
TAIR|locus:2181216139 ACP5 "AT5G27200" [Arabidopsis 0.677 0.589 0.372 1.2e-08
TAIR|locus:2114820137 ACP1 "acyl carrier protein 1" 0.413 0.364 0.44 2.9e-07
TAIR|locus:2199461 ACP2 "AT1G54580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 142 (55.0 bits), Expect = 6.6e-10, P = 6.6e-10
 Identities = 34/91 (37%), Positives = 52/91 (57%)

Query:     7 ITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKT--NRFCVSCSAKPETVQ 64
             + S+  + S+        +A   S +K    G R +   +L+    R  VSC+AKPETV 
Sbjct:     1 MASIAASASISLQARPRQLAIAASQVKSFSNGRRSSLSFNLRQLPTRLTVSCAAKPETVD 60

Query:    65 KVCEIVRRQLALPAETELTSESKFSALGGNS 95
             KVC +VR+QL+L    E+T+ +KF+ALG +S
Sbjct:    61 KVCAVVRKQLSLKEADEITAATKFAALGADS 91




GO:0006633 "fatty acid biosynthetic process" evidence=TAS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0031177 "phosphopantetheine binding" evidence=IEA
GO:0000036 "ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process" evidence=IDA
TAIR|locus:2199517 ACP3 "acyl carrier protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181216 ACP5 "AT5G27200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114820 ACP1 "acyl carrier protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00006175001
RecName- Full=Acyl carrier protein;; Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity) (139 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00007299001
SubName- Full=Chromosome chr2 scaffold_187, whole genome shotgun sequence; (431 aa)
     0.845
GSVIVG00024012001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (392 aa)
    0.783
GSVIVG00016391001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (405 aa)
      0.577
GSVIVG00003432001
SubName- Full=Chromosome undetermined scaffold_143, whole genome shotgun sequence; (463 aa)
      0.569
GSVIVG00025980001
SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (418 aa)
      0.563
GSVIVG00034037001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (502 aa)
      0.489
GSVIVG00009555001
SubName- Full=Chromosome chr12 scaffold_238, whole genome shotgun sequence; (211 aa)
      0.488
GSVIVG00034687001
RecName- Full=Acyl-[acyl-carrier protein] desaturase; EC=1.14.19.2;; Converts stearoyl-ACP to o [...] (392 aa)
       0.483
GSVIVG00034684001
SubName- Full=Chromosome chr5 scaffold_72, whole genome shotgun sequence;; Converts stearoyl-AC [...] (387 aa)
       0.483
GSVIVG00034679001
RecName- Full=Acyl-[acyl-carrier protein] desaturase; EC=1.14.19.2;; Converts stearoyl-ACP to o [...] (352 aa)
       0.483

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
KOG1748131 consensus Acyl carrier protein/NADH-ubiquinone oxi 99.78
PRK0711779 acyl carrier protein; Validated 99.65
PRK0582884 acyl carrier protein; Validated 99.56
PRK0588391 acyl carrier protein; Validated 99.54
PRK0535082 acyl carrier protein; Provisional 99.52
PRK0650893 acyl carrier protein; Provisional 99.52
PRK0817282 putative acyl carrier protein IacP; Validated 99.52
PRK0763986 acyl carrier protein; Provisional 99.51
PRK1244980 acyl carrier protein; Provisional 99.5
CHL0012482 acpP acyl carrier protein; Validated 99.48
PTZ00171148 acyl carrier protein; Provisional 99.47
COG023680 AcpP Acyl carrier protein [Lipid metabolism / Seco 99.44
TIGR0051777 acyl_carrier acyl carrier protein. S (Ser) at posi 99.43
PRK0918489 acyl carrier protein; Provisional 99.38
PRK0708183 acyl carrier protein; Provisional 99.27
PRK0098278 acpP acyl carrier protein; Provisional 99.2
PF0055067 PP-binding: Phosphopantetheine attachment site; In 99.15
PRK0508778 D-alanine--poly(phosphoribitol) ligase subunit 2; 99.12
TIGR0168873 dltC D-alanine--poly(phosphoribitol) ligase, subun 98.66
PF1457396 PP-binding_2: Acyl-carrier; PDB: 3CE7_A. 98.17
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.15
smart0082386 PKS_PP Phosphopantetheine attachment site. Phospho 98.01
PF07377111 DUF1493: Protein of unknown function (DUF1493); In 97.62
PRK06060705 acyl-CoA synthetase; Validated 97.33
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 96.9
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 96.78
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 96.55
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 96.26
PRK12467 3956 peptide synthase; Provisional 95.87
PRK05691 4334 peptide synthase; Validated 95.25
PRK123165163 peptide synthase; Provisional 95.15
PRK12467 3956 peptide synthase; Provisional 95.14
PRK056914334 peptide synthase; Validated 94.82
PRK12316 5163 peptide synthase; Provisional 94.4
COG343374 Aryl carrier domain [Secondary metabolites biosynt 92.52
TIGR02372 386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 90.05
>KOG1748 consensus Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit [Energy production and conversion; Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=99.78  E-value=6.6e-20  Score=136.32  Aligned_cols=56  Identities=25%  Similarity=0.331  Sum_probs=54.4

Q ss_pred             cCChHHHHHHHHHHHHHHhCCCCCCccCCCCccc-cCCCChHHHHHHHHHHHHhcCCC
Q 033331           56 CSAKPETVQKVCEIVRRQLALPAETELTSESKFS-ALGGNSDELRRRIWDWCRRGKLP  112 (121)
Q Consensus        56 c~ak~et~ekV~~IV~~~l~l~d~~~It~eS~F~-DLGaDSLD~VEIVm~LEdeF~Ip  112 (121)
                      |++|+++.+||.+||+++..+ ++++++++++|. |||+||||+|||||+|||||||+
T Consensus        48 ~l~k~~v~~RVl~VVk~~dki-~~~k~~~~s~f~~DLGlDSLD~VEiVMAlEEEFgiE  104 (131)
T KOG1748|consen   48 CLAKKEVVDRVLDVVKKFDKI-DPSKLTTDSDFFKDLGLDSLDTVEIVMALEEEFGIE  104 (131)
T ss_pred             hhhHHHHHHHHHHHHHHhhcC-CccccchhhHHHHhcCCcccccchhhhhhHHHhCCc
Confidence            999999999999999999999 999999999998 99999999999999999999984



>PRK07117 acyl carrier protein; Validated Back     alignment and domain information
>PRK05828 acyl carrier protein; Validated Back     alignment and domain information
>PRK05883 acyl carrier protein; Validated Back     alignment and domain information
>PRK05350 acyl carrier protein; Provisional Back     alignment and domain information
>PRK06508 acyl carrier protein; Provisional Back     alignment and domain information
>PRK08172 putative acyl carrier protein IacP; Validated Back     alignment and domain information
>PRK07639 acyl carrier protein; Provisional Back     alignment and domain information
>PRK12449 acyl carrier protein; Provisional Back     alignment and domain information
>CHL00124 acpP acyl carrier protein; Validated Back     alignment and domain information
>PTZ00171 acyl carrier protein; Provisional Back     alignment and domain information
>COG0236 AcpP Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00517 acyl_carrier acyl carrier protein Back     alignment and domain information
>PRK09184 acyl carrier protein; Provisional Back     alignment and domain information
>PRK07081 acyl carrier protein; Provisional Back     alignment and domain information
>PRK00982 acpP acyl carrier protein; Provisional Back     alignment and domain information
>PF00550 PP-binding: Phosphopantetheine attachment site; InterPro: IPR006163 Phosphopantetheine (or pantetheine 4' phosphate) is the prosthetic group of acyl carrier proteins (ACP) in some multienzyme complexes where it serves as a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups [] Back     alignment and domain information
>PRK05087 D-alanine--poly(phosphoribitol) ligase subunit 2; Validated Back     alignment and domain information
>TIGR01688 dltC D-alanine--poly(phosphoribitol) ligase, subunit 2 Back     alignment and domain information
>PF14573 PP-binding_2: Acyl-carrier; PDB: 3CE7_A Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>smart00823 PKS_PP Phosphopantetheine attachment site Back     alignment and domain information
>PF07377 DUF1493: Protein of unknown function (DUF1493); InterPro: IPR010862 This family consists of several bacterial proteins of around 115 residues in length Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
2ava_A82 Solution Structure Of Stearoyl-Acyl Carrier Protein 3e-05
2xz0_D82 The Structure Of The 2:1 (Partially Occupied) Compl 8e-05
>pdb|2AVA|A Chain A, Solution Structure Of Stearoyl-Acyl Carrier Protein Length = 82 Back     alignment and structure

