Citrus Sinensis ID: 033363


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MAQIYSIRLKEIAILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHGVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVSTKGNL
ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccccccccccccHHEEEEEccccccccccHHHHHHHHHHHHHcccc
ccEEEEEEHHHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHcHHHccHHHHHHHHHHHHHHHHHcccccHHHcccccHHHHHHHHHHccccHHHcccccHHHHHHHHHHHHHcccc
MAQIYSIRLKEIAILLKAGRVISDLftlcpdaktateVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHGVGKYAADAFAIFCtgkwdrvrptdhMLNYYWEFLVSTKGNL
MAQIYSIRLKEIAILLKAGRVISDLFTLCPDAktatevdaeEIEKIIstlglqkkraPMIKRFSQEYLGESWTHVTQLHGVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVSTKGNL
MAQIYSIRLKEIAILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHGVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVSTKGNL
***IYSIRLKEIAILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHGVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVS*****
**QIYSIRLKEIAILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHGVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVSTK***
MAQIYSIRLKEIAILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHGVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVSTKGNL
MAQIYSIRLKEIAILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHGVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVSTK***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQIYSIRLKEIAILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHGVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVSTKGNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
Q9Z2D7554 Methyl-CpG-binding domain yes no 0.702 0.153 0.411 5e-16
O95243580 Methyl-CpG-binding domain yes no 0.702 0.146 0.411 1e-15
>sp|Q9Z2D7|MBD4_MOUSE Methyl-CpG-binding domain protein 4 OS=Mus musculus GN=Mbd4 PE=1 SV=1 Back     alignment and function desciption
 Score = 83.2 bits (204), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 35/85 (41%), Positives = 52/85 (61%)

Query: 30  PDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHGVGKYAADAF 89
           P A+ A   D  ++ +++  LGL   RA  I +FS EYL + W +  +LHG+GKY  D++
Sbjct: 460 PSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGKYGNDSY 519

Query: 90  AIFCTGKWDRVRPTDHMLNYYWEFL 114
            IFC  +W +V P DH LN Y ++L
Sbjct: 520 RIFCVNEWKQVHPEDHKLNKYHDWL 544




Mismatch-specific DNA N-glycosylase involved in DNA repair. Has thymine glycosylase activity and is specific for G:T mismatches within methylated and unmethylated CpG sites. Can also remove uracil or 5-fluorouracil in G:U mismatches. Has no lyase activity. Was first identified as methyl-CpG-binding protein.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 2EC: .EC: 2EC: .EC: -
>sp|O95243|MBD4_HUMAN Methyl-CpG-binding domain protein 4 OS=Homo sapiens GN=MBD4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
255546672 608 conserved hypothetical protein [Ricinus 0.776 0.154 0.819 9e-42
297829352 435 hypothetical protein ARALYDRAFT_896965 [ 0.776 0.216 0.797 5e-41
356551311 1505 PREDICTED: uncharacterized protein LOC10 0.842 0.067 0.725 7e-40
296085641 599 unnamed protein product [Vitis vinifera] 0.818 0.165 0.747 1e-39
224118080107 predicted protein [Populus trichocarpa] 0.876 0.990 0.698 1e-39
147837937 635 hypothetical protein VITISV_044254 [Viti 0.842 0.160 0.737 2e-39
225469167 536 PREDICTED: uncharacterized protein LOC10 0.818 0.184 0.747 2e-39
42572315 445 methyl-CpG-binding domain protein 4 [Ara 0.776 0.211 0.776 3e-39
6648205 419 hypothetical protein [Arabidopsis thalia 0.776 0.224 0.776 3e-39
27754344 407 unknown protein [Arabidopsis thaliana] 0.776 0.230 0.776 4e-39
>gi|255546672|ref|XP_002514395.1| conserved hypothetical protein [Ricinus communis] gi|223546492|gb|EEF47991.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  174 bits (440), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 77/94 (81%), Positives = 82/94 (87%)

Query: 21  VISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHG 80
           VISD FTLCPDAK ATE   EEIEKII  LGLQKKRA MI+R SQEYL + WTHVTQLHG
Sbjct: 508 VISDFFTLCPDAKAATEAKTEEIEKIIVPLGLQKKRAVMIQRLSQEYLADDWTHVTQLHG 567

Query: 81  VGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFL 114
           VGKYAADA+AIFCTGKWD+VRP DHMLNYYW+FL
Sbjct: 568 VGKYAADAYAIFCTGKWDQVRPKDHMLNYYWDFL 601




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297829352|ref|XP_002882558.1| hypothetical protein ARALYDRAFT_896965 [Arabidopsis lyrata subsp. lyrata] gi|297328398|gb|EFH58817.1| hypothetical protein ARALYDRAFT_896965 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356551311|ref|XP_003544020.1| PREDICTED: uncharacterized protein LOC100793802 [Glycine max] Back     alignment and taxonomy information
>gi|296085641|emb|CBI29440.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224118080|ref|XP_002317727.1| predicted protein [Populus trichocarpa] gi|222858400|gb|EEE95947.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147837937|emb|CAN67143.1| hypothetical protein VITISV_044254 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225469167|ref|XP_002271845.1| PREDICTED: uncharacterized protein LOC100244192 [Vitis vinifera] Back     alignment and taxonomy information
>gi|42572315|ref|NP_974253.1| methyl-CpG-binding domain protein 4 [Arabidopsis thaliana] gi|114050633|gb|ABI49466.1| At3g07930 [Arabidopsis thaliana] gi|332641100|gb|AEE74621.1| methyl-CpG-binding domain protein 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|6648205|gb|AAF21203.1|AC013483_27 hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|27754344|gb|AAO22623.1| unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
TAIR|locus:2077357445 AT3G07930 [Arabidopsis thalian 0.776 0.211 0.776 6.3e-37
UNIPROTKB|O95243580 MBD4 "Methyl-CpG-binding domai 0.702 0.146 0.411 1.3e-16
UNIPROTKB|Q2MD36262 MBD4 "Methyl-CpG-binding domai 0.702 0.324 0.411 2.3e-16
UNIPROTKB|E1BVB1108 MBD4 "Uncharacterized protein" 0.702 0.787 0.411 7.7e-16
UNIPROTKB|F1P366199 MBD4 "Uncharacterized protein" 0.702 0.427 0.411 7.7e-16
MGI|MGI:1333850554 Mbd4 "methyl-CpG binding domai 0.702 0.153 0.411 2.4e-15
UNIPROTKB|E2RL50570 MBD4 "Uncharacterized protein" 0.702 0.149 0.411 3.3e-15
UNIPROTKB|F1MUX1554 MBD4 "Uncharacterized protein" 0.702 0.153 0.411 4e-15
UNIPROTKB|E9PEE4572 MBD4 "Methyl-CpG-binding domai 0.611 0.129 0.405 3.3e-13
RGD|1585874530 Mbd4 "methyl-CpG binding domai 0.537 0.122 0.461 1.3e-11
TAIR|locus:2077357 AT3G07930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 397 (144.8 bits), Expect = 6.3e-37, P = 6.3e-37
 Identities = 73/94 (77%), Positives = 79/94 (84%)

Query:    21 VISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHG 80
             VISDLF LC DAKTATEV  EEIE +I  LGLQKKR  MI+R S EYL ESWTHVTQLHG
Sbjct:   346 VISDLFGLCTDAKTATEVKEEEIENLIKPLGLQKKRTKMIQRLSLEYLQESWTHVTQLHG 405

Query:    81 VGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFL 114
             VGKYAADA+AIFC G WDRV+P DHMLNYYW++L
Sbjct:   406 VGKYAADAYAIFCNGNWDRVKPNDHMLNYYWDYL 439




GO:0003824 "catalytic activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006281 "DNA repair" evidence=IEA
GO:0006284 "base-excision repair" evidence=IEA;ISS
GO:0006306 "DNA methylation" evidence=RCA
UNIPROTKB|O95243 MBD4 "Methyl-CpG-binding domain protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2MD36 MBD4 "Methyl-CpG-binding domain protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVB1 MBD4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P366 MBD4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1333850 Mbd4 "methyl-CpG binding domain protein 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RL50 MBD4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MUX1 MBD4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PEE4 MBD4 "Methyl-CpG-binding domain protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1585874 Mbd4 "methyl-CpG binding domain protein 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
pfam00730144 pfam00730, HhH-GPD, HhH-GPD superfamily base excis 2e-13
smart00478149 smart00478, ENDO3c, endonuclease III 3e-04
cd00056158 cd00056, ENDO3c, endonuclease III; includes endonu 0.002
COG0177211 COG0177, Nth, Predicted EndoIII-related endonuclea 0.002
>gnl|CDD|216088 pfam00730, HhH-GPD, HhH-GPD superfamily base excision DNA repair protein Back     alignment and domain information
 Score = 61.6 bits (150), Expect = 2e-13
 Identities = 28/115 (24%), Positives = 48/115 (41%), Gaps = 14/115 (12%)

Query: 18  AGRVISDLFTLC--PDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHV 75
           A ++   LF     P  +   E D EE+ ++I  LG  +++A  IK  ++  +      V
Sbjct: 14  ANKITKRLFERYGFPTPEDLAEADEEELRELIKGLGFYRRKAKYIKELARILVEGYLGLV 73

Query: 76  ----------TQLHGVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWE--FLVSTK 118
                       L GVG++ A+A  +F  G+ D     D  +    +   L+ TK
Sbjct: 74  PLDLEELEALLALPGVGRWTAEAVLLFALGRPDVFPAVDTHVRRVAKRLGLIDTK 128


This family contains a diverse range of structurally related DNA repair proteins. The superfamily is called the HhH-GPD family after its hallmark Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate. This includes endonuclease III, EC:4.2.99.18 and MutY an A/G-specific adenine glycosylase, both have a C terminal 4Fe-4S cluster. The family also includes 8-oxoguanine DNA glycosylases. The methyl-CPG binding protein MBD4 also contains a related domain that is a thymine DNA glycosylase. The family also includes DNA-3-methyladenine glycosylase II EC:3.2.2.21 and other members of the AlkA family. Length = 144

>gnl|CDD|214684 smart00478, ENDO3c, endonuclease III Back     alignment and domain information
>gnl|CDD|238013 cd00056, ENDO3c, endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases Back     alignment and domain information
>gnl|CDD|223255 COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
COG0177211 Nth Predicted EndoIII-related endonuclease [DNA re 99.97
PRK10702211 endonuclease III; Provisional 99.96
PRK13913218 3-methyladenine DNA glycosylase; Provisional 99.95
TIGR01083191 nth endonuclease III. This equivalog model identif 99.95
PRK10880 350 adenine DNA glycosylase; Provisional 99.94
TIGR01084 275 mutY A/G-specific adenine glycosylase. This equiva 99.94
PRK13910 289 DNA glycosylase MutY; Provisional 99.93
smart00478149 ENDO3c endonuclease III. includes endonuclease III 99.93
cd00056158 ENDO3c endonuclease III; includes endonuclease III 99.92
COG1194 342 MutY A/G-specific DNA glycosylase [DNA replication 99.88
COG0122285 AlkA 3-methyladenine DNA glycosylase/8-oxoguanine 99.88
PRK10308283 3-methyl-adenine DNA glycosylase II; Provisional 99.86
TIGR00588310 ogg 8-oxoguanine DNA-glycosylase (ogg). All protei 99.85
TIGR03252177 uncharacterized HhH-GPD family protein. This model 99.83
PRK01229208 N-glycosylase/DNA lyase; Provisional 99.81
COG2231215 Uncharacterized protein related to Endonuclease II 99.81
KOG1921286 consensus Endonuclease III [Replication, recombina 99.8
KOG1918254 consensus 3-methyladenine DNA glycosidase [Replica 99.74
PF00730108 HhH-GPD: HhH-GPD superfamily base excision DNA rep 99.67
KOG2457 555 consensus A/G-specific adenine DNA glycosylase [Re 99.61
KOG2875323 consensus 8-oxoguanine DNA glycosylase [Replicatio 99.57
PF0063330 HHH: Helix-hairpin-helix motif; InterPro: IPR00044 98.67
COG1059210 Thermostable 8-oxoguanine DNA glycosylase [DNA rep 97.43
PF1471668 HHH_8: Helix-hairpin-helix domain; PDB: 2W9M_A 1HU 97.03
smart0027826 HhH1 Helix-hairpin-helix DNA-binding motif class 1 96.95
PRK13901196 ruvA Holliday junction DNA helicase RuvA; Provisio 96.91
PF1282664 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS 96.91
PRK14606188 ruvA Holliday junction DNA helicase RuvA; Provisio 96.51
PRK14601183 ruvA Holliday junction DNA helicase RuvA; Provisio 96.51
PRK14602203 ruvA Holliday junction DNA helicase RuvA; Provisio 96.41
PRK14603197 ruvA Holliday junction DNA helicase RuvA; Provisio 96.34
COG0632201 RuvA Holliday junction resolvasome, DNA-binding su 96.33
PRK14604195 ruvA Holliday junction DNA helicase RuvA; Provisio 96.31
PRK14605194 ruvA Holliday junction DNA helicase RuvA; Provisio 96.2
TIGR00084191 ruvA Holliday junction DNA helicase, RuvA subunit. 95.96
PRK14600186 ruvA Holliday junction DNA helicase RuvA; Provisio 95.9
PF1452060 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU 95.83
PF0237187 Transposase_20: Transposase IS116/IS110/IS902 fami 95.75
PRK02515132 psbU photosystem II complex extrinsic protein prec 95.75
PRK00116192 ruvA Holliday junction DNA helicase RuvA; Reviewed 95.58
TIGR0042669 competence protein ComEA helix-hairpin-helix repea 95.3
PF1283665 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE 95.13
PF1452060 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU 94.62
TIGR00615 195 recR recombination protein RecR. This family is ba 94.27
PRK00076 196 recR recombination protein RecR; Reviewed 94.2
PRK14973936 DNA topoisomerase I; Provisional 94.18
PF1449094 HHH_4: Helix-hairpin-helix containing domain; PDB: 94.16
PRK13844 200 recombination protein RecR; Provisional 94.12
TIGR01259120 comE comEA protein. This model describes the ComEA 94.11
smart00483 334 POLXc DNA polymerase X family. includes vertebrate 94.09
COG0353 198 RecR Recombinational DNA repair protein (RecF path 93.94
PF1173193 Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd 93.76
cd00141 307 NT_POLXc Nucleotidyltransferase (NT) domain of fam 93.66
KOG2841254 consensus Structure-specific endonuclease ERCC1-XP 93.52
PF1283665 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE 93.45
PRK07956665 ligA NAD-dependent DNA ligase LigA; Validated 93.42
PF1179832 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 93.36
TIGR00575652 dnlj DNA ligase, NAD-dependent. The member of this 93.35
PRK07945 335 hypothetical protein; Provisional 93.12
COG1555149 ComEA DNA uptake protein and related DNA-binding p 92.65
PRK08097562 ligB NAD-dependent DNA ligase LigB; Reviewed 92.61
PF05559319 DUF763: Protein of unknown function (DUF763); Inte 92.56
COG1555149 ComEA DNA uptake protein and related DNA-binding p 92.55
TIGR01259120 comE comEA protein. This model describes the ComEA 92.36
PF1039152 DNA_pol_lambd_f: Fingers domain of DNA polymerase 92.05
PRK14350669 ligA NAD-dependent DNA ligase LigA; Provisional 91.98
COG0272667 Lig NAD-dependent DNA ligase (contains BRCT domain 91.45
PRK13482352 DNA integrity scanning protein DisA; Provisional 91.06
TIGR00084191 ruvA Holliday junction DNA helicase, RuvA subunit. 90.95
PRK00116192 ruvA Holliday junction DNA helicase RuvA; Reviewed 90.79
PRK08609 570 hypothetical protein; Provisional 90.72
PF03352179 Adenine_glyco: Methyladenine glycosylase; InterPro 90.45
PF14229122 DUF4332: Domain of unknown function (DUF4332) 90.24
PRK14605194 ruvA Holliday junction DNA helicase RuvA; Provisio 89.99
smart0027936 HhH2 Helix-hairpin-helix class 2 (Pol1 family) mot 89.99
PRK00024 224 hypothetical protein; Reviewed 89.96
PRK12766 232 50S ribosomal protein L32e; Provisional 89.57
PF1282664 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS 89.45
smart00483 334 POLXc DNA polymerase X family. includes vertebrate 89.01
cd00141 307 NT_POLXc Nucleotidyltransferase (NT) domain of fam 88.57
PRK02515132 psbU photosystem II complex extrinsic protein prec 88.48
PRK00024224 hypothetical protein; Reviewed 88.28
cd0008075 HhH2_motif Helix-hairpin-helix class 2 (Pol1 famil 87.4
PRK14351689 ligA NAD-dependent DNA ligase LigA; Provisional 87.31
KOG2534 353 consensus DNA polymerase IV (family X) [Replicatio 87.15
COG1796 326 POL4 DNA polymerase IV (family X) [DNA replication 86.88
PF0311866 RNA_pol_A_CTD: Bacterial RNA polymerase, alpha cha 85.98
TIGR0042669 competence protein ComEA helix-hairpin-helix repea 85.74
PRK00254720 ski2-like helicase; Provisional 84.63
PRK13901196 ruvA Holliday junction DNA helicase RuvA; Provisio 83.85
TIGR00608218 radc DNA repair protein radc. This family is based 83.8
PRK14600186 ruvA Holliday junction DNA helicase RuvA; Provisio 83.7
PRK14601183 ruvA Holliday junction DNA helicase RuvA; Provisio 83.47
PRK14606188 ruvA Holliday junction DNA helicase RuvA; Provisio 82.74
PRK14603197 ruvA Holliday junction DNA helicase RuvA; Provisio 82.51
PRK14602203 ruvA Holliday junction DNA helicase RuvA; Provisio 82.51
PRK09482256 flap endonuclease-like protein; Provisional 82.4
PF0959757 IGR: IGR protein motif; InterPro: IPR019083 This e 81.86
PRK12766 232 50S ribosomal protein L32e; Provisional 81.78
PRK14604195 ruvA Holliday junction DNA helicase RuvA; Provisio 81.53
PRK14351 689 ligA NAD-dependent DNA ligase LigA; Provisional 81.52
TIGR0195450 nusA_Cterm_rpt transcription termination factor Nu 81.42
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 80.65
>COG0177 Nth Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
Probab=99.97  E-value=4.9e-30  Score=193.11  Aligned_cols=103  Identities=22%  Similarity=0.345  Sum_probs=95.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHhcCCHHHHHHHHhhcCChhHHHHHHHHHHHHHHH-------hhHHHh
Q 033363            3 QIYSIRLKEIAILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLG-------ESWTHV   75 (121)
Q Consensus         3 ~~~si~~~~~~~~~~v~~v~~~l~~~~pt~~~la~a~~~eL~~~i~~~Gl~~~Ka~~i~~~a~~i~~-------~~~~~L   75 (121)
                      .+.++.+|+++||+.|++++.+||++||||++++++++++|++.|+++|||++||++|+++|+++++       +++++|
T Consensus        32 lLva~iLSaqttD~~vn~at~~Lf~~~~t~e~l~~a~~~~l~~~I~~iGlyr~KAk~I~~~~~~l~e~~~g~vP~~~~eL  111 (211)
T COG0177          32 LLVAVILSAQTTDEVVNKATPALFKRYPTPEDLLNADEEELEELIKSIGLYRNKAKNIKELARILLEKFGGEVPDTREEL  111 (211)
T ss_pred             HHHHHHHhccCchHHHHHHHHHHHHHcCCHHHHHcCCHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHHcCCCCCchHHHH
Confidence            3567788888999999999999999999999999999999999999999999999999999999999       489999


Q ss_pred             ccCCCCcHHHHHHHHHHhcCCCCccCcchHHH
Q 033363           76 TQLHGVGKYAADAFAIFCTGKWDRVRPTDHML  107 (121)
Q Consensus        76 ~~lpGIG~~tA~~vl~f~~~~~~~v~p~D~~l  107 (121)
                      .+|||||+|||++||.++||.|  .+|+|+++
T Consensus       112 ~~LPGVGrKTAnvVL~~a~g~p--~i~VDTHV  141 (211)
T COG0177         112 LSLPGVGRKTANVVLSFAFGIP--AIAVDTHV  141 (211)
T ss_pred             HhCCCcchHHHHHHHHhhcCCC--cccccchH
Confidence            9999999999999999999998  56666544



>PRK10702 endonuclease III; Provisional Back     alignment and domain information
>PRK13913 3-methyladenine DNA glycosylase; Provisional Back     alignment and domain information
>TIGR01083 nth endonuclease III Back     alignment and domain information
>PRK10880 adenine DNA glycosylase; Provisional Back     alignment and domain information
>TIGR01084 mutY A/G-specific adenine glycosylase Back     alignment and domain information
>PRK13910 DNA glycosylase MutY; Provisional Back     alignment and domain information
>smart00478 ENDO3c endonuclease III Back     alignment and domain information
>cd00056 ENDO3c endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases Back     alignment and domain information
>COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0122 AlkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10308 3-methyl-adenine DNA glycosylase II; Provisional Back     alignment and domain information
>TIGR00588 ogg 8-oxoguanine DNA-glycosylase (ogg) Back     alignment and domain information
>TIGR03252 uncharacterized HhH-GPD family protein Back     alignment and domain information
>PRK01229 N-glycosylase/DNA lyase; Provisional Back     alignment and domain information
>COG2231 Uncharacterized protein related to Endonuclease III [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1921 consensus Endonuclease III [Replication, recombination and repair] Back     alignment and domain information
>KOG1918 consensus 3-methyladenine DNA glycosidase [Replication, recombination and repair] Back     alignment and domain information
>PF00730 HhH-GPD: HhH-GPD superfamily base excision DNA repair protein This entry corresponds to Endonuclease III This entry corresponds to Alkylbase DNA glycosidase; InterPro: IPR003265 Endonuclease III (4 Back     alignment and domain information
>KOG2457 consensus A/G-specific adenine DNA glycosylase [Replication, recombination and repair] Back     alignment and domain information
>KOG2875 consensus 8-oxoguanine DNA glycosylase [Replication, recombination and repair] Back     alignment and domain information
>PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] Back     alignment and domain information
>COG1059 Thermostable 8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF14716 HHH_8: Helix-hairpin-helix domain; PDB: 2W9M_A 1HUZ_A 1HUO_A 2BPG_B 2BPF_A 1DK3_A 1BPE_A 1BNO_A 1BNP_A 1DK2_A Back     alignment and domain information
>smart00278 HhH1 Helix-hairpin-helix DNA-binding motif class 1 Back     alignment and domain information
>PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PF12826 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS_A 1V9P_B Back     alignment and domain information
>PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit Back     alignment and domain information
>PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A Back     alignment and domain information
>PF02371 Transposase_20: Transposase IS116/IS110/IS902 family; InterPro: IPR003346 Transposases are needed for efficient transposition of the insertion sequence or transposon DNA Back     alignment and domain information
>PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional Back     alignment and domain information
>PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed Back     alignment and domain information
>TIGR00426 competence protein ComEA helix-hairpin-helix repeat region Back     alignment and domain information
>PF12836 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE_A 3BZK_A 3BZC_A 2DUY_A Back     alignment and domain information
>PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A Back     alignment and domain information
>TIGR00615 recR recombination protein RecR Back     alignment and domain information
>PRK00076 recR recombination protein RecR; Reviewed Back     alignment and domain information
>PRK14973 DNA topoisomerase I; Provisional Back     alignment and domain information
>PF14490 HHH_4: Helix-hairpin-helix containing domain; PDB: 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK13844 recombination protein RecR; Provisional Back     alignment and domain information
>TIGR01259 comE comEA protein Back     alignment and domain information
>smart00483 POLXc DNA polymerase X family Back     alignment and domain information
>COG0353 RecR Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF11731 Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd1 is expressed as part of the pathogenicity locus operon in several different orders of bacteria [] Back     alignment and domain information
>cd00141 NT_POLXc Nucleotidyltransferase (NT) domain of family X DNA Polymerases Back     alignment and domain information
>KOG2841 consensus Structure-specific endonuclease ERCC1-XPF, ERCC1 component [Replication, recombination and repair] Back     alignment and domain information
>PF12836 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE_A 3BZK_A 3BZC_A 2DUY_A Back     alignment and domain information
>PRK07956 ligA NAD-dependent DNA ligase LigA; Validated Back     alignment and domain information
>PF11798 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases [] Back     alignment and domain information
>TIGR00575 dnlj DNA ligase, NAD-dependent Back     alignment and domain information
>PRK07945 hypothetical protein; Provisional Back     alignment and domain information
>COG1555 ComEA DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08097 ligB NAD-dependent DNA ligase LigB; Reviewed Back     alignment and domain information
>PF05559 DUF763: Protein of unknown function (DUF763); InterPro: IPR008482 This family consists of several uncharacterised bacterial and archaeal proteins of unknown function Back     alignment and domain information
>COG1555 ComEA DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01259 comE comEA protein Back     alignment and domain information
>PF10391 DNA_pol_lambd_f: Fingers domain of DNA polymerase lambda; InterPro: IPR018944 DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains Back     alignment and domain information
>PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional Back     alignment and domain information
>COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13482 DNA integrity scanning protein DisA; Provisional Back     alignment and domain information
>TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit Back     alignment and domain information
>PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed Back     alignment and domain information
>PRK08609 hypothetical protein; Provisional Back     alignment and domain information
>PF03352 Adenine_glyco: Methyladenine glycosylase; InterPro: IPR005019 This family of methyladenine glycosylases includes DNA-3-methyladenine glycosylase I (3 Back     alignment and domain information
>PF14229 DUF4332: Domain of unknown function (DUF4332) Back     alignment and domain information
>PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>smart00279 HhH2 Helix-hairpin-helix class 2 (Pol1 family) motifs Back     alignment and domain information
>PRK00024 hypothetical protein; Reviewed Back     alignment and domain information
>PRK12766 50S ribosomal protein L32e; Provisional Back     alignment and domain information
>PF12826 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS_A 1V9P_B Back     alignment and domain information
>smart00483 POLXc DNA polymerase X family Back     alignment and domain information
>cd00141 NT_POLXc Nucleotidyltransferase (NT) domain of family X DNA Polymerases Back     alignment and domain information
>PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional Back     alignment and domain information
>PRK00024 hypothetical protein; Reviewed Back     alignment and domain information
>cd00080 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) motif Back     alignment and domain information
>PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional Back     alignment and domain information
>KOG2534 consensus DNA polymerase IV (family X) [Replication, recombination and repair] Back     alignment and domain information
>COG1796 POL4 DNA polymerase IV (family X) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03118 RNA_pol_A_CTD: Bacterial RNA polymerase, alpha chain C terminal domain; InterPro: IPR011260 The core of the bacterial RNA polymerase (RNAP) consists of four subunits, two alpha, a beta and a beta', which are conserved from bacteria to mammals Back     alignment and domain information
>TIGR00426 competence protein ComEA helix-hairpin-helix repeat region Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>TIGR00608 radc DNA repair protein radc Back     alignment and domain information
>PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK09482 flap endonuclease-like protein; Provisional Back     alignment and domain information
>PF09597 IGR: IGR protein motif; InterPro: IPR019083 This entry is found in fungal and plant proteins and contains a conserved IGR motif Back     alignment and domain information
>PRK12766 50S ribosomal protein L32e; Provisional Back     alignment and domain information
>PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional Back     alignment and domain information
>PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional Back     alignment and domain information
>TIGR01954 nusA_Cterm_rpt transcription termination factor NusA, C-terminal duplication Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
1ngn_A155 Mismatch Repair In Methylated Dna. Structure Of The 9e-17
4ew4_A146 Mouse Mbd4 Glycosylase Domain In Complex With Dna C 9e-17
4e9e_A161 Structure Of The Glycosylase Domain Of Mbd4 Length 1e-16
4dk9_A157 Crystal Structure Of Mbd4 Catalytic Domain Bound To 1e-16
3iho_A138 The C-Terminal Glycosylase Domain Of Human Mbd4 Len 1e-16
4evv_A146 Mouse Mbd4 Glycosylase Domain In Complex With A G:t 3e-16
4e9g_A161 Structure Of The Glycosylase Domain Of Mbd4 Bound T 1e-15
4ea4_A155 Structure Of The Glycosylase Domain Of Mbd4 Bound T 1e-15
4ea5_A160 Structure Of The Glycoslyase Domain Of Mbd4 Bound T 1e-15
>pdb|1NGN|A Chain A, Mismatch Repair In Methylated Dna. Structure Of The Mismatch-Specific Thymine Glycosylase Domain Of Methyl-Cpg- Binding Protein Mbd4 Length = 155 Back     alignment and structure

Iteration: 1

Score = 81.6 bits (200), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 36/94 (38%), Positives = 55/94 (58%) Query: 21 VISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHG 80 V+ + P A+ A D ++ +++ LGL RA I +FS EYL + W + +LHG Sbjct: 52 VLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHG 111 Query: 81 VGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFL 114 +GKY D++ IFC +W +V P DH LN Y ++L Sbjct: 112 IGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWL 145
>pdb|4EW4|A Chain A, Mouse Mbd4 Glycosylase Domain In Complex With Dna Containing A Ribose Sugar Length = 146 Back     alignment and structure
>pdb|4E9E|A Chain A, Structure Of The Glycosylase Domain Of Mbd4 Length = 161 Back     alignment and structure
>pdb|4DK9|A Chain A, Crystal Structure Of Mbd4 Catalytic Domain Bound To Abasic Dna Length = 157 Back     alignment and structure
>pdb|3IHO|A Chain A, The C-Terminal Glycosylase Domain Of Human Mbd4 Length = 138 Back     alignment and structure
>pdb|4EVV|A Chain A, Mouse Mbd4 Glycosylase Domain In Complex With A G:t Mismatch Length = 146 Back     alignment and structure
>pdb|4E9G|A Chain A, Structure Of The Glycosylase Domain Of Mbd4 Bound To Thymine Containing Dna Length = 161 Back     alignment and structure
>pdb|4EA4|A Chain A, Structure Of The Glycosylase Domain Of Mbd4 Bound To 5hmu-Containing Dna Length = 155 Back     alignment and structure
>pdb|4EA5|A Chain A, Structure Of The Glycoslyase Domain Of Mbd4 Bound To A 5hmu Containing Dna Length = 160 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
4e9f_A161 Methyl-CPG-binding domain protein 4; HHH DNA glyco 4e-31
1orn_A226 Endonuclease III; DNA repair, DNA glycosylase, [4F 7e-04
>4e9f_A Methyl-CPG-binding domain protein 4; HHH DNA glycosylase family, hydrolase-DNA complex; HET: DNA 3DR; 1.79A {Homo sapiens} PDB: 4e9e_A* 4e9g_A* 4e9h_A* 4ea5_A* 4dk9_A* 1ngn_A 4ea4_A* 4ew4_A* 4evv_A* 4ew0_A* 3iho_A Length = 161 Back     alignment and structure
 Score =  107 bits (268), Expect = 4e-31
 Identities = 36/94 (38%), Positives = 54/94 (57%)

Query: 21  VISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHG 80
           V+       P A+ A   D  ++ +++  LGL   RA  I +FS EYL + W +  +LHG
Sbjct: 52  VLWKFLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHG 111

Query: 81  VGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFL 114
           +GKY  D++ IFC  +W +V P DH LN Y ++L
Sbjct: 112 IGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWL 145


>1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* Length = 226 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
4e9f_A161 Methyl-CPG-binding domain protein 4; HHH DNA glyco 100.0
1orn_A226 Endonuclease III; DNA repair, DNA glycosylase, [4F 99.95
1kea_A221 Possible G-T mismatches repair enzyme; DNA repair, 99.94
2abk_A211 Endonuclease III; DNA-repair, DNA glycosylase; 1.8 99.94
1kg2_A225 A/G-specific adenine glycosylase; DNA repair, hydr 99.94
1pu6_A218 3-methyladenine DNA glycosylase; helix-hairpin-hel 99.93
3n5n_X 287 A/G-specific adenine DNA glycosylase; alpha-helice 99.93
4b21_A232 Probable DNA-3-methyladenine glycosylase 2; hydrol 99.93
2h56_A233 DNA-3-methyladenine glycosidase; 10174367, EC 3.2. 99.92
2yg9_A225 DNA-3-methyladenine glycosidase II, putative; hydr 99.92
3s6i_A228 DNA-3-methyladenine glycosylase 1; DNA glycosylase 99.92
3fsp_A 369 A/G-specific adenine glycosylase; protein-DNA comp 99.92
1mpg_A282 ALKA, 3-methyladenine DNA glycosylase II; DNA repa 99.9
2jhn_A295 ALKA, 3-methyladenine DNA-glycosylase; DNA repair, 99.88
3i0w_A290 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8- 99.88
3n0u_A219 Probable N-glycosylase/DNA lyase; structural genom 99.86
3fhf_A214 Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel 99.86
3fhg_A207 Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel 99.86
2xhi_A360 N-glycosylase/DNA lyase; lyase-DNA complex, lyase/ 99.86
2ztd_A212 Holliday junction ATP-dependent DNA helicase RUVA; 96.31
4gfj_A685 Topoisomerase V; helix-hairpin-helix, DNA repair e 96.22
1ixr_A191 Holliday junction DNA helicase RUVA; heterooligome 95.98
1z00_A89 DNA excision repair protein ERCC-1; helix-hairpin- 95.87
1x2i_A75 HEF helicase/nuclease; alpha helix, helix-hairpin- 95.85
1kft_A78 UVRC, excinuclease ABC subunit C; helix-hairpin-he 95.81
2fmp_A 335 DNA polymerase beta; nucleotidyl transferase, tran 95.66
2a1j_B91 DNA excision repair protein ERCC-1; XPF, xeroderma 95.47
4glx_A586 DNA ligase; inhibitor, ligase-ligase inhibitor-DNA 95.34
1cuk_A203 RUVA protein; DNA repair, SOS response, DNA-bindin 95.34
2ihm_A 360 POL MU, DNA polymerase MU; helix-turn-helix, trans 95.3
2bcq_A 335 DNA polymerase lambda; misalignment, extrahelical, 95.02
1jms_A 381 Terminal deoxynucleotidyltransferase; polymerase; 94.96
3vdp_A 212 Recombination protein RECR; zinc finger, DNA repai 94.84
2csb_A519 Topoisomerase V, TOP61; topoisomerase IB, helix-tu 94.82
2a1j_A63 DNA repair endonuclease XPF; XPF, xeroderma pigmen 94.61
2duy_A75 Competence protein comea-related protein; helix-ha 94.49
2duy_A75 Competence protein comea-related protein; helix-ha 94.46
1vdd_A 228 Recombination protein RECR; helix-hairpin-helix, z 94.26
1s5l_U134 Photosystem II 12 kDa extrinsic protein; photosynt 94.17
2edu_A98 Kinesin-like protein KIF22; kinesin-like DNA bindi 93.93
2a1j_A63 DNA repair endonuclease XPF; XPF, xeroderma pigmen 93.42
2owo_A671 DNA ligase; protein-DNA complex, ligase-DNA comple 92.99
2bgw_A219 XPF endonuclease; hydrolase, structure specific en 92.79
1z00_B84 DNA repair endonuclease XPF; helix-hairpin-helix, 92.56
3arc_U97 Photosystem II 12 kDa extrinsic protein; PSII, mem 92.46
2fmp_A 335 DNA polymerase beta; nucleotidyl transferase, tran 92.45
2kp7_A87 Crossover junction endonuclease MUS81; helix-hairp 92.22
1s5l_U134 Photosystem II 12 kDa extrinsic protein; photosynt 92.14
1wcn_A70 Transcription elongation protein NUSA; RNA-binding 92.01
1z00_B84 DNA repair endonuclease XPF; helix-hairpin-helix, 91.93
2i5h_A205 Hypothetical protein AF1531; PFAM:DUF655, PSI-2, s 91.87
3arc_U97 Photosystem II 12 kDa extrinsic protein; PSII, mem 91.34
1dgs_A667 DNA ligase; AMP complex, NAD+-dependent; HET: DNA 91.23
2ihm_A 360 POL MU, DNA polymerase MU; helix-turn-helix, trans 91.04
2edu_A98 Kinesin-like protein KIF22; kinesin-like DNA bindi 90.92
1ixr_A191 Holliday junction DNA helicase RUVA; heterooligome 90.78
2ztd_A212 Holliday junction ATP-dependent DNA helicase RUVA; 90.55
3c1y_A377 DNA integrity scanning protein DISA; DNA damage, D 89.88
3b0x_A 575 DNA polymerase beta family (X family); structural 89.84
2jg6_A186 DNA-3-methyladenine glycosidase; 3-methyladenine-D 89.78
2w9m_A 578 Polymerase X; SAXS, DNA repair, DNA polymerase, DN 89.28
1cuk_A203 RUVA protein; DNA repair, SOS response, DNA-bindin 88.98
1z00_A89 DNA excision repair protein ERCC-1; helix-hairpin- 88.67
1jms_A 381 Terminal deoxynucleotidyltransferase; polymerase; 88.53
3sgi_A615 DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tub 88.51
1kft_A78 UVRC, excinuclease ABC subunit C; helix-hairpin-he 88.2
1x2i_A75 HEF helicase/nuclease; alpha helix, helix-hairpin- 88.13
2ofk_A183 3-methyladenine DNA glycosylase I, constitutive; D 87.49
2bcq_A 335 DNA polymerase lambda; misalignment, extrahelical, 87.41
2a1j_B91 DNA excision repair protein ERCC-1; XPF, xeroderma 86.67
1u9l_A70 Transcription elongation protein NUSA; escherichia 86.65
1z3e_B73 DNA-directed RNA polymerase alpha chain; bacterial 85.22
2w9m_A 578 Polymerase X; SAXS, DNA repair, DNA polymerase, DN 83.9
3k4g_A86 DNA-directed RNA polymerase subunit alpha; bacteri 83.53
4gfj_A 685 Topoisomerase V; helix-hairpin-helix, DNA repair e 82.45
1dgs_A 667 DNA ligase; AMP complex, NAD+-dependent; HET: DNA 82.16
1vq8_Y 241 50S ribosomal protein L32E; ribosome 50S, protein- 82.14
2bgw_A219 XPF endonuclease; hydrolase, structure specific en 80.94
1b22_A114 DNA repair protein RAD51; DNA binding, riken struc 80.17
3gfk_B79 DNA-directed RNA polymerase subunit alpha; protein 80.13
>4e9f_A Methyl-CPG-binding domain protein 4; HHH DNA glycosylase family, hydrolase-DNA complex; HET: DNA 3DR; 1.79A {Homo sapiens} PDB: 4e9e_A* 4e9g_A* 4e9h_A* 4ea5_A* 4dk9_A* 1ngn_A 4ea4_A* 4ew4_A* 4evv_A* 4ew0_A* 3iho_A Back     alignment and structure
Probab=100.00  E-value=2.9e-35  Score=212.89  Aligned_cols=114  Identities=33%  Similarity=0.650  Sum_probs=106.1

Q ss_pred             HHHHHHHH----HHHHHHHHHHHHHHHhCCCHHHHhcCCHHHHHHHHhhcCChhHHHHHHHHHHHHHHHhhHHHhccCCC
Q 033363            5 YSIRLKEI----AILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHG   80 (121)
Q Consensus         5 ~si~~~~~----~~~~~v~~v~~~l~~~~pt~~~la~a~~~eL~~~i~~~Gl~~~Ka~~i~~~a~~i~~~~~~~L~~lpG   80 (121)
                      |.+.+++|    |++++|++++.+|+++||||++|+++++++|+++|+++|||++||++|+++|+.++.+++++|++|||
T Consensus        32 ~~vLVs~ILsqQT~~~~v~~~~~~l~~~~pt~~~la~a~~~el~~~i~~lG~y~~KAk~i~~~a~~~vp~~~~~L~~LpG  111 (161)
T 4e9f_A           32 WKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHG  111 (161)
T ss_dssp             HHHHHHHHHTTTSCHHHHHHHHHHHHHHSCSHHHHTTSCHHHHHHHHGGGSCHHHHHHHHHHHHHHHHHSCCSSGGGSTT
T ss_pred             HHHHHHHHHHhhCcHHHHHHHHHHHHHHCCCHHHHhccChHhHHhHhhhcCCHHHHHHHHHHHhCCcCCCChhhhhcCCC
Confidence            45555555    56789999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcHHHHHHHHHHhcCCCCccCcchHHHHHHHHHHHHhh
Q 033363           81 VGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVSTK  118 (121)
Q Consensus        81 IG~~tA~~vl~f~~~~~~~v~p~D~~l~~~~~wl~~~~  118 (121)
                      ||+||||++++||+|++..|+|+|+++++|++|+++..
T Consensus       112 VG~yTAdav~~F~~~e~~~V~p~D~~l~r~l~wl~~~~  149 (161)
T 4e9f_A          112 IGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENH  149 (161)
T ss_dssp             CCHHHHHHHHHHTSSCGGGCCCCSHHHHHHHHHHHHTC
T ss_pred             chHHHHHHHHHHHCCCCCCCCCCcHHHHHHHHHHHcCc
Confidence            99999999999999987779999999999999998764



>1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* Back     alignment and structure
>1kea_A Possible G-T mismatches repair enzyme; DNA repair, DNA glycosylase, DNA mismatch, methylation; 2.00A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.96.1.2 Back     alignment and structure
>2abk_A Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {Escherichia coli} SCOP: a.96.1.1 Back     alignment and structure
>1kg2_A A/G-specific adenine glycosylase; DNA repair, hydrolase; 1.20A {Escherichia coli} SCOP: a.96.1.2 PDB: 1kg3_A 1muy_A 1kg6_A 1kg5_A 1mun_A 1mud_A 1kg4_A 1weg_A 1wei_A* 1wef_A* 1kg7_A 1kqj_A Back     alignment and structure
>1pu6_A 3-methyladenine DNA glycosylase; helix-hairpin-helix, base excision repair, hydrolase; HET: KCX; 1.64A {Helicobacter pylori} SCOP: a.96.1.5 PDB: 1pu7_A* 1pu8_A* Back     alignment and structure
>3n5n_X A/G-specific adenine DNA glycosylase; alpha-helices, helix-hairpin-helix motif, iron-sulfur cluste hydrolase; 2.30A {Homo sapiens} Back     alignment and structure
>4b21_A Probable DNA-3-methyladenine glycosylase 2; hydrolase-DNA complex, helix-hairpin-helix; HET: BGC 3DR; 1.45A {Schizosaccharomyces pombe} PDB: 4b22_A* 4b23_A* 4b24_A* Back     alignment and structure
>2h56_A DNA-3-methyladenine glycosidase; 10174367, EC 3.2.2.-, struc genomics, PSI-2, protein structure initiative, joint center structural genomics; 2.55A {Bacillus halodurans} Back     alignment and structure
>2yg9_A DNA-3-methyladenine glycosidase II, putative; hydrolase, DNA repair; 1.95A {Deinococcus radiodurans} PDB: 2yg8_A Back     alignment and structure
>3s6i_A DNA-3-methyladenine glycosylase 1; DNA glycosylase, DNA repair, helix-hairpin-helix (HHH), ABAS tetrahydrofuran (THF); HET: 3DR; 2.28A {Schizosaccharomyces pombe} Back     alignment and structure
>3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Back     alignment and structure
>1mpg_A ALKA, 3-methyladenine DNA glycosylase II; DNA repair, base excision, methylation, ALK hydrolase; 1.80A {Escherichia coli} SCOP: a.96.1.3 d.129.1.2 PDB: 1diz_A 1pvs_A* 3cvs_A* 3cvt_A* 3cw7_A* 3cwa_A* 3cws_A* 3cwt_A* 3cwu_A* 3d4v_A* 3ogd_A* 3oh9_A* 3oh6_A* Back     alignment and structure
>2jhn_A ALKA, 3-methyladenine DNA-glycosylase; DNA repair, N1-methyladenine, N3-methylcytosine, hyperthermophiles, hydrolase; HET: MBO MES; 1.8A {Archaeoglobus fulgidus} PDB: 2jhj_A Back     alignment and structure
>3i0w_A 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8-OXOG, 8OXOG, glycosylase, cytosine, hydrolase,lyase/DNA complex; HET: 8OG; 1.73A {Clostridium acetobutylicum} PDB: 3i0x_A* 3f10_A* 3f0z_A Back     alignment and structure
>3n0u_A Probable N-glycosylase/DNA lyase; structural genomics, ISFI, DNA repair, 8-oxoguanine, base EX repair, PSI-2, protein structure initiative; 1.50A {Thermotoga maritima} Back     alignment and structure
>3fhf_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase; 2.00A {Methanocaldococcus jannaschii} PDB: 3knt_A* Back     alignment and structure
>3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>2xhi_A N-glycosylase/DNA lyase; lyase-DNA complex, lyase/DNA complex, separation-OF-function helix-hairpin-helix, DNA repair; HET: 8OG; 1.55A {Homo sapiens} PDB: 1ko9_A 1lwy_A* 1hu0_A* 1lwv_A* 1lww_A* 2noe_A* 2noh_A* 2nol_A* 1n3c_A* 1fn7_A* 2noz_A* 1yqk_A 1yqr_A* 1yql_A* 1yqm_A* 2noi_A 1ebm_A* 1m3q_A* 1m3h_A* 1n39_A* ... Back     alignment and structure
>2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA BIND oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A Back     alignment and structure
>4gfj_A Topoisomerase V; helix-hairpin-helix, DNA repair enzyme, DNA B isomerase; 2.91A {Methanopyrus kandleri AV19} Back     alignment and structure
>1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2 Back     alignment and structure
>1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 Back     alignment and structure
>1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 Back     alignment and structure
>2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ... Back     alignment and structure
>2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>4glx_A DNA ligase; inhibitor, ligase-ligase inhibitor-DNA complex; HET: DNA 0XS; 1.90A {Escherichia coli} Back     alignment and structure
>1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A Back     alignment and structure
>2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus} Back     alignment and structure
>2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ... Back     alignment and structure
>1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A* Back     alignment and structure
>3vdp_A Recombination protein RECR; zinc finger, DNA repair, DNA binding; 2.45A {Thermoanaerobacter tengcongensis} PDB: 3vdu_A 3ve5_D Back     alignment and structure
>2csb_A Topoisomerase V, TOP61; topoisomerase IB, helix-turn-helix, helix-H helix, HHH motif, three helix bundle, methanopyrus kandleri isomerase; 2.30A {Methanopyrus kandleri} SCOP: a.60.2.4 a.60.2.4 a.60.2.4 a.60.2.4 a.267.1.1 PDB: 2csd_A Back     alignment and structure
>2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* Back     alignment and structure
>2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 Back     alignment and structure
>2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 Back     alignment and structure
>1vdd_A Recombination protein RECR; helix-hairpin-helix, zinc finger, toprim, walker B ATP binding motif; 2.50A {Deinococcus radiodurans} SCOP: e.49.1.1 PDB: 2v1c_A Back     alignment and structure
>1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 Back     alignment and structure
>2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* Back     alignment and structure
>2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} Back     alignment and structure
>2bgw_A XPF endonuclease; hydrolase, structure specific endonuclease, nucleotide excision repair; 2.8A {Aeropyrum pernix} SCOP: a.60.2.5 c.52.1.20 PDB: 2bhn_A Back     alignment and structure
>1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* Back     alignment and structure
>3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* Back     alignment and structure
>2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ... Back     alignment and structure
>2kp7_A Crossover junction endonuclease MUS81; helix-hairpin-helix, tumour suppressor, DNA damage, DNA recombination, DNA repair, hydrolase, magnesium; NMR {Mus musculus} Back     alignment and structure
>1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1wcn_A Transcription elongation protein NUSA; RNA-binding protein, escherichia coli NUSA, transcription regulation, regulation of RNA binding; NMR {Escherichia coli} PDB: 2jzb_B Back     alignment and structure
>1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* Back     alignment and structure
>2i5h_A Hypothetical protein AF1531; PFAM:DUF655, PSI-2, structural genomics, protein structure initiative; 1.74A {Archaeoglobus fulgidus} SCOP: e.71.1.1 Back     alignment and structure
>3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* Back     alignment and structure
>1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* Back     alignment and structure
>2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus} Back     alignment and structure
>2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 Back     alignment and structure
>1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2 Back     alignment and structure
>2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA BIND oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A Back     alignment and structure
>3c1y_A DNA integrity scanning protein DISA; DNA damage, DNA repair, DNA-binding, DNA binding protein; HET: DNA 2BA; 2.10A {Thermotoga maritima} PDB: 3c1z_A* 3c21_A* 3c23_A* Back     alignment and structure
>3b0x_A DNA polymerase beta family (X family); structural genomics, riken structural genomics/proteomics in RSGI, polxc, PHP, DRP lyase; HET: DNA DGT; 1.36A {Thermus thermophilus} PDB: 3au2_A* 3au6_A* 3auo_A* 3b0y_A* Back     alignment and structure
>2jg6_A DNA-3-methyladenine glycosidase; 3-methyladenine-DNA-glycosylase-I, hydrolase; 1.70A {Staphylococcus aureus} PDB: 4aia_A* 4ai5_A* 4ai4_A Back     alignment and structure
>2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans} Back     alignment and structure
>1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A Back     alignment and structure
>1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A* Back     alignment and structure
>3sgi_A DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 Back     alignment and structure
>1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 Back     alignment and structure
>2ofk_A 3-methyladenine DNA glycosylase I, constitutive; DNA repair, base excision, helix-hairpin-helix, hydrolase; HET: PGE; 1.50A {Salmonella typhi} PDB: 2ofi_A* 1lmz_A 1nku_A 1p7m_A* Back     alignment and structure
>2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ... Back     alignment and structure
>2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 Back     alignment and structure
>1u9l_A Transcription elongation protein NUSA; escherichia coli NUSA, phage lambda protein N, regulation of RNA binding, transcription antitermination, X-RAY crystallography; 1.90A {Escherichia coli} SCOP: a.60.4.2 PDB: 1wcl_A Back     alignment and structure
>1z3e_B DNA-directed RNA polymerase alpha chain; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: a.60.3.1 PDB: 3ihq_B Back     alignment and structure
>2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans} Back     alignment and structure
>3k4g_A DNA-directed RNA polymerase subunit alpha; bacterial transcription regulation, DNA-directed RNA polymer nucleotidyltransferase; HET: MLY; 2.05A {Escherichia coli k-12} SCOP: a.60.3.1 PDB: 3n4m_B* 1lb2_B* 3n97_B* 1xs9_D Back     alignment and structure
>4gfj_A Topoisomerase V; helix-hairpin-helix, DNA repair enzyme, DNA B isomerase; 2.91A {Methanopyrus kandleri AV19} Back     alignment and structure
>1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* Back     alignment and structure
>1vq8_Y 50S ribosomal protein L32E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.9.2.1 PDB: 1vq4_Y* 1vq5_Y* 1vq6_Y* 1vq7_Y* 1s72_Y* 1vq9_Y* 1vqk_Y* 1vql_Y* 1vqm_Y* 1vqn_Y* 1vqo_Y* 1vqp_Y* 1yhq_Y* 1yi2_Y* 1yij_Y* 1yit_Y* 1yj9_Y* 1yjn_Y* 1yjw_Y* 2otj_Y* ... Back     alignment and structure
>2bgw_A XPF endonuclease; hydrolase, structure specific endonuclease, nucleotide excision repair; 2.8A {Aeropyrum pernix} SCOP: a.60.2.5 c.52.1.20 PDB: 2bhn_A Back     alignment and structure
>1b22_A DNA repair protein RAD51; DNA binding, riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.60.4.1 Back     alignment and structure
>3gfk_B DNA-directed RNA polymerase subunit alpha; protein-protein complex, cytoplasm, redox-active center, stress response, transcription; 2.30A {Bacillus subtilis} SCOP: a.60.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 121
d1ngna_144 a.96.1.2 (A:) Mismatch-specific thymine glycosylas 2e-14
>d1ngna_ a.96.1.2 (A:) Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 Back     information, alignment and structure

class: All alpha proteins
fold: DNA-glycosylase
superfamily: DNA-glycosylase
family: Mismatch glycosylase
domain: Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 63.2 bits (153), Expect = 2e-14
 Identities = 36/95 (37%), Positives = 55/95 (57%)

Query: 20  RVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLH 79
            V+ +     P A+ A   D  ++ +++  LGL   RA  I +FS EYL + W +  +LH
Sbjct: 40  PVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELH 99

Query: 80  GVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFL 114
           G+GKY  D++ IFC  +W +V P DH LN Y ++L
Sbjct: 100 GIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWL 134


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d1ngna_144 Mismatch-specific thymine glycosylase domain of th 100.0
d1keaa_217 Thymine-DNA glycosylase {Archaeon Methanobacterium 99.95
d2abka_211 Endonuclease III {Escherichia coli [TaxId: 562]} 99.95
d1orna_214 Endonuclease III {Escherichia coli [TaxId: 562]} 99.94
d1kg2a_224 Catalytic domain of MutY {Escherichia coli [TaxId: 99.94
d1pu6a_217 3-Methyladenine DNA glycosylase III (MagIII) {Heli 99.94
d1rrqa1221 Catalytic domain of MutY {Bacillus stearothermophi 99.93
d1mpga1183 3-Methyladenine DNA glycosylase II (gene alkA or a 99.89
d2noha1190 8-oxoguanine glycosylase {Human (Homo sapiens) [Ta 99.88
d1ixra173 DNA helicase RuvA subunit, middle domain {Thermus 97.33
d1cuka278 DNA helicase RuvA subunit, middle domain {Escheric 97.25
d1bvsa271 DNA helicase RuvA subunit, middle domain {Mycobact 97.24
d2fmpa182 DNA polymerase beta, N-terminal (8 kD)-domain {Hum 96.92
d2bcqa176 DNA polymerase lambda {Human (Homo sapiens) [TaxId 96.89
d1x2ia168 ATP-dependent RNA helicase PF2015 {Pyrococcus furi 96.69
d2i1qa160 DNA repair protein Rad51, N-terminal domain {Archa 96.57
d1kfta_56 Excinuclease UvrC C-terminal domain {Escherichia c 96.39
d1pzna161 DNA repair protein Rad51, N-terminal domain {Archa 96.13
d2i1qa160 DNA repair protein Rad51, N-terminal domain {Archa 95.92
d2a1ja162 DNA repair endonuclease XPF {Human (Homo sapiens) 95.9
d1jmsa195 Terminal deoxynucleotidyl transferase {Mouse (Mus 95.88
d2bgwa170 DNA repair endonuclease XPF {Aeropyrum pernix [Tax 95.76
d1dgsa1181 NAD+-dependent DNA ligase, domain 3 {Thermus filif 95.75
d1pzna161 DNA repair protein Rad51, N-terminal domain {Archa 95.4
d1vdda_ 199 Recombination protein RecR {Deinococcus radioduran 94.55
d2bgwa170 DNA repair endonuclease XPF {Aeropyrum pernix [Tax 94.41
d2edua191 KIF22, C-terminal domain {Human (Homo sapiens) [Ta 94.29
d2a1ja162 DNA repair endonuclease XPF {Human (Homo sapiens) 94.29
d1kfta_56 Excinuclease UvrC C-terminal domain {Escherichia c 94.28
d2a1jb178 DNA excision repair protein ERCC-1 {Human (Homo sa 94.21
d1bvsa271 DNA helicase RuvA subunit, middle domain {Mycobact 94.1
d3bzka190 Transcriptional accessory factor Tex {Pseudomonas 94.09
d1szpa164 DNA repair protein Rad51, N-terminal domain {Baker 94.04
d2duya165 Uncharacterized protein TTHA1967 {Thermus thermoph 94.04
d1jmsa360 Terminal deoxynucleotidyl transferase {Mouse (Mus 93.74
d2a1jb178 DNA excision repair protein ERCC-1 {Human (Homo sa 93.59
d2edua191 KIF22, C-terminal domain {Human (Homo sapiens) [Ta 93.58
d2fmpa257 DNA polymerase beta {Human (Homo sapiens) [TaxId: 93.54
d3bzka190 Transcriptional accessory factor Tex {Pseudomonas 93.26
d1ixra173 DNA helicase RuvA subunit, middle domain {Thermus 93.15
d1cuka278 DNA helicase RuvA subunit, middle domain {Escheric 93.13
d1x2ia168 ATP-dependent RNA helicase PF2015 {Pyrococcus furi 92.25
d2axtu198 Photosystem II 12 kDa extrinsic protein PsbU {Ther 92.08
d2bcqa257 DNA polymerase lambda {Human (Homo sapiens) [TaxId 91.64
d2duya165 Uncharacterized protein TTHA1967 {Thermus thermoph 91.29
d1b22a_70 DNA repair protein Rad51, N-terminal domain {Human 91.26
d1doqa_69 C-terminal domain of RNA polymerase alpha subunit 91.08
d2csba355 Topoisomerase V {Methanopyrus kandleri [TaxId: 232 90.09
d1a77a1108 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met 88.86
d2axtu198 Photosystem II 12 kDa extrinsic protein PsbU {Ther 88.54
d1rxwa1105 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc 87.47
d1szpa164 DNA repair protein Rad51, N-terminal domain {Baker 87.07
d1xo1a1105 T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726] 85.19
d1z3eb167 C-terminal domain of RNA polymerase alpha subunit 83.79
d1ul1x1140 Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo 83.36
d1nkua_187 3-Methyladenine DNA glycosylase I (Tag) {Escherich 82.53
d1b43a1120 Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyr 82.49
d2e1fa194 Werner syndrome ATP-dependent helicase, WRN {Human 80.9
>d1ngna_ a.96.1.2 (A:) Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA-glycosylase
superfamily: DNA-glycosylase
family: Mismatch glycosylase
domain: Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=3.4e-35  Score=207.17  Aligned_cols=116  Identities=32%  Similarity=0.605  Sum_probs=107.3

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHhcCCHHHHHHHHhhcCChhHHHHHHHHHHHHHHHhhHHHhccCCCCcH
Q 033363            4 IYSIRLKEIAILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHGVGK   83 (121)
Q Consensus         4 ~~si~~~~~~~~~~v~~v~~~l~~~~pt~~~la~a~~~eL~~~i~~~Gl~~~Ka~~i~~~a~~i~~~~~~~L~~lpGIG~   83 (121)
                      +.+..+++++++++|++++.+|+++||||+++++++.++|+++|+++||+++||++|+++|+.++.++.++|++|||||+
T Consensus        24 LV~~ILsqqT~~~~v~~v~~~L~~~~pt~e~la~a~~~el~~~Ir~~G~~~~KAk~I~~~a~~~ip~~~~~l~~LpGVG~  103 (144)
T d1ngna_          24 LIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGK  103 (144)
T ss_dssp             HHHHHHHTTSCHHHHHHHHHHHHHHSCSHHHHHHSCHHHHHHHTGGGSCHHHHHHHHHHHHHHHHHSCCSSGGGSTTCCH
T ss_pred             HHHHHHHccCCHHHHHHHHHHHHHhCCchhhhhccCHHHHHHHHHhhhhHHHHHHHHHHHHhhHhhhhhhhHHhcCCccH
Confidence            34555555566789999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCCCccCcchHHHHHHHHHHHHhhc
Q 033363           84 YAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVSTKG  119 (121)
Q Consensus        84 ~tA~~vl~f~~~~~~~v~p~D~~l~~~~~wl~~~~~  119 (121)
                      |||+++++|++|+.+.++|+||++++|++|+++...
T Consensus       104 ~tad~~~if~~~~~~~v~~~D~~l~r~~~~~~~~~~  139 (144)
T d1ngna_         104 YGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHE  139 (144)
T ss_dssp             HHHHHHHHHTSSCGGGCCCCSHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHcCCCCCCCCCChHHHHHHHHHHcCcc
Confidence            999999999999987799999999999999997653



>d1keaa_ a.96.1.2 (A:) Thymine-DNA glycosylase {Archaeon Methanobacterium thermoformicicum [TaxId: 145262]} Back     information, alignment and structure
>d2abka_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orna_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kg2a_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pu6a_ a.96.1.5 (A:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1rrqa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mpga1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2noha1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d2fmpa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcqa1 a.60.6.1 (A:252-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmsa1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1dgsa1 a.60.2.2 (A:401-581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]} Back     information, alignment and structure
>d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vdda_ e.49.1.1 (A:) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1doqa_ a.60.3.1 (A:) C-terminal domain of RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2csba3 a.60.2.4 (A:410-464) Topoisomerase V {Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} Back     information, alignment and structure
>d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} Back     information, alignment and structure
>d1z3eb1 a.60.3.1 (B:245-311) C-terminal domain of RNA polymerase alpha subunit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkua_ a.96.1.4 (A:) 3-Methyladenine DNA glycosylase I (Tag) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2e1fa1 a.60.8.1 (A:1142-1235) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure