Citrus Sinensis ID: 033363
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| 255546672 | 608 | conserved hypothetical protein [Ricinus | 0.776 | 0.154 | 0.819 | 9e-42 | |
| 297829352 | 435 | hypothetical protein ARALYDRAFT_896965 [ | 0.776 | 0.216 | 0.797 | 5e-41 | |
| 356551311 | 1505 | PREDICTED: uncharacterized protein LOC10 | 0.842 | 0.067 | 0.725 | 7e-40 | |
| 296085641 | 599 | unnamed protein product [Vitis vinifera] | 0.818 | 0.165 | 0.747 | 1e-39 | |
| 224118080 | 107 | predicted protein [Populus trichocarpa] | 0.876 | 0.990 | 0.698 | 1e-39 | |
| 147837937 | 635 | hypothetical protein VITISV_044254 [Viti | 0.842 | 0.160 | 0.737 | 2e-39 | |
| 225469167 | 536 | PREDICTED: uncharacterized protein LOC10 | 0.818 | 0.184 | 0.747 | 2e-39 | |
| 42572315 | 445 | methyl-CpG-binding domain protein 4 [Ara | 0.776 | 0.211 | 0.776 | 3e-39 | |
| 6648205 | 419 | hypothetical protein [Arabidopsis thalia | 0.776 | 0.224 | 0.776 | 3e-39 | |
| 27754344 | 407 | unknown protein [Arabidopsis thaliana] | 0.776 | 0.230 | 0.776 | 4e-39 |
| >gi|255546672|ref|XP_002514395.1| conserved hypothetical protein [Ricinus communis] gi|223546492|gb|EEF47991.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 174 bits (440), Expect = 9e-42, Method: Compositional matrix adjust.
Identities = 77/94 (81%), Positives = 82/94 (87%)
Query: 21 VISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHG 80
VISD FTLCPDAK ATE EEIEKII LGLQKKRA MI+R SQEYL + WTHVTQLHG
Sbjct: 508 VISDFFTLCPDAKAATEAKTEEIEKIIVPLGLQKKRAVMIQRLSQEYLADDWTHVTQLHG 567
Query: 81 VGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFL 114
VGKYAADA+AIFCTGKWD+VRP DHMLNYYW+FL
Sbjct: 568 VGKYAADAYAIFCTGKWDQVRPKDHMLNYYWDFL 601
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297829352|ref|XP_002882558.1| hypothetical protein ARALYDRAFT_896965 [Arabidopsis lyrata subsp. lyrata] gi|297328398|gb|EFH58817.1| hypothetical protein ARALYDRAFT_896965 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356551311|ref|XP_003544020.1| PREDICTED: uncharacterized protein LOC100793802 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296085641|emb|CBI29440.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224118080|ref|XP_002317727.1| predicted protein [Populus trichocarpa] gi|222858400|gb|EEE95947.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147837937|emb|CAN67143.1| hypothetical protein VITISV_044254 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225469167|ref|XP_002271845.1| PREDICTED: uncharacterized protein LOC100244192 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|42572315|ref|NP_974253.1| methyl-CpG-binding domain protein 4 [Arabidopsis thaliana] gi|114050633|gb|ABI49466.1| At3g07930 [Arabidopsis thaliana] gi|332641100|gb|AEE74621.1| methyl-CpG-binding domain protein 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|6648205|gb|AAF21203.1|AC013483_27 hypothetical protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|27754344|gb|AAO22623.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 121 | ||||||
| TAIR|locus:2077357 | 445 | AT3G07930 [Arabidopsis thalian | 0.776 | 0.211 | 0.776 | 6.3e-37 | |
| UNIPROTKB|O95243 | 580 | MBD4 "Methyl-CpG-binding domai | 0.702 | 0.146 | 0.411 | 1.3e-16 | |
| UNIPROTKB|Q2MD36 | 262 | MBD4 "Methyl-CpG-binding domai | 0.702 | 0.324 | 0.411 | 2.3e-16 | |
| UNIPROTKB|E1BVB1 | 108 | MBD4 "Uncharacterized protein" | 0.702 | 0.787 | 0.411 | 7.7e-16 | |
| UNIPROTKB|F1P366 | 199 | MBD4 "Uncharacterized protein" | 0.702 | 0.427 | 0.411 | 7.7e-16 | |
| MGI|MGI:1333850 | 554 | Mbd4 "methyl-CpG binding domai | 0.702 | 0.153 | 0.411 | 2.4e-15 | |
| UNIPROTKB|E2RL50 | 570 | MBD4 "Uncharacterized protein" | 0.702 | 0.149 | 0.411 | 3.3e-15 | |
| UNIPROTKB|F1MUX1 | 554 | MBD4 "Uncharacterized protein" | 0.702 | 0.153 | 0.411 | 4e-15 | |
| UNIPROTKB|E9PEE4 | 572 | MBD4 "Methyl-CpG-binding domai | 0.611 | 0.129 | 0.405 | 3.3e-13 | |
| RGD|1585874 | 530 | Mbd4 "methyl-CpG binding domai | 0.537 | 0.122 | 0.461 | 1.3e-11 |
| TAIR|locus:2077357 AT3G07930 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 397 (144.8 bits), Expect = 6.3e-37, P = 6.3e-37
Identities = 73/94 (77%), Positives = 79/94 (84%)
Query: 21 VISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHG 80
VISDLF LC DAKTATEV EEIE +I LGLQKKR MI+R S EYL ESWTHVTQLHG
Sbjct: 346 VISDLFGLCTDAKTATEVKEEEIENLIKPLGLQKKRTKMIQRLSLEYLQESWTHVTQLHG 405
Query: 81 VGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFL 114
VGKYAADA+AIFC G WDRV+P DHMLNYYW++L
Sbjct: 406 VGKYAADAYAIFCNGNWDRVKPNDHMLNYYWDYL 439
|
|
| UNIPROTKB|O95243 MBD4 "Methyl-CpG-binding domain protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2MD36 MBD4 "Methyl-CpG-binding domain protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVB1 MBD4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P366 MBD4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1333850 Mbd4 "methyl-CpG binding domain protein 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RL50 MBD4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MUX1 MBD4 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PEE4 MBD4 "Methyl-CpG-binding domain protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1585874 Mbd4 "methyl-CpG binding domain protein 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 121 | |||
| pfam00730 | 144 | pfam00730, HhH-GPD, HhH-GPD superfamily base excis | 2e-13 | |
| smart00478 | 149 | smart00478, ENDO3c, endonuclease III | 3e-04 | |
| cd00056 | 158 | cd00056, ENDO3c, endonuclease III; includes endonu | 0.002 | |
| COG0177 | 211 | COG0177, Nth, Predicted EndoIII-related endonuclea | 0.002 |
| >gnl|CDD|216088 pfam00730, HhH-GPD, HhH-GPD superfamily base excision DNA repair protein | Back alignment and domain information |
|---|
Score = 61.6 bits (150), Expect = 2e-13
Identities = 28/115 (24%), Positives = 48/115 (41%), Gaps = 14/115 (12%)
Query: 18 AGRVISDLFTLC--PDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHV 75
A ++ LF P + E D EE+ ++I LG +++A IK ++ + V
Sbjct: 14 ANKITKRLFERYGFPTPEDLAEADEEELRELIKGLGFYRRKAKYIKELARILVEGYLGLV 73
Query: 76 ----------TQLHGVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWE--FLVSTK 118
L GVG++ A+A +F G+ D D + + L+ TK
Sbjct: 74 PLDLEELEALLALPGVGRWTAEAVLLFALGRPDVFPAVDTHVRRVAKRLGLIDTK 128
|
This family contains a diverse range of structurally related DNA repair proteins. The superfamily is called the HhH-GPD family after its hallmark Helix-hairpin-helix and Gly/Pro rich loop followed by a conserved aspartate. This includes endonuclease III, EC:4.2.99.18 and MutY an A/G-specific adenine glycosylase, both have a C terminal 4Fe-4S cluster. The family also includes 8-oxoguanine DNA glycosylases. The methyl-CPG binding protein MBD4 also contains a related domain that is a thymine DNA glycosylase. The family also includes DNA-3-methyladenine glycosylase II EC:3.2.2.21 and other members of the AlkA family. Length = 144 |
| >gnl|CDD|214684 smart00478, ENDO3c, endonuclease III | Back alignment and domain information |
|---|
| >gnl|CDD|238013 cd00056, ENDO3c, endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases | Back alignment and domain information |
|---|
| >gnl|CDD|223255 COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| COG0177 | 211 | Nth Predicted EndoIII-related endonuclease [DNA re | 99.97 | |
| PRK10702 | 211 | endonuclease III; Provisional | 99.96 | |
| PRK13913 | 218 | 3-methyladenine DNA glycosylase; Provisional | 99.95 | |
| TIGR01083 | 191 | nth endonuclease III. This equivalog model identif | 99.95 | |
| PRK10880 | 350 | adenine DNA glycosylase; Provisional | 99.94 | |
| TIGR01084 | 275 | mutY A/G-specific adenine glycosylase. This equiva | 99.94 | |
| PRK13910 | 289 | DNA glycosylase MutY; Provisional | 99.93 | |
| smart00478 | 149 | ENDO3c endonuclease III. includes endonuclease III | 99.93 | |
| cd00056 | 158 | ENDO3c endonuclease III; includes endonuclease III | 99.92 | |
| COG1194 | 342 | MutY A/G-specific DNA glycosylase [DNA replication | 99.88 | |
| COG0122 | 285 | AlkA 3-methyladenine DNA glycosylase/8-oxoguanine | 99.88 | |
| PRK10308 | 283 | 3-methyl-adenine DNA glycosylase II; Provisional | 99.86 | |
| TIGR00588 | 310 | ogg 8-oxoguanine DNA-glycosylase (ogg). All protei | 99.85 | |
| TIGR03252 | 177 | uncharacterized HhH-GPD family protein. This model | 99.83 | |
| PRK01229 | 208 | N-glycosylase/DNA lyase; Provisional | 99.81 | |
| COG2231 | 215 | Uncharacterized protein related to Endonuclease II | 99.81 | |
| KOG1921 | 286 | consensus Endonuclease III [Replication, recombina | 99.8 | |
| KOG1918 | 254 | consensus 3-methyladenine DNA glycosidase [Replica | 99.74 | |
| PF00730 | 108 | HhH-GPD: HhH-GPD superfamily base excision DNA rep | 99.67 | |
| KOG2457 | 555 | consensus A/G-specific adenine DNA glycosylase [Re | 99.61 | |
| KOG2875 | 323 | consensus 8-oxoguanine DNA glycosylase [Replicatio | 99.57 | |
| PF00633 | 30 | HHH: Helix-hairpin-helix motif; InterPro: IPR00044 | 98.67 | |
| COG1059 | 210 | Thermostable 8-oxoguanine DNA glycosylase [DNA rep | 97.43 | |
| PF14716 | 68 | HHH_8: Helix-hairpin-helix domain; PDB: 2W9M_A 1HU | 97.03 | |
| smart00278 | 26 | HhH1 Helix-hairpin-helix DNA-binding motif class 1 | 96.95 | |
| PRK13901 | 196 | ruvA Holliday junction DNA helicase RuvA; Provisio | 96.91 | |
| PF12826 | 64 | HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS | 96.91 | |
| PRK14606 | 188 | ruvA Holliday junction DNA helicase RuvA; Provisio | 96.51 | |
| PRK14601 | 183 | ruvA Holliday junction DNA helicase RuvA; Provisio | 96.51 | |
| PRK14602 | 203 | ruvA Holliday junction DNA helicase RuvA; Provisio | 96.41 | |
| PRK14603 | 197 | ruvA Holliday junction DNA helicase RuvA; Provisio | 96.34 | |
| COG0632 | 201 | RuvA Holliday junction resolvasome, DNA-binding su | 96.33 | |
| PRK14604 | 195 | ruvA Holliday junction DNA helicase RuvA; Provisio | 96.31 | |
| PRK14605 | 194 | ruvA Holliday junction DNA helicase RuvA; Provisio | 96.2 | |
| TIGR00084 | 191 | ruvA Holliday junction DNA helicase, RuvA subunit. | 95.96 | |
| PRK14600 | 186 | ruvA Holliday junction DNA helicase RuvA; Provisio | 95.9 | |
| PF14520 | 60 | HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU | 95.83 | |
| PF02371 | 87 | Transposase_20: Transposase IS116/IS110/IS902 fami | 95.75 | |
| PRK02515 | 132 | psbU photosystem II complex extrinsic protein prec | 95.75 | |
| PRK00116 | 192 | ruvA Holliday junction DNA helicase RuvA; Reviewed | 95.58 | |
| TIGR00426 | 69 | competence protein ComEA helix-hairpin-helix repea | 95.3 | |
| PF12836 | 65 | HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE | 95.13 | |
| PF14520 | 60 | HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU | 94.62 | |
| TIGR00615 | 195 | recR recombination protein RecR. This family is ba | 94.27 | |
| PRK00076 | 196 | recR recombination protein RecR; Reviewed | 94.2 | |
| PRK14973 | 936 | DNA topoisomerase I; Provisional | 94.18 | |
| PF14490 | 94 | HHH_4: Helix-hairpin-helix containing domain; PDB: | 94.16 | |
| PRK13844 | 200 | recombination protein RecR; Provisional | 94.12 | |
| TIGR01259 | 120 | comE comEA protein. This model describes the ComEA | 94.11 | |
| smart00483 | 334 | POLXc DNA polymerase X family. includes vertebrate | 94.09 | |
| COG0353 | 198 | RecR Recombinational DNA repair protein (RecF path | 93.94 | |
| PF11731 | 93 | Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd | 93.76 | |
| cd00141 | 307 | NT_POLXc Nucleotidyltransferase (NT) domain of fam | 93.66 | |
| KOG2841 | 254 | consensus Structure-specific endonuclease ERCC1-XP | 93.52 | |
| PF12836 | 65 | HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE | 93.45 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 93.42 | |
| PF11798 | 32 | IMS_HHH: IMS family HHH motif; InterPro: IPR024728 | 93.36 | |
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 93.35 | |
| PRK07945 | 335 | hypothetical protein; Provisional | 93.12 | |
| COG1555 | 149 | ComEA DNA uptake protein and related DNA-binding p | 92.65 | |
| PRK08097 | 562 | ligB NAD-dependent DNA ligase LigB; Reviewed | 92.61 | |
| PF05559 | 319 | DUF763: Protein of unknown function (DUF763); Inte | 92.56 | |
| COG1555 | 149 | ComEA DNA uptake protein and related DNA-binding p | 92.55 | |
| TIGR01259 | 120 | comE comEA protein. This model describes the ComEA | 92.36 | |
| PF10391 | 52 | DNA_pol_lambd_f: Fingers domain of DNA polymerase | 92.05 | |
| PRK14350 | 669 | ligA NAD-dependent DNA ligase LigA; Provisional | 91.98 | |
| COG0272 | 667 | Lig NAD-dependent DNA ligase (contains BRCT domain | 91.45 | |
| PRK13482 | 352 | DNA integrity scanning protein DisA; Provisional | 91.06 | |
| TIGR00084 | 191 | ruvA Holliday junction DNA helicase, RuvA subunit. | 90.95 | |
| PRK00116 | 192 | ruvA Holliday junction DNA helicase RuvA; Reviewed | 90.79 | |
| PRK08609 | 570 | hypothetical protein; Provisional | 90.72 | |
| PF03352 | 179 | Adenine_glyco: Methyladenine glycosylase; InterPro | 90.45 | |
| PF14229 | 122 | DUF4332: Domain of unknown function (DUF4332) | 90.24 | |
| PRK14605 | 194 | ruvA Holliday junction DNA helicase RuvA; Provisio | 89.99 | |
| smart00279 | 36 | HhH2 Helix-hairpin-helix class 2 (Pol1 family) mot | 89.99 | |
| PRK00024 | 224 | hypothetical protein; Reviewed | 89.96 | |
| PRK12766 | 232 | 50S ribosomal protein L32e; Provisional | 89.57 | |
| PF12826 | 64 | HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS | 89.45 | |
| smart00483 | 334 | POLXc DNA polymerase X family. includes vertebrate | 89.01 | |
| cd00141 | 307 | NT_POLXc Nucleotidyltransferase (NT) domain of fam | 88.57 | |
| PRK02515 | 132 | psbU photosystem II complex extrinsic protein prec | 88.48 | |
| PRK00024 | 224 | hypothetical protein; Reviewed | 88.28 | |
| cd00080 | 75 | HhH2_motif Helix-hairpin-helix class 2 (Pol1 famil | 87.4 | |
| PRK14351 | 689 | ligA NAD-dependent DNA ligase LigA; Provisional | 87.31 | |
| KOG2534 | 353 | consensus DNA polymerase IV (family X) [Replicatio | 87.15 | |
| COG1796 | 326 | POL4 DNA polymerase IV (family X) [DNA replication | 86.88 | |
| PF03118 | 66 | RNA_pol_A_CTD: Bacterial RNA polymerase, alpha cha | 85.98 | |
| TIGR00426 | 69 | competence protein ComEA helix-hairpin-helix repea | 85.74 | |
| PRK00254 | 720 | ski2-like helicase; Provisional | 84.63 | |
| PRK13901 | 196 | ruvA Holliday junction DNA helicase RuvA; Provisio | 83.85 | |
| TIGR00608 | 218 | radc DNA repair protein radc. This family is based | 83.8 | |
| PRK14600 | 186 | ruvA Holliday junction DNA helicase RuvA; Provisio | 83.7 | |
| PRK14601 | 183 | ruvA Holliday junction DNA helicase RuvA; Provisio | 83.47 | |
| PRK14606 | 188 | ruvA Holliday junction DNA helicase RuvA; Provisio | 82.74 | |
| PRK14603 | 197 | ruvA Holliday junction DNA helicase RuvA; Provisio | 82.51 | |
| PRK14602 | 203 | ruvA Holliday junction DNA helicase RuvA; Provisio | 82.51 | |
| PRK09482 | 256 | flap endonuclease-like protein; Provisional | 82.4 | |
| PF09597 | 57 | IGR: IGR protein motif; InterPro: IPR019083 This e | 81.86 | |
| PRK12766 | 232 | 50S ribosomal protein L32e; Provisional | 81.78 | |
| PRK14604 | 195 | ruvA Holliday junction DNA helicase RuvA; Provisio | 81.53 | |
| PRK14351 | 689 | ligA NAD-dependent DNA ligase LigA; Provisional | 81.52 | |
| TIGR01954 | 50 | nusA_Cterm_rpt transcription termination factor Nu | 81.42 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 80.65 |
| >COG0177 Nth Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Probab=99.97 E-value=4.9e-30 Score=193.11 Aligned_cols=103 Identities=22% Similarity=0.345 Sum_probs=95.3
Q ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHhcCCHHHHHHHHhhcCChhHHHHHHHHHHHHHHH-------hhHHHh
Q 033363 3 QIYSIRLKEIAILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLG-------ESWTHV 75 (121)
Q Consensus 3 ~~~si~~~~~~~~~~v~~v~~~l~~~~pt~~~la~a~~~eL~~~i~~~Gl~~~Ka~~i~~~a~~i~~-------~~~~~L 75 (121)
.+.++.+|+++||+.|++++.+||++||||++++++++++|++.|+++|||++||++|+++|+++++ +++++|
T Consensus 32 lLva~iLSaqttD~~vn~at~~Lf~~~~t~e~l~~a~~~~l~~~I~~iGlyr~KAk~I~~~~~~l~e~~~g~vP~~~~eL 111 (211)
T COG0177 32 LLVAVILSAQTTDEVVNKATPALFKRYPTPEDLLNADEEELEELIKSIGLYRNKAKNIKELARILLEKFGGEVPDTREEL 111 (211)
T ss_pred HHHHHHHhccCchHHHHHHHHHHHHHcCCHHHHHcCCHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHHcCCCCCchHHHH
Confidence 3567788888999999999999999999999999999999999999999999999999999999999 489999
Q ss_pred ccCCCCcHHHHHHHHHHhcCCCCccCcchHHH
Q 033363 76 TQLHGVGKYAADAFAIFCTGKWDRVRPTDHML 107 (121)
Q Consensus 76 ~~lpGIG~~tA~~vl~f~~~~~~~v~p~D~~l 107 (121)
.+|||||+|||++||.++||.| .+|+|+++
T Consensus 112 ~~LPGVGrKTAnvVL~~a~g~p--~i~VDTHV 141 (211)
T COG0177 112 LSLPGVGRKTANVVLSFAFGIP--AIAVDTHV 141 (211)
T ss_pred HhCCCcchHHHHHHHHhhcCCC--cccccchH
Confidence 9999999999999999999998 56666544
|
|
| >PRK10702 endonuclease III; Provisional | Back alignment and domain information |
|---|
| >PRK13913 3-methyladenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01083 nth endonuclease III | Back alignment and domain information |
|---|
| >PRK10880 adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01084 mutY A/G-specific adenine glycosylase | Back alignment and domain information |
|---|
| >PRK13910 DNA glycosylase MutY; Provisional | Back alignment and domain information |
|---|
| >smart00478 ENDO3c endonuclease III | Back alignment and domain information |
|---|
| >cd00056 ENDO3c endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases | Back alignment and domain information |
|---|
| >COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0122 AlkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10308 3-methyl-adenine DNA glycosylase II; Provisional | Back alignment and domain information |
|---|
| >TIGR00588 ogg 8-oxoguanine DNA-glycosylase (ogg) | Back alignment and domain information |
|---|
| >TIGR03252 uncharacterized HhH-GPD family protein | Back alignment and domain information |
|---|
| >PRK01229 N-glycosylase/DNA lyase; Provisional | Back alignment and domain information |
|---|
| >COG2231 Uncharacterized protein related to Endonuclease III [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1921 consensus Endonuclease III [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1918 consensus 3-methyladenine DNA glycosidase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00730 HhH-GPD: HhH-GPD superfamily base excision DNA repair protein This entry corresponds to Endonuclease III This entry corresponds to Alkylbase DNA glycosidase; InterPro: IPR003265 Endonuclease III (4 | Back alignment and domain information |
|---|
| >KOG2457 consensus A/G-specific adenine DNA glycosylase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2875 consensus 8-oxoguanine DNA glycosylase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] | Back alignment and domain information |
|---|
| >COG1059 Thermostable 8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF14716 HHH_8: Helix-hairpin-helix domain; PDB: 2W9M_A 1HUZ_A 1HUO_A 2BPG_B 2BPF_A 1DK3_A 1BPE_A 1BNO_A 1BNP_A 1DK2_A | Back alignment and domain information |
|---|
| >smart00278 HhH1 Helix-hairpin-helix DNA-binding motif class 1 | Back alignment and domain information |
|---|
| >PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PF12826 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS_A 1V9P_B | Back alignment and domain information |
|---|
| >PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit | Back alignment and domain information |
|---|
| >PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A | Back alignment and domain information |
|---|
| >PF02371 Transposase_20: Transposase IS116/IS110/IS902 family; InterPro: IPR003346 Transposases are needed for efficient transposition of the insertion sequence or transposon DNA | Back alignment and domain information |
|---|
| >PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional | Back alignment and domain information |
|---|
| >PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00426 competence protein ComEA helix-hairpin-helix repeat region | Back alignment and domain information |
|---|
| >PF12836 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE_A 3BZK_A 3BZC_A 2DUY_A | Back alignment and domain information |
|---|
| >PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A | Back alignment and domain information |
|---|
| >TIGR00615 recR recombination protein RecR | Back alignment and domain information |
|---|
| >PRK00076 recR recombination protein RecR; Reviewed | Back alignment and domain information |
|---|
| >PRK14973 DNA topoisomerase I; Provisional | Back alignment and domain information |
|---|
| >PF14490 HHH_4: Helix-hairpin-helix containing domain; PDB: 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK13844 recombination protein RecR; Provisional | Back alignment and domain information |
|---|
| >TIGR01259 comE comEA protein | Back alignment and domain information |
|---|
| >smart00483 POLXc DNA polymerase X family | Back alignment and domain information |
|---|
| >COG0353 RecR Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF11731 Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd1 is expressed as part of the pathogenicity locus operon in several different orders of bacteria [] | Back alignment and domain information |
|---|
| >cd00141 NT_POLXc Nucleotidyltransferase (NT) domain of family X DNA Polymerases | Back alignment and domain information |
|---|
| >KOG2841 consensus Structure-specific endonuclease ERCC1-XPF, ERCC1 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12836 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE_A 3BZK_A 3BZC_A 2DUY_A | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >PF11798 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases [] | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK07945 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1555 ComEA DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08097 ligB NAD-dependent DNA ligase LigB; Reviewed | Back alignment and domain information |
|---|
| >PF05559 DUF763: Protein of unknown function (DUF763); InterPro: IPR008482 This family consists of several uncharacterised bacterial and archaeal proteins of unknown function | Back alignment and domain information |
|---|
| >COG1555 ComEA DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01259 comE comEA protein | Back alignment and domain information |
|---|
| >PF10391 DNA_pol_lambd_f: Fingers domain of DNA polymerase lambda; InterPro: IPR018944 DNA polymerases catalyse the addition of dNMPs onto the 3-prime ends of DNA chains | Back alignment and domain information |
|---|
| >PRK14350 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13482 DNA integrity scanning protein DisA; Provisional | Back alignment and domain information |
|---|
| >TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit | Back alignment and domain information |
|---|
| >PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed | Back alignment and domain information |
|---|
| >PRK08609 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03352 Adenine_glyco: Methyladenine glycosylase; InterPro: IPR005019 This family of methyladenine glycosylases includes DNA-3-methyladenine glycosylase I (3 | Back alignment and domain information |
|---|
| >PF14229 DUF4332: Domain of unknown function (DUF4332) | Back alignment and domain information |
|---|
| >PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >smart00279 HhH2 Helix-hairpin-helix class 2 (Pol1 family) motifs | Back alignment and domain information |
|---|
| >PRK00024 hypothetical protein; Reviewed | Back alignment and domain information |
|---|
| >PRK12766 50S ribosomal protein L32e; Provisional | Back alignment and domain information |
|---|
| >PF12826 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS_A 1V9P_B | Back alignment and domain information |
|---|
| >smart00483 POLXc DNA polymerase X family | Back alignment and domain information |
|---|
| >cd00141 NT_POLXc Nucleotidyltransferase (NT) domain of family X DNA Polymerases | Back alignment and domain information |
|---|
| >PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional | Back alignment and domain information |
|---|
| >PRK00024 hypothetical protein; Reviewed | Back alignment and domain information |
|---|
| >cd00080 HhH2_motif Helix-hairpin-helix class 2 (Pol1 family) motif | Back alignment and domain information |
|---|
| >PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >KOG2534 consensus DNA polymerase IV (family X) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1796 POL4 DNA polymerase IV (family X) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF03118 RNA_pol_A_CTD: Bacterial RNA polymerase, alpha chain C terminal domain; InterPro: IPR011260 The core of the bacterial RNA polymerase (RNAP) consists of four subunits, two alpha, a beta and a beta', which are conserved from bacteria to mammals | Back alignment and domain information |
|---|
| >TIGR00426 competence protein ComEA helix-hairpin-helix repeat region | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >TIGR00608 radc DNA repair protein radc | Back alignment and domain information |
|---|
| >PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK09482 flap endonuclease-like protein; Provisional | Back alignment and domain information |
|---|
| >PF09597 IGR: IGR protein motif; InterPro: IPR019083 This entry is found in fungal and plant proteins and contains a conserved IGR motif | Back alignment and domain information |
|---|
| >PRK12766 50S ribosomal protein L32e; Provisional | Back alignment and domain information |
|---|
| >PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14351 ligA NAD-dependent DNA ligase LigA; Provisional | Back alignment and domain information |
|---|
| >TIGR01954 nusA_Cterm_rpt transcription termination factor NusA, C-terminal duplication | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 121 | ||||
| 1ngn_A | 155 | Mismatch Repair In Methylated Dna. Structure Of The | 9e-17 | ||
| 4ew4_A | 146 | Mouse Mbd4 Glycosylase Domain In Complex With Dna C | 9e-17 | ||
| 4e9e_A | 161 | Structure Of The Glycosylase Domain Of Mbd4 Length | 1e-16 | ||
| 4dk9_A | 157 | Crystal Structure Of Mbd4 Catalytic Domain Bound To | 1e-16 | ||
| 3iho_A | 138 | The C-Terminal Glycosylase Domain Of Human Mbd4 Len | 1e-16 | ||
| 4evv_A | 146 | Mouse Mbd4 Glycosylase Domain In Complex With A G:t | 3e-16 | ||
| 4e9g_A | 161 | Structure Of The Glycosylase Domain Of Mbd4 Bound T | 1e-15 | ||
| 4ea4_A | 155 | Structure Of The Glycosylase Domain Of Mbd4 Bound T | 1e-15 | ||
| 4ea5_A | 160 | Structure Of The Glycoslyase Domain Of Mbd4 Bound T | 1e-15 |
| >pdb|1NGN|A Chain A, Mismatch Repair In Methylated Dna. Structure Of The Mismatch-Specific Thymine Glycosylase Domain Of Methyl-Cpg- Binding Protein Mbd4 Length = 155 | Back alignment and structure |
|
| >pdb|4EW4|A Chain A, Mouse Mbd4 Glycosylase Domain In Complex With Dna Containing A Ribose Sugar Length = 146 | Back alignment and structure |
| >pdb|4E9E|A Chain A, Structure Of The Glycosylase Domain Of Mbd4 Length = 161 | Back alignment and structure |
| >pdb|4DK9|A Chain A, Crystal Structure Of Mbd4 Catalytic Domain Bound To Abasic Dna Length = 157 | Back alignment and structure |
| >pdb|3IHO|A Chain A, The C-Terminal Glycosylase Domain Of Human Mbd4 Length = 138 | Back alignment and structure |
| >pdb|4EVV|A Chain A, Mouse Mbd4 Glycosylase Domain In Complex With A G:t Mismatch Length = 146 | Back alignment and structure |
| >pdb|4E9G|A Chain A, Structure Of The Glycosylase Domain Of Mbd4 Bound To Thymine Containing Dna Length = 161 | Back alignment and structure |
| >pdb|4EA4|A Chain A, Structure Of The Glycosylase Domain Of Mbd4 Bound To 5hmu-Containing Dna Length = 155 | Back alignment and structure |
| >pdb|4EA5|A Chain A, Structure Of The Glycoslyase Domain Of Mbd4 Bound To A 5hmu Containing Dna Length = 160 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 121 | |||
| 4e9f_A | 161 | Methyl-CPG-binding domain protein 4; HHH DNA glyco | 4e-31 | |
| 1orn_A | 226 | Endonuclease III; DNA repair, DNA glycosylase, [4F | 7e-04 |
| >4e9f_A Methyl-CPG-binding domain protein 4; HHH DNA glycosylase family, hydrolase-DNA complex; HET: DNA 3DR; 1.79A {Homo sapiens} PDB: 4e9e_A* 4e9g_A* 4e9h_A* 4ea5_A* 4dk9_A* 1ngn_A 4ea4_A* 4ew4_A* 4evv_A* 4ew0_A* 3iho_A Length = 161 | Back alignment and structure |
|---|
Score = 107 bits (268), Expect = 4e-31
Identities = 36/94 (38%), Positives = 54/94 (57%)
Query: 21 VISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHG 80
V+ P A+ A D ++ +++ LGL RA I +FS EYL + W + +LHG
Sbjct: 52 VLWKFLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHG 111
Query: 81 VGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFL 114
+GKY D++ IFC +W +V P DH LN Y ++L
Sbjct: 112 IGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWL 145
|
| >1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* Length = 226 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| 4e9f_A | 161 | Methyl-CPG-binding domain protein 4; HHH DNA glyco | 100.0 | |
| 1orn_A | 226 | Endonuclease III; DNA repair, DNA glycosylase, [4F | 99.95 | |
| 1kea_A | 221 | Possible G-T mismatches repair enzyme; DNA repair, | 99.94 | |
| 2abk_A | 211 | Endonuclease III; DNA-repair, DNA glycosylase; 1.8 | 99.94 | |
| 1kg2_A | 225 | A/G-specific adenine glycosylase; DNA repair, hydr | 99.94 | |
| 1pu6_A | 218 | 3-methyladenine DNA glycosylase; helix-hairpin-hel | 99.93 | |
| 3n5n_X | 287 | A/G-specific adenine DNA glycosylase; alpha-helice | 99.93 | |
| 4b21_A | 232 | Probable DNA-3-methyladenine glycosylase 2; hydrol | 99.93 | |
| 2h56_A | 233 | DNA-3-methyladenine glycosidase; 10174367, EC 3.2. | 99.92 | |
| 2yg9_A | 225 | DNA-3-methyladenine glycosidase II, putative; hydr | 99.92 | |
| 3s6i_A | 228 | DNA-3-methyladenine glycosylase 1; DNA glycosylase | 99.92 | |
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 99.92 | |
| 1mpg_A | 282 | ALKA, 3-methyladenine DNA glycosylase II; DNA repa | 99.9 | |
| 2jhn_A | 295 | ALKA, 3-methyladenine DNA-glycosylase; DNA repair, | 99.88 | |
| 3i0w_A | 290 | 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8- | 99.88 | |
| 3n0u_A | 219 | Probable N-glycosylase/DNA lyase; structural genom | 99.86 | |
| 3fhf_A | 214 | Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel | 99.86 | |
| 3fhg_A | 207 | Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel | 99.86 | |
| 2xhi_A | 360 | N-glycosylase/DNA lyase; lyase-DNA complex, lyase/ | 99.86 | |
| 2ztd_A | 212 | Holliday junction ATP-dependent DNA helicase RUVA; | 96.31 | |
| 4gfj_A | 685 | Topoisomerase V; helix-hairpin-helix, DNA repair e | 96.22 | |
| 1ixr_A | 191 | Holliday junction DNA helicase RUVA; heterooligome | 95.98 | |
| 1z00_A | 89 | DNA excision repair protein ERCC-1; helix-hairpin- | 95.87 | |
| 1x2i_A | 75 | HEF helicase/nuclease; alpha helix, helix-hairpin- | 95.85 | |
| 1kft_A | 78 | UVRC, excinuclease ABC subunit C; helix-hairpin-he | 95.81 | |
| 2fmp_A | 335 | DNA polymerase beta; nucleotidyl transferase, tran | 95.66 | |
| 2a1j_B | 91 | DNA excision repair protein ERCC-1; XPF, xeroderma | 95.47 | |
| 4glx_A | 586 | DNA ligase; inhibitor, ligase-ligase inhibitor-DNA | 95.34 | |
| 1cuk_A | 203 | RUVA protein; DNA repair, SOS response, DNA-bindin | 95.34 | |
| 2ihm_A | 360 | POL MU, DNA polymerase MU; helix-turn-helix, trans | 95.3 | |
| 2bcq_A | 335 | DNA polymerase lambda; misalignment, extrahelical, | 95.02 | |
| 1jms_A | 381 | Terminal deoxynucleotidyltransferase; polymerase; | 94.96 | |
| 3vdp_A | 212 | Recombination protein RECR; zinc finger, DNA repai | 94.84 | |
| 2csb_A | 519 | Topoisomerase V, TOP61; topoisomerase IB, helix-tu | 94.82 | |
| 2a1j_A | 63 | DNA repair endonuclease XPF; XPF, xeroderma pigmen | 94.61 | |
| 2duy_A | 75 | Competence protein comea-related protein; helix-ha | 94.49 | |
| 2duy_A | 75 | Competence protein comea-related protein; helix-ha | 94.46 | |
| 1vdd_A | 228 | Recombination protein RECR; helix-hairpin-helix, z | 94.26 | |
| 1s5l_U | 134 | Photosystem II 12 kDa extrinsic protein; photosynt | 94.17 | |
| 2edu_A | 98 | Kinesin-like protein KIF22; kinesin-like DNA bindi | 93.93 | |
| 2a1j_A | 63 | DNA repair endonuclease XPF; XPF, xeroderma pigmen | 93.42 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 92.99 | |
| 2bgw_A | 219 | XPF endonuclease; hydrolase, structure specific en | 92.79 | |
| 1z00_B | 84 | DNA repair endonuclease XPF; helix-hairpin-helix, | 92.56 | |
| 3arc_U | 97 | Photosystem II 12 kDa extrinsic protein; PSII, mem | 92.46 | |
| 2fmp_A | 335 | DNA polymerase beta; nucleotidyl transferase, tran | 92.45 | |
| 2kp7_A | 87 | Crossover junction endonuclease MUS81; helix-hairp | 92.22 | |
| 1s5l_U | 134 | Photosystem II 12 kDa extrinsic protein; photosynt | 92.14 | |
| 1wcn_A | 70 | Transcription elongation protein NUSA; RNA-binding | 92.01 | |
| 1z00_B | 84 | DNA repair endonuclease XPF; helix-hairpin-helix, | 91.93 | |
| 2i5h_A | 205 | Hypothetical protein AF1531; PFAM:DUF655, PSI-2, s | 91.87 | |
| 3arc_U | 97 | Photosystem II 12 kDa extrinsic protein; PSII, mem | 91.34 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 91.23 | |
| 2ihm_A | 360 | POL MU, DNA polymerase MU; helix-turn-helix, trans | 91.04 | |
| 2edu_A | 98 | Kinesin-like protein KIF22; kinesin-like DNA bindi | 90.92 | |
| 1ixr_A | 191 | Holliday junction DNA helicase RUVA; heterooligome | 90.78 | |
| 2ztd_A | 212 | Holliday junction ATP-dependent DNA helicase RUVA; | 90.55 | |
| 3c1y_A | 377 | DNA integrity scanning protein DISA; DNA damage, D | 89.88 | |
| 3b0x_A | 575 | DNA polymerase beta family (X family); structural | 89.84 | |
| 2jg6_A | 186 | DNA-3-methyladenine glycosidase; 3-methyladenine-D | 89.78 | |
| 2w9m_A | 578 | Polymerase X; SAXS, DNA repair, DNA polymerase, DN | 89.28 | |
| 1cuk_A | 203 | RUVA protein; DNA repair, SOS response, DNA-bindin | 88.98 | |
| 1z00_A | 89 | DNA excision repair protein ERCC-1; helix-hairpin- | 88.67 | |
| 1jms_A | 381 | Terminal deoxynucleotidyltransferase; polymerase; | 88.53 | |
| 3sgi_A | 615 | DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tub | 88.51 | |
| 1kft_A | 78 | UVRC, excinuclease ABC subunit C; helix-hairpin-he | 88.2 | |
| 1x2i_A | 75 | HEF helicase/nuclease; alpha helix, helix-hairpin- | 88.13 | |
| 2ofk_A | 183 | 3-methyladenine DNA glycosylase I, constitutive; D | 87.49 | |
| 2bcq_A | 335 | DNA polymerase lambda; misalignment, extrahelical, | 87.41 | |
| 2a1j_B | 91 | DNA excision repair protein ERCC-1; XPF, xeroderma | 86.67 | |
| 1u9l_A | 70 | Transcription elongation protein NUSA; escherichia | 86.65 | |
| 1z3e_B | 73 | DNA-directed RNA polymerase alpha chain; bacterial | 85.22 | |
| 2w9m_A | 578 | Polymerase X; SAXS, DNA repair, DNA polymerase, DN | 83.9 | |
| 3k4g_A | 86 | DNA-directed RNA polymerase subunit alpha; bacteri | 83.53 | |
| 4gfj_A | 685 | Topoisomerase V; helix-hairpin-helix, DNA repair e | 82.45 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 82.16 | |
| 1vq8_Y | 241 | 50S ribosomal protein L32E; ribosome 50S, protein- | 82.14 | |
| 2bgw_A | 219 | XPF endonuclease; hydrolase, structure specific en | 80.94 | |
| 1b22_A | 114 | DNA repair protein RAD51; DNA binding, riken struc | 80.17 | |
| 3gfk_B | 79 | DNA-directed RNA polymerase subunit alpha; protein | 80.13 |
| >4e9f_A Methyl-CPG-binding domain protein 4; HHH DNA glycosylase family, hydrolase-DNA complex; HET: DNA 3DR; 1.79A {Homo sapiens} PDB: 4e9e_A* 4e9g_A* 4e9h_A* 4ea5_A* 4dk9_A* 1ngn_A 4ea4_A* 4ew4_A* 4evv_A* 4ew0_A* 3iho_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.9e-35 Score=212.89 Aligned_cols=114 Identities=33% Similarity=0.650 Sum_probs=106.1
Q ss_pred HHHHHHHH----HHHHHHHHHHHHHHHhCCCHHHHhcCCHHHHHHHHhhcCChhHHHHHHHHHHHHHHHhhHHHhccCCC
Q 033363 5 YSIRLKEI----AILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHG 80 (121)
Q Consensus 5 ~si~~~~~----~~~~~v~~v~~~l~~~~pt~~~la~a~~~eL~~~i~~~Gl~~~Ka~~i~~~a~~i~~~~~~~L~~lpG 80 (121)
|.+.+++| |++++|++++.+|+++||||++|+++++++|+++|+++|||++||++|+++|+.++.+++++|++|||
T Consensus 32 ~~vLVs~ILsqQT~~~~v~~~~~~l~~~~pt~~~la~a~~~el~~~i~~lG~y~~KAk~i~~~a~~~vp~~~~~L~~LpG 111 (161)
T 4e9f_A 32 WKLLIATIFLNRTSGKMAIPVLWKFLEKYPSAEVARTADWRDVSELLKPLGLYDLRAKTIVKFSDEYLTKQWKYPIELHG 111 (161)
T ss_dssp HHHHHHHHHTTTSCHHHHHHHHHHHHHHSCSHHHHTTSCHHHHHHHHGGGSCHHHHHHHHHHHHHHHHHSCCSSGGGSTT
T ss_pred HHHHHHHHHHhhCcHHHHHHHHHHHHHHCCCHHHHhccChHhHHhHhhhcCCHHHHHHHHHHHhCCcCCCChhhhhcCCC
Confidence 45555555 56789999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CcHHHHHHHHHHhcCCCCccCcchHHHHHHHHHHHHhh
Q 033363 81 VGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVSTK 118 (121)
Q Consensus 81 IG~~tA~~vl~f~~~~~~~v~p~D~~l~~~~~wl~~~~ 118 (121)
||+||||++++||+|++..|+|+|+++++|++|+++..
T Consensus 112 VG~yTAdav~~F~~~e~~~V~p~D~~l~r~l~wl~~~~ 149 (161)
T 4e9f_A 112 IGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENH 149 (161)
T ss_dssp CCHHHHHHHHHHTSSCGGGCCCCSHHHHHHHHHHHHTC
T ss_pred chHHHHHHHHHHHCCCCCCCCCCcHHHHHHHHHHHcCc
Confidence 99999999999999987779999999999999998764
|
| >1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* | Back alignment and structure |
|---|
| >1kea_A Possible G-T mismatches repair enzyme; DNA repair, DNA glycosylase, DNA mismatch, methylation; 2.00A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.96.1.2 | Back alignment and structure |
|---|
| >2abk_A Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {Escherichia coli} SCOP: a.96.1.1 | Back alignment and structure |
|---|
| >1kg2_A A/G-specific adenine glycosylase; DNA repair, hydrolase; 1.20A {Escherichia coli} SCOP: a.96.1.2 PDB: 1kg3_A 1muy_A 1kg6_A 1kg5_A 1mun_A 1mud_A 1kg4_A 1weg_A 1wei_A* 1wef_A* 1kg7_A 1kqj_A | Back alignment and structure |
|---|
| >1pu6_A 3-methyladenine DNA glycosylase; helix-hairpin-helix, base excision repair, hydrolase; HET: KCX; 1.64A {Helicobacter pylori} SCOP: a.96.1.5 PDB: 1pu7_A* 1pu8_A* | Back alignment and structure |
|---|
| >3n5n_X A/G-specific adenine DNA glycosylase; alpha-helices, helix-hairpin-helix motif, iron-sulfur cluste hydrolase; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4b21_A Probable DNA-3-methyladenine glycosylase 2; hydrolase-DNA complex, helix-hairpin-helix; HET: BGC 3DR; 1.45A {Schizosaccharomyces pombe} PDB: 4b22_A* 4b23_A* 4b24_A* | Back alignment and structure |
|---|
| >2h56_A DNA-3-methyladenine glycosidase; 10174367, EC 3.2.2.-, struc genomics, PSI-2, protein structure initiative, joint center structural genomics; 2.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2yg9_A DNA-3-methyladenine glycosidase II, putative; hydrolase, DNA repair; 1.95A {Deinococcus radiodurans} PDB: 2yg8_A | Back alignment and structure |
|---|
| >3s6i_A DNA-3-methyladenine glycosylase 1; DNA glycosylase, DNA repair, helix-hairpin-helix (HHH), ABAS tetrahydrofuran (THF); HET: 3DR; 2.28A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
| >1mpg_A ALKA, 3-methyladenine DNA glycosylase II; DNA repair, base excision, methylation, ALK hydrolase; 1.80A {Escherichia coli} SCOP: a.96.1.3 d.129.1.2 PDB: 1diz_A 1pvs_A* 3cvs_A* 3cvt_A* 3cw7_A* 3cwa_A* 3cws_A* 3cwt_A* 3cwu_A* 3d4v_A* 3ogd_A* 3oh9_A* 3oh6_A* | Back alignment and structure |
|---|
| >2jhn_A ALKA, 3-methyladenine DNA-glycosylase; DNA repair, N1-methyladenine, N3-methylcytosine, hyperthermophiles, hydrolase; HET: MBO MES; 1.8A {Archaeoglobus fulgidus} PDB: 2jhj_A | Back alignment and structure |
|---|
| >3i0w_A 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8-OXOG, 8OXOG, glycosylase, cytosine, hydrolase,lyase/DNA complex; HET: 8OG; 1.73A {Clostridium acetobutylicum} PDB: 3i0x_A* 3f10_A* 3f0z_A | Back alignment and structure |
|---|
| >3n0u_A Probable N-glycosylase/DNA lyase; structural genomics, ISFI, DNA repair, 8-oxoguanine, base EX repair, PSI-2, protein structure initiative; 1.50A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3fhf_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase; 2.00A {Methanocaldococcus jannaschii} PDB: 3knt_A* | Back alignment and structure |
|---|
| >3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2xhi_A N-glycosylase/DNA lyase; lyase-DNA complex, lyase/DNA complex, separation-OF-function helix-hairpin-helix, DNA repair; HET: 8OG; 1.55A {Homo sapiens} PDB: 1ko9_A 1lwy_A* 1hu0_A* 1lwv_A* 1lww_A* 2noe_A* 2noh_A* 2nol_A* 1n3c_A* 1fn7_A* 2noz_A* 1yqk_A 1yqr_A* 1yql_A* 1yqm_A* 2noi_A 1ebm_A* 1m3q_A* 1m3h_A* 1n39_A* ... | Back alignment and structure |
|---|
| >2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA BIND oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A | Back alignment and structure |
|---|
| >4gfj_A Topoisomerase V; helix-hairpin-helix, DNA repair enzyme, DNA B isomerase; 2.91A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2 | Back alignment and structure |
|---|
| >1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 | Back alignment and structure |
|---|
| >2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ... | Back alignment and structure |
|---|
| >2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >4glx_A DNA ligase; inhibitor, ligase-ligase inhibitor-DNA complex; HET: DNA 0XS; 1.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A | Back alignment and structure |
|---|
| >2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ... | Back alignment and structure |
|---|
| >1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A* | Back alignment and structure |
|---|
| >3vdp_A Recombination protein RECR; zinc finger, DNA repair, DNA binding; 2.45A {Thermoanaerobacter tengcongensis} PDB: 3vdu_A 3ve5_D | Back alignment and structure |
|---|
| >2csb_A Topoisomerase V, TOP61; topoisomerase IB, helix-turn-helix, helix-H helix, HHH motif, three helix bundle, methanopyrus kandleri isomerase; 2.30A {Methanopyrus kandleri} SCOP: a.60.2.4 a.60.2.4 a.60.2.4 a.60.2.4 a.267.1.1 PDB: 2csd_A | Back alignment and structure |
|---|
| >2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* | Back alignment and structure |
|---|
| >2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >1vdd_A Recombination protein RECR; helix-hairpin-helix, zinc finger, toprim, walker B ATP binding motif; 2.50A {Deinococcus radiodurans} SCOP: e.49.1.1 PDB: 2v1c_A | Back alignment and structure |
|---|
| >1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2bgw_A XPF endonuclease; hydrolase, structure specific endonuclease, nucleotide excision repair; 2.8A {Aeropyrum pernix} SCOP: a.60.2.5 c.52.1.20 PDB: 2bhn_A | Back alignment and structure |
|---|
| >1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* | Back alignment and structure |
|---|
| >3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* | Back alignment and structure |
|---|
| >2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ... | Back alignment and structure |
|---|
| >2kp7_A Crossover junction endonuclease MUS81; helix-hairpin-helix, tumour suppressor, DNA damage, DNA recombination, DNA repair, hydrolase, magnesium; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >1wcn_A Transcription elongation protein NUSA; RNA-binding protein, escherichia coli NUSA, transcription regulation, regulation of RNA binding; NMR {Escherichia coli} PDB: 2jzb_B | Back alignment and structure |
|---|
| >1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* | Back alignment and structure |
|---|
| >2i5h_A Hypothetical protein AF1531; PFAM:DUF655, PSI-2, structural genomics, protein structure initiative; 1.74A {Archaeoglobus fulgidus} SCOP: e.71.1.1 | Back alignment and structure |
|---|
| >3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2 | Back alignment and structure |
|---|
| >2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA BIND oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A | Back alignment and structure |
|---|
| >3c1y_A DNA integrity scanning protein DISA; DNA damage, DNA repair, DNA-binding, DNA binding protein; HET: DNA 2BA; 2.10A {Thermotoga maritima} PDB: 3c1z_A* 3c21_A* 3c23_A* | Back alignment and structure |
|---|
| >3b0x_A DNA polymerase beta family (X family); structural genomics, riken structural genomics/proteomics in RSGI, polxc, PHP, DRP lyase; HET: DNA DGT; 1.36A {Thermus thermophilus} PDB: 3au2_A* 3au6_A* 3auo_A* 3b0y_A* | Back alignment and structure |
|---|
| >2jg6_A DNA-3-methyladenine glycosidase; 3-methyladenine-DNA-glycosylase-I, hydrolase; 1.70A {Staphylococcus aureus} PDB: 4aia_A* 4ai5_A* 4ai4_A | Back alignment and structure |
|---|
| >2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A | Back alignment and structure |
|---|
| >1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A* | Back alignment and structure |
|---|
| >3sgi_A DNA ligase; HET: DNA AMP; 3.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 | Back alignment and structure |
|---|
| >1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >2ofk_A 3-methyladenine DNA glycosylase I, constitutive; DNA repair, base excision, helix-hairpin-helix, hydrolase; HET: PGE; 1.50A {Salmonella typhi} PDB: 2ofi_A* 1lmz_A 1nku_A 1p7m_A* | Back alignment and structure |
|---|
| >2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ... | Back alignment and structure |
|---|
| >2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >1u9l_A Transcription elongation protein NUSA; escherichia coli NUSA, phage lambda protein N, regulation of RNA binding, transcription antitermination, X-RAY crystallography; 1.90A {Escherichia coli} SCOP: a.60.4.2 PDB: 1wcl_A | Back alignment and structure |
|---|
| >1z3e_B DNA-directed RNA polymerase alpha chain; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: a.60.3.1 PDB: 3ihq_B | Back alignment and structure |
|---|
| >2w9m_A Polymerase X; SAXS, DNA repair, DNA polymerase, DNA replication; 2.46A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3k4g_A DNA-directed RNA polymerase subunit alpha; bacterial transcription regulation, DNA-directed RNA polymer nucleotidyltransferase; HET: MLY; 2.05A {Escherichia coli k-12} SCOP: a.60.3.1 PDB: 3n4m_B* 1lb2_B* 3n97_B* 1xs9_D | Back alignment and structure |
|---|
| >4gfj_A Topoisomerase V; helix-hairpin-helix, DNA repair enzyme, DNA B isomerase; 2.91A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >1vq8_Y 50S ribosomal protein L32E; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: c.9.2.1 PDB: 1vq4_Y* 1vq5_Y* 1vq6_Y* 1vq7_Y* 1s72_Y* 1vq9_Y* 1vqk_Y* 1vql_Y* 1vqm_Y* 1vqn_Y* 1vqo_Y* 1vqp_Y* 1yhq_Y* 1yi2_Y* 1yij_Y* 1yit_Y* 1yj9_Y* 1yjn_Y* 1yjw_Y* 2otj_Y* ... | Back alignment and structure |
|---|
| >2bgw_A XPF endonuclease; hydrolase, structure specific endonuclease, nucleotide excision repair; 2.8A {Aeropyrum pernix} SCOP: a.60.2.5 c.52.1.20 PDB: 2bhn_A | Back alignment and structure |
|---|
| >1b22_A DNA repair protein RAD51; DNA binding, riken structural genomics/proteomics initiative, RSGI, structural genomics, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.60.4.1 | Back alignment and structure |
|---|
| >3gfk_B DNA-directed RNA polymerase subunit alpha; protein-protein complex, cytoplasm, redox-active center, stress response, transcription; 2.30A {Bacillus subtilis} SCOP: a.60.3.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 121 | ||||
| d1ngna_ | 144 | a.96.1.2 (A:) Mismatch-specific thymine glycosylas | 2e-14 |
| >d1ngna_ a.96.1.2 (A:) Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA-glycosylase superfamily: DNA-glycosylase family: Mismatch glycosylase domain: Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 63.2 bits (153), Expect = 2e-14
Identities = 36/95 (37%), Positives = 55/95 (57%)
Query: 20 RVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLH 79
V+ + P A+ A D ++ +++ LGL RA I +FS EYL + W + +LH
Sbjct: 40 PVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELH 99
Query: 80 GVGKYAADAFAIFCTGKWDRVRPTDHMLNYYWEFL 114
G+GKY D++ IFC +W +V P DH LN Y ++L
Sbjct: 100 GIGKYGNDSYRIFCVNEWKQVHPEDHKLNKYHDWL 134
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 121 | |||
| d1ngna_ | 144 | Mismatch-specific thymine glycosylase domain of th | 100.0 | |
| d1keaa_ | 217 | Thymine-DNA glycosylase {Archaeon Methanobacterium | 99.95 | |
| d2abka_ | 211 | Endonuclease III {Escherichia coli [TaxId: 562]} | 99.95 | |
| d1orna_ | 214 | Endonuclease III {Escherichia coli [TaxId: 562]} | 99.94 | |
| d1kg2a_ | 224 | Catalytic domain of MutY {Escherichia coli [TaxId: | 99.94 | |
| d1pu6a_ | 217 | 3-Methyladenine DNA glycosylase III (MagIII) {Heli | 99.94 | |
| d1rrqa1 | 221 | Catalytic domain of MutY {Bacillus stearothermophi | 99.93 | |
| d1mpga1 | 183 | 3-Methyladenine DNA glycosylase II (gene alkA or a | 99.89 | |
| d2noha1 | 190 | 8-oxoguanine glycosylase {Human (Homo sapiens) [Ta | 99.88 | |
| d1ixra1 | 73 | DNA helicase RuvA subunit, middle domain {Thermus | 97.33 | |
| d1cuka2 | 78 | DNA helicase RuvA subunit, middle domain {Escheric | 97.25 | |
| d1bvsa2 | 71 | DNA helicase RuvA subunit, middle domain {Mycobact | 97.24 | |
| d2fmpa1 | 82 | DNA polymerase beta, N-terminal (8 kD)-domain {Hum | 96.92 | |
| d2bcqa1 | 76 | DNA polymerase lambda {Human (Homo sapiens) [TaxId | 96.89 | |
| d1x2ia1 | 68 | ATP-dependent RNA helicase PF2015 {Pyrococcus furi | 96.69 | |
| d2i1qa1 | 60 | DNA repair protein Rad51, N-terminal domain {Archa | 96.57 | |
| d1kfta_ | 56 | Excinuclease UvrC C-terminal domain {Escherichia c | 96.39 | |
| d1pzna1 | 61 | DNA repair protein Rad51, N-terminal domain {Archa | 96.13 | |
| d2i1qa1 | 60 | DNA repair protein Rad51, N-terminal domain {Archa | 95.92 | |
| d2a1ja1 | 62 | DNA repair endonuclease XPF {Human (Homo sapiens) | 95.9 | |
| d1jmsa1 | 95 | Terminal deoxynucleotidyl transferase {Mouse (Mus | 95.88 | |
| d2bgwa1 | 70 | DNA repair endonuclease XPF {Aeropyrum pernix [Tax | 95.76 | |
| d1dgsa1 | 181 | NAD+-dependent DNA ligase, domain 3 {Thermus filif | 95.75 | |
| d1pzna1 | 61 | DNA repair protein Rad51, N-terminal domain {Archa | 95.4 | |
| d1vdda_ | 199 | Recombination protein RecR {Deinococcus radioduran | 94.55 | |
| d2bgwa1 | 70 | DNA repair endonuclease XPF {Aeropyrum pernix [Tax | 94.41 | |
| d2edua1 | 91 | KIF22, C-terminal domain {Human (Homo sapiens) [Ta | 94.29 | |
| d2a1ja1 | 62 | DNA repair endonuclease XPF {Human (Homo sapiens) | 94.29 | |
| d1kfta_ | 56 | Excinuclease UvrC C-terminal domain {Escherichia c | 94.28 | |
| d2a1jb1 | 78 | DNA excision repair protein ERCC-1 {Human (Homo sa | 94.21 | |
| d1bvsa2 | 71 | DNA helicase RuvA subunit, middle domain {Mycobact | 94.1 | |
| d3bzka1 | 90 | Transcriptional accessory factor Tex {Pseudomonas | 94.09 | |
| d1szpa1 | 64 | DNA repair protein Rad51, N-terminal domain {Baker | 94.04 | |
| d2duya1 | 65 | Uncharacterized protein TTHA1967 {Thermus thermoph | 94.04 | |
| d1jmsa3 | 60 | Terminal deoxynucleotidyl transferase {Mouse (Mus | 93.74 | |
| d2a1jb1 | 78 | DNA excision repair protein ERCC-1 {Human (Homo sa | 93.59 | |
| d2edua1 | 91 | KIF22, C-terminal domain {Human (Homo sapiens) [Ta | 93.58 | |
| d2fmpa2 | 57 | DNA polymerase beta {Human (Homo sapiens) [TaxId: | 93.54 | |
| d3bzka1 | 90 | Transcriptional accessory factor Tex {Pseudomonas | 93.26 | |
| d1ixra1 | 73 | DNA helicase RuvA subunit, middle domain {Thermus | 93.15 | |
| d1cuka2 | 78 | DNA helicase RuvA subunit, middle domain {Escheric | 93.13 | |
| d1x2ia1 | 68 | ATP-dependent RNA helicase PF2015 {Pyrococcus furi | 92.25 | |
| d2axtu1 | 98 | Photosystem II 12 kDa extrinsic protein PsbU {Ther | 92.08 | |
| d2bcqa2 | 57 | DNA polymerase lambda {Human (Homo sapiens) [TaxId | 91.64 | |
| d2duya1 | 65 | Uncharacterized protein TTHA1967 {Thermus thermoph | 91.29 | |
| d1b22a_ | 70 | DNA repair protein Rad51, N-terminal domain {Human | 91.26 | |
| d1doqa_ | 69 | C-terminal domain of RNA polymerase alpha subunit | 91.08 | |
| d2csba3 | 55 | Topoisomerase V {Methanopyrus kandleri [TaxId: 232 | 90.09 | |
| d1a77a1 | 108 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Met | 88.86 | |
| d2axtu1 | 98 | Photosystem II 12 kDa extrinsic protein PsbU {Ther | 88.54 | |
| d1rxwa1 | 105 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Arc | 87.47 | |
| d1szpa1 | 64 | DNA repair protein Rad51, N-terminal domain {Baker | 87.07 | |
| d1xo1a1 | 105 | T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726] | 85.19 | |
| d1z3eb1 | 67 | C-terminal domain of RNA polymerase alpha subunit | 83.79 | |
| d1ul1x1 | 140 | Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo | 83.36 | |
| d1nkua_ | 187 | 3-Methyladenine DNA glycosylase I (Tag) {Escherich | 82.53 | |
| d1b43a1 | 120 | Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyr | 82.49 | |
| d2e1fa1 | 94 | Werner syndrome ATP-dependent helicase, WRN {Human | 80.9 |
| >d1ngna_ a.96.1.2 (A:) Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA-glycosylase superfamily: DNA-glycosylase family: Mismatch glycosylase domain: Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=3.4e-35 Score=207.17 Aligned_cols=116 Identities=32% Similarity=0.605 Sum_probs=107.3
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHhcCCHHHHHHHHhhcCChhHHHHHHHHHHHHHHHhhHHHhccCCCCcH
Q 033363 4 IYSIRLKEIAILLKAGRVISDLFTLCPDAKTATEVDAEEIEKIISTLGLQKKRAPMIKRFSQEYLGESWTHVTQLHGVGK 83 (121)
Q Consensus 4 ~~si~~~~~~~~~~v~~v~~~l~~~~pt~~~la~a~~~eL~~~i~~~Gl~~~Ka~~i~~~a~~i~~~~~~~L~~lpGIG~ 83 (121)
+.+..+++++++++|++++.+|+++||||+++++++.++|+++|+++||+++||++|+++|+.++.++.++|++|||||+
T Consensus 24 LV~~ILsqqT~~~~v~~v~~~L~~~~pt~e~la~a~~~el~~~Ir~~G~~~~KAk~I~~~a~~~ip~~~~~l~~LpGVG~ 103 (144)
T d1ngna_ 24 LIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGK 103 (144)
T ss_dssp HHHHHHHTTSCHHHHHHHHHHHHHHSCSHHHHHHSCHHHHHHHTGGGSCHHHHHHHHHHHHHHHHHSCCSSGGGSTTCCH
T ss_pred HHHHHHHccCCHHHHHHHHHHHHHhCCchhhhhccCHHHHHHHHHhhhhHHHHHHHHHHHHhhHhhhhhhhHHhcCCccH
Confidence 34555555566789999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHhcCCCCccCcchHHHHHHHHHHHHhhc
Q 033363 84 YAADAFAIFCTGKWDRVRPTDHMLNYYWEFLVSTKG 119 (121)
Q Consensus 84 ~tA~~vl~f~~~~~~~v~p~D~~l~~~~~wl~~~~~ 119 (121)
|||+++++|++|+.+.++|+||++++|++|+++...
T Consensus 104 ~tad~~~if~~~~~~~v~~~D~~l~r~~~~~~~~~~ 139 (144)
T d1ngna_ 104 YGNDSYRIFCVNEWKQVHPEDHKLNKYHDWLWENHE 139 (144)
T ss_dssp HHHHHHHHHTSSCGGGCCCCSHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHcCCCCCCCCCChHHHHHHHHHHcCcc
Confidence 999999999999987799999999999999997653
|
| >d1keaa_ a.96.1.2 (A:) Thymine-DNA glycosylase {Archaeon Methanobacterium thermoformicicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2abka_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1orna_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kg2a_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pu6a_ a.96.1.5 (A:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1rrqa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mpga1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2noha1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d2fmpa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcqa1 a.60.6.1 (A:252-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmsa1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1dgsa1 a.60.2.2 (A:401-581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]} | Back information, alignment and structure |
|---|
| >d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vdda_ e.49.1.1 (A:) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} | Back information, alignment and structure |
|---|
| >d2bcqa2 a.60.12.1 (A:329-385) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1doqa_ a.60.3.1 (A:) C-terminal domain of RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2csba3 a.60.2.4 (A:410-464) Topoisomerase V {Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1a77a1 a.60.7.1 (A:209-316) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} | Back information, alignment and structure |
|---|
| >d1rxwa1 a.60.7.1 (A:220-324) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xo1a1 a.60.7.1 (A:186-290) T5 5'-exonuclease {Bacteriophage T5 [TaxId: 10726]} | Back information, alignment and structure |
|---|
| >d1z3eb1 a.60.3.1 (B:245-311) C-terminal domain of RNA polymerase alpha subunit {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ul1x1 a.60.7.1 (X:218-357) Flap endonuclease-1 (Fen-1 nuclease) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkua_ a.96.1.4 (A:) 3-Methyladenine DNA glycosylase I (Tag) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b43a1 a.60.7.1 (A:220-339) Flap endonuclease-1 (Fen-1 nuclease) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2e1fa1 a.60.8.1 (A:1142-1235) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|