Iteration: 1

Score = 43.5 bits (101), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 19/38 (50%), Positives = 29/38 (76%) Query: 58 AKPETVQKVCEIVRRQLALPAETELTSESKFSALGGNS 95 AK ET+ KV +IV+ +LAL A+ +T++S+FS LG +S Sbjct: 1 AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADS 38
>pdb|2XZ0|D Chain D, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 5e-06
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 2e-04
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Length = 82 Back     alignment and structure
 Score = 40.7 bits (96), Expect = 5e-06
 Identities = 19/38 (50%), Positives = 29/38 (76%)

Query: 58 AKPETVQKVCEIVRRQLALPAETELTSESKFSALGGNS 95
          AK ET+ KV +IV+ +LAL A+  +T++S+FS LG +S
Sbjct: 1  AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADS 38


>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
2l9f_A102 CALE8, meacp; transferase, acyl carrier protein; N 99.61
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 99.55
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 99.51
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 99.48
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 99.45
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 99.45
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 99.44
2lki_A105 Putative uncharacterized protein; helical bundle, 99.44
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 99.43
2kjs_A87 Putative acyl carrier protein; alpha, ACP, PNS, st 99.43
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 99.42
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 99.42
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 99.42
2kw2_A101 Specialized acyl carrier protein; structural genom 99.41
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 99.39
1x3o_A80 Acyl carrier protein; structural genomics, riken s 99.39
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 99.39
2l4b_A88 Acyl carrier protein; infectious disease, human gr 99.39
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 99.38
2lte_A103 Specialized acyl carrier protein; APO protein, tra 99.07
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 99.36
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 99.36
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 99.34
2amw_A83 Hypothetical protein NE2163; all helical protein, 99.34
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 99.32
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 99.3
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 99.26
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 99.25
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 99.23
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 99.23
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 99.22
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 99.21
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 99.16
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 99.09
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 99.06
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 98.98
2l22_A 212 Mupirocin didomain acyl carrier protein; biosynthe 98.91
2ju1_A95 Erythronolide synthase; carrier protein domain, mo 98.88
1dny_A91 Non-ribosomal peptide synthetase peptidyl carrier 98.8
4i4d_A93 Peptide synthetase NRPS type II-PCP; structural ge 98.75
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 98.69
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 98.19
2cq8_A110 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH 97.79
2jgp_A 520 Tyrocidine synthetase 3; multifunctional enzyme, a 97.69
2fq1_A287 Isochorismatase; ENTB, NRPS, multi-domain, ACP, hy 97.19
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 96.85
4f6l_B 508 AUSA reductase domain protein; thioester reductase 96.63
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 95.77
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 95.7
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 95.06
1dd4_C40 50S ribosomal protein L7/L12; dimer formation, fle 90.79
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 84.33
1zav_U30 50S ribosomal protein L7/L12; ribosome structure a 82.83
>2l9f_A CALE8, meacp; transferase, acyl carrier protein; NMR {Micromonospora echinospora} Back     alignment and structure
Probab=99.61  E-value=1.2e-15  Score=108.30  Aligned_cols=55  Identities=20%  Similarity=0.181  Sum_probs=51.5

Q ss_pred             ChHHHHHHHHHHHHHHhCCCCCCccCCCCccc-cCCCChHHHHHHHHHHHHhcCCCC
Q 033331           58 AKPETVQKVCEIVRRQLALPAETELTSESKFS-ALGGNSDELRRRIWDWCRRGKLPE  113 (121)
Q Consensus        58 ak~et~ekV~~IV~~~l~l~d~~~It~eS~F~-DLGaDSLD~VEIVm~LEdeF~Ip~  113 (121)
                      +-.+++++|++||.+++++ ++++|+++++|. |||+||||+|||||.+|++||++-
T Consensus        11 ~~~~I~~~V~~ilaE~lev-~~e~Vtpda~l~dDLglDSLd~VeLVm~lE~~fGi~i   66 (102)
T 2l9f_A           11 AATGALELVRHLVAERAEL-PVEVLRDDSRFLDDLHMSSITVGQLVNEAARAMGLSA   66 (102)
T ss_dssp             SSCCHHHHHHHHHHHHTTS-CSSSCCTTCBTTTTSCCCHHHHHHHHHHHHHHHTCST
T ss_pred             hHHHHHHHHHHHHHHHHCC-CHHHcCCCcchhhhcCCcHHHHHHHHHHHHHHhCCCC
Confidence            4457999999999999999 999999999998 999999999999999999999963



>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} SCOP: a.28.1.0 PDB: 3gzl_A* 2fq0_A* 2fq2_A* Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>2ju1_A Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A Back     alignment and structure
>1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A Back     alignment and structure
>4i4d_A Peptide synthetase NRPS type II-PCP; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MLY; 2.10A {Streptomyces verticillus} Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2cq8_A 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jgp_A Tyrocidine synthetase 3; multifunctional enzyme, antibiotic biosynthesis, condensatio domain, peptide bond formation, ligase; 1.85A {Brevibacillus brevis} Back     alignment and structure
>2fq1_A Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrolase; 2.30A {Escherichia coli} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>1dd4_C 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; HET: TBR; 2.40A {Thermotoga maritima} SCOP: a.108.1.1 Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1zav_U 50S ribosomal protein L7/L12; ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk; 1.90A {Thermotoga maritima} SCOP: a.108.1.1 PDB: 1zaw_U 1zax_U 1dd3_C Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 121
d1f80d_74 a.28.1.1 (D:) Acyl carrier protein {Bacillus subti 0.004
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Length = 74 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Bacillus subtilis [TaxId: 1423]
 Score = 31.7 bits (72), Expect = 0.004
 Identities = 6/28 (21%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 61 ETVQKVCEIVRRQLALPAETELTSESKF 88
          +T+++V +I+  +L +    ++  E+ F
Sbjct: 3  DTLERVTKIIVDRLGVDEA-DVKLEASF 29


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d1f80d_74 Acyl carrier protein {Bacillus subtilis [TaxId: 14 99.55
d1t8ka_77 Acyl carrier protein {Escherichia coli [TaxId: 562 99.54
d1vkua_85 Acyl carrier protein {Thermotoga maritima [TaxId: 99.38
d1klpa_115 Acyl carrier protein {Mycobacterium tuberculosis [ 99.31
d1dv5a_80 apo-D-alanyl carrier protein {Lactobacillus casei 99.31
d2jq4a183 Hypothetical protein Atu2571 {Agrobacterium tumefa 99.14
d1nq4a_95 Oxytetracycline polyketide synthase acyl carrier { 99.13
d1or5a_82 Frenolicin polyketide synthase acyl carrier protei 99.09
d2af8a_86 Actinorhodin polyketide synthase acyl carrier prot 99.0
d2pnga176 Type I fatty acid synthase ACP domain {Rat (Rattus 98.94
d2gdwa176 Peptidyl carrier protein (PCP), thioester domain { 98.71
d2gyc3147 Ribosomal protein L7/12, oligomerisation (N-termin 93.16
d1dd3a157 Ribosomal protein L7/12, oligomerisation (N-termin 81.52
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Bacillus subtilis [TaxId: 1423]
Probab=99.55  E-value=3.3e-15  Score=96.46  Aligned_cols=53  Identities=17%  Similarity=0.335  Sum_probs=50.1

Q ss_pred             HHHHHHHHHHHHHHhCCCCCCccCCCCccc-cCCCChHHHHHHHHHHHHhcCCCC
Q 033331           60 PETVQKVCEIVRRQLALPAETELTSESKFS-ALGGNSDELRRRIWDWCRRGKLPE  113 (121)
Q Consensus        60 ~et~ekV~~IV~~~l~l~d~~~It~eS~F~-DLGaDSLD~VEIVm~LEdeF~Ip~  113 (121)
                      .|++++|++||++++++ ++++|+++++|. |||+|||+.+|+++.||++|||+.
T Consensus         2 ~dv~~~v~~iia~~l~~-~~~~i~~~~~~~~DlG~DSl~~vel~~~le~~f~i~i   55 (74)
T d1f80d_           2 ADTLERVTKIIVDRLGV-DEADVKLEASFKEDLGADXLDVVELVMELEDEFDMEI   55 (74)
T ss_dssp             CHHHHHHHHHHHHHSSC-CSSCCCTTCBHHHHSCCCHHHHHHHHHHHHHHTTCCC
T ss_pred             hHHHHHHHHHHHHHHCc-CHHHcCCCccHHHhcCccHhHHHHHHHHHHHHhCCCC
Confidence            47999999999999999 899999999997 899999999999999999999864



>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d2gyc31 a.108.1.1 (3:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dd3a1 a.108.1.1 (A:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure