Citrus Sinensis ID: 033440


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MALWMDAESEPKTESEKADLDAIAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVVILCSGSHPNQF
cccccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHcccccc
cccccccccccccHHccHHHHHHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccc
malwmdaesepkteseKADLDAIAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQnvlsdsensVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVVILcsgshpnqf
malwmdaesepktesekaDLDAIAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVVILCSGSHPNQF
MALWMDAESEPKTESEKADLDAIAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVVILCSGSHPNQF
****************************************YVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVVILCS*******
MALW******************************KEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVVILCSGSHP***
******************DLDAIAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVVILCSGSHPNQF
********SEPKTESEKADLDAIAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVVILCSGSHP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALWMDAESEPKTESEKADLDAIAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVVILCSGSHPNQF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query119 2.2.26 [Sep-21-2011]
P53043 513 Serine/threonine-protein yes no 0.647 0.150 0.385 7e-08
O95801 387 Tetratricopeptide repeat yes no 0.899 0.276 0.327 8e-08
Q5EA11 388 Tetratricopeptide repeat yes no 0.722 0.221 0.352 8e-08
Q28IV3 657 RNA polymerase II-associa no no 0.714 0.129 0.413 3e-07
Q6NU95 660 RNA polymerase II-associa N/A no 0.739 0.133 0.4 8e-07
Q54M20 397 Tetratricopeptide repeat yes no 0.663 0.198 0.329 1e-06
P33313 385 Hsp70/Hsp90 co-chaperone no no 0.756 0.233 0.371 1e-06
Q9D706 660 RNA polymerase II-associa yes no 0.731 0.131 0.361 4e-06
Q8R3H9 386 Tetratricopeptide repeat no no 0.722 0.222 0.340 4e-06
Q07617 926 Sperm-associated antigen no no 0.714 0.091 0.369 6e-06
>sp|P53043|PPT1_YEAST Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 Back     alignment and function desciption
 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 50/83 (60%), Gaps = 6/83 (7%)

Query: 24  AALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLL 83
            A   + A+E K +GN +VK+  KH+  AI+ YT AI+     DS  S+ ++NRA  +  
Sbjct: 5   TAADRAKALERKNEGNVFVKE--KHFLKAIEKYTEAIDL----DSTQSIYFSNRAFAHFK 58

Query: 84  LGNYRRAFTDAEEALKLCPTNVK 106
           + N++ A  D +EA+KL P N+K
Sbjct: 59  VDNFQSALNDCDEAIKLDPKNIK 81




Protein phosphatase that specifically binds to and dephosphorylates the molecular chaperone Hsp90 (HSC82 and HSP82). Dephosphorylation positively regulates the Hsp90 chaperone machinery.
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (taxid: 559292)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|O95801|TTC4_HUMAN Tetratricopeptide repeat protein 4 OS=Homo sapiens GN=TTC4 PE=1 SV=3 Back     alignment and function description
>sp|Q5EA11|TTC4_BOVIN Tetratricopeptide repeat protein 4 OS=Bos taurus GN=TTC4 PE=2 SV=2 Back     alignment and function description
>sp|Q28IV3|RPAP3_XENTR RNA polymerase II-associated protein 3 OS=Xenopus tropicalis GN=rpap3 PE=2 SV=1 Back     alignment and function description
>sp|Q6NU95|RPAP3_XENLA RNA polymerase II-associated protein 3 OS=Xenopus laevis GN=rpap3 PE=2 SV=1 Back     alignment and function description
>sp|Q54M20|TTC4_DICDI Tetratricopeptide repeat protein 4 homolog OS=Dictyostelium discoideum GN=ttc4 PE=3 SV=1 Back     alignment and function description
>sp|P33313|CNS1_YEAST Hsp70/Hsp90 co-chaperone CNS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNS1 PE=1 SV=1 Back     alignment and function description
>sp|Q9D706|RPAP3_MOUSE RNA polymerase II-associated protein 3 OS=Mus musculus GN=Rpap3 PE=1 SV=1 Back     alignment and function description
>sp|Q8R3H9|TTC4_MOUSE Tetratricopeptide repeat protein 4 OS=Mus musculus GN=Ttc4 PE=2 SV=1 Back     alignment and function description
>sp|Q07617|SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens GN=SPAG1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
224070033 370 predicted protein [Populus trichocarpa] 0.907 0.291 0.805 3e-45
225437945 364 PREDICTED: tetratricopeptide repeat prot 0.890 0.291 0.811 3e-44
356537202 360 PREDICTED: tetratricopeptide repeat prot 0.941 0.311 0.767 1e-43
255575041 299 heat shock protein 70 (HSP70)-interactin 0.907 0.361 0.787 2e-43
449509065 309 PREDICTED: tetratricopeptide repeat prot 0.907 0.349 0.768 3e-43
449468596 360 PREDICTED: tetratricopeptide repeat prot 0.907 0.3 0.768 6e-43
297843222 360 binding protein [Arabidopsis lyrata subs 0.907 0.3 0.759 1e-42
255634538 230 unknown [Glycine max] 0.907 0.469 0.768 3e-42
356545912 360 PREDICTED: tetratricopeptide repeat prot 0.907 0.3 0.768 5e-42
3142297 427 Contains similarity to serine/threonine 0.915 0.255 0.733 2e-41
>gi|224070033|ref|XP_002303105.1| predicted protein [Populus trichocarpa] gi|222844831|gb|EEE82378.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  185 bits (470), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 87/108 (80%), Positives = 99/108 (91%)

Query: 1   MALWMDAESEPKTESEKADLDAIAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAI 60
           MALWM+A SEPKTESE ADL AI+ALK S A+ELKEKGNEYVK GKKHYSDAI+CYTRAI
Sbjct: 1   MALWMEAGSEPKTESEIADLQAISALKHSTALELKEKGNEYVKMGKKHYSDAIECYTRAI 60

Query: 61  NQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVV 108
           NQ+ LSDS+NS++Y+NRAHVNLLLGNYRRA TDA+EA+KLCPTNVK +
Sbjct: 61  NQDALSDSDNSIVYSNRAHVNLLLGNYRRALTDAQEAIKLCPTNVKAM 108




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225437945|ref|XP_002269637.1| PREDICTED: tetratricopeptide repeat protein 4 homolog [Vitis vinifera] gi|297744240|emb|CBI37210.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356537202|ref|XP_003537118.1| PREDICTED: tetratricopeptide repeat protein 4 homolog [Glycine max] Back     alignment and taxonomy information
>gi|255575041|ref|XP_002528426.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] gi|223532162|gb|EEF33968.1| heat shock protein 70 (HSP70)-interacting protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449509065|ref|XP_004163482.1| PREDICTED: tetratricopeptide repeat protein 4 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|449468596|ref|XP_004152007.1| PREDICTED: tetratricopeptide repeat protein 4 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|297843222|ref|XP_002889492.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297335334|gb|EFH65751.1| binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255634538|gb|ACU17632.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356545912|ref|XP_003541377.1| PREDICTED: tetratricopeptide repeat protein 4 homolog [Glycine max] Back     alignment and taxonomy information
>gi|3142297|gb|AAC16748.1| Contains similarity to serine/threonine protein phosphatase gb|X83099 from S. cerevisiae [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query119
TAIR|locus:2020225 360 TPR2 "tetratricopeptide repeat 0.907 0.3 0.740 1.4e-39
ZFIN|ZDB-GENE-040426-1021 402 ttc4 "tetratricopeptide repeat 0.672 0.199 0.414 1.2e-09
SGD|S000003355 513 PPT1 "Protein serine/threonine 0.638 0.148 0.390 5e-09
ZFIN|ZDB-GENE-040704-72 320 sgta "small glutamine-rich tet 0.588 0.218 0.407 1.2e-08
CGD|CAL0005143 390 CNS1 [Candida albicans (taxid: 0.747 0.228 0.385 1.4e-08
UNIPROTKB|Q5ABB8 390 CNS1 "Putative uncharacterized 0.747 0.228 0.385 1.4e-08
DICTYBASE|DDB_G0286253 397 ttc4 "tetratricopeptide repeat 0.815 0.244 0.292 2.3e-08
SGD|S000000359 385 CNS1 "TPR-containing co-chaper 0.747 0.231 0.385 3.6e-08
UNIPROTKB|E2RJK8309 TOMM34 "Uncharacterized protei 0.773 0.297 0.386 4.9e-08
RGD|1309029309 Tomm34 "translocase of outer m 0.815 0.313 0.387 6.3e-08
TAIR|locus:2020225 TPR2 "tetratricopeptide repeat 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 422 (153.6 bits), Expect = 1.4e-39, P = 1.4e-39
 Identities = 80/108 (74%), Positives = 95/108 (87%)

Query:     1 MALWMDAESEPKTESEKADLDAIAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAI 60
             MALWMDA + P TE EKADL+AI+ALKES AIE KE+GNE V+KGKKHYS+AIDCYT+AI
Sbjct:     1 MALWMDAGATPTTEKEKADLEAISALKESTAIEFKEEGNECVRKGKKHYSEAIDCYTKAI 60

Query:    61 NQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVV 108
             +Q VLSDSE S+L++NR+HVNLLLGNYRRA TDAEE+++L P NVK V
Sbjct:    61 SQGVLSDSETSILFSNRSHVNLLLGNYRRALTDAEESMRLSPHNVKAV 108




GO:0005737 "cytoplasm" evidence=ISM
GO:0051879 "Hsp90 protein binding" evidence=IPI
ZFIN|ZDB-GENE-040426-1021 ttc4 "tetratricopeptide repeat domain 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
SGD|S000003355 PPT1 "Protein serine/threonine phosphatase, regulates Hsp90 chaperone by af" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040704-72 sgta "small glutamine-rich tetratricopeptide repeat (TPR)-containing, alpha" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
CGD|CAL0005143 CNS1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ABB8 CNS1 "Putative uncharacterized protein CNS1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286253 ttc4 "tetratricopeptide repeat domain 4" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000000359 CNS1 "TPR-containing co-chaperone" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJK8 TOMM34 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1309029 Tomm34 "translocase of outer mitochondrial membrane 34" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-10
pfam1341469 pfam13414, TPR_11, TPR repeat 4e-09
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 2e-06
PLN03088 356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 2e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-04
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 52.4 bits (126), Expect = 4e-10
 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query: 33  ELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFT 92
            L   GN Y K G   Y +A++ Y +A+      D +N+  Y N A     LG Y  A  
Sbjct: 2   ALLNLGNLYYKLGD--YDEALEYYEKALEL----DPDNADAYYNLAAAYYKLGKYEEALE 55

Query: 93  DAEEALKLCPTNVKV 107
           D E+AL+L P N K 
Sbjct: 56  DYEKALELDPDNAKA 70


Length = 100

>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 119
KOG0553 304 consensus TPR repeat-containing protein [General f 99.74
PRK15359144 type III secretion system chaperone protein SscB; 99.67
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.67
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.65
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.64
PRK15359144 type III secretion system chaperone protein SscB; 99.62
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.54
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.52
PRK10370198 formate-dependent nitrite reductase complex subuni 99.51
KOG4234271 consensus TPR repeat-containing protein [General f 99.5
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.5
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.49
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.48
PRK11189 296 lipoprotein NlpI; Provisional 99.47
KOG0553 304 consensus TPR repeat-containing protein [General f 99.46
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.45
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.44
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.43
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.42
PRK11189 296 lipoprotein NlpI; Provisional 99.41
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.4
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.39
PRK12370 553 invasion protein regulator; Provisional 99.38
PF1337173 TPR_9: Tetratricopeptide repeat 99.38
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.37
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.37
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.37
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.34
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.32
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 99.32
PRK12370 553 invasion protein regulator; Provisional 99.31
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.29
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 99.29
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.27
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.26
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.25
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.25
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.25
PLN02789 320 farnesyltranstransferase 99.24
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.23
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.22
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.21
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.21
KOG1155 559 consensus Anaphase-promoting complex (APC), Cdc23 99.2
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 99.2
KOG1126 638 consensus DNA-binding cell division cycle control 99.2
PRK10370198 formate-dependent nitrite reductase complex subuni 99.18
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.17
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.16
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.16
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.16
KOG1125579 consensus TPR repeat-containing protein [General f 99.15
PLN02789 320 farnesyltranstransferase 99.15
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.15
KOG1126638 consensus DNA-binding cell division cycle control 99.15
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.15
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.14
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.13
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.11
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.11
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.1
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.07
COG3063 250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.07
TIGR03302 235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.06
PRK15331165 chaperone protein SicA; Provisional 99.06
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.04
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.04
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.03
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.03
KOG1125579 consensus TPR repeat-containing protein [General f 99.02
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.99
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.99
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.99
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.99
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.98
PRK10803263 tol-pal system protein YbgF; Provisional 98.98
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.96
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.96
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.94
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.93
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 98.92
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.91
PRK11788 389 tetratricopeptide repeat protein; Provisional 98.91
PRK11788 389 tetratricopeptide repeat protein; Provisional 98.9
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.9
PF13512142 TPR_18: Tetratricopeptide repeat 98.9
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.88
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.88
PF13525 203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.88
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 98.86
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 98.85
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.85
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.84
PF1342844 TPR_14: Tetratricopeptide repeat 98.82
KOG4555175 consensus TPR repeat-containing protein [Function 98.82
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.82
KOG4234271 consensus TPR repeat-containing protein [General f 98.81
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.77
KOG2076 895 consensus RNA polymerase III transcription factor 98.76
PRK11906458 transcriptional regulator; Provisional 98.76
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.71
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.71
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.71
PRK10803263 tol-pal system protein YbgF; Provisional 98.69
PRK15331165 chaperone protein SicA; Provisional 98.68
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.67
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.67
PF12688120 TPR_5: Tetratrico peptide repeat 98.65
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.62
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.62
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.6
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.59
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.58
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 98.57
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.57
KOG2076 895 consensus RNA polymerase III transcription factor 98.57
PRK11906458 transcriptional regulator; Provisional 98.55
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.54
PRK14574 822 hmsH outer membrane protein; Provisional 98.54
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.53
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.52
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.52
PF1343134 TPR_17: Tetratricopeptide repeat 98.5
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.49
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.45
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.44
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.44
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.43
KOG2003 840 consensus TPR repeat-containing protein [General f 98.43
PF1337173 TPR_9: Tetratricopeptide repeat 98.43
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.43
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.42
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.42
KOG1129478 consensus TPR repeat-containing protein [General f 98.42
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.41
KOG4555175 consensus TPR repeat-containing protein [Function 98.39
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.39
PF13512142 TPR_18: Tetratricopeptide repeat 98.36
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.34
PF1342844 TPR_14: Tetratricopeptide repeat 98.33
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.31
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.31
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.3
COG4105 254 ComL DNA uptake lipoprotein [General function pred 98.29
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.27
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 98.27
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.26
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 98.26
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.26
PRK14574 822 hmsH outer membrane protein; Provisional 98.25
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.25
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.24
PF12688120 TPR_5: Tetratrico peptide repeat 98.24
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.21
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.2
KOG1129478 consensus TPR repeat-containing protein [General f 98.2
KOG2003 840 consensus TPR repeat-containing protein [General f 98.18
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 98.15
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 98.15
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.14
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 98.12
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 98.11
PRK10941269 hypothetical protein; Provisional 98.09
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.05
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.05
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.03
PF06552 186 TOM20_plant: Plant specific mitochondrial import r 98.03
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.02
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.0
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.99
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 97.99
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 97.97
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.97
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 97.97
KOG1310 758 consensus WD40 repeat protein [General function pr 97.96
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.96
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.93
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.87
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.86
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.86
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.85
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.79
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 97.77
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.76
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 97.76
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.75
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.71
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.71
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.7
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 97.7
PF1343134 TPR_17: Tetratricopeptide repeat 97.69
KOG0495 913 consensus HAT repeat protein [RNA processing and m 97.68
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.67
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.62
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.61
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.6
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.58
COG4976 287 Predicted methyltransferase (contains TPR repeat) 97.55
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.48
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.44
KOG2471 696 consensus TPR repeat-containing protein [General f 97.41
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.38
KOG3364149 consensus Membrane protein involved in organellar 97.32
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.29
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.29
COG4700251 Uncharacterized protein conserved in bacteria cont 97.27
PF1286294 Apc5: Anaphase-promoting complex subunit 5 97.24
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.23
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.22
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 97.21
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.19
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.18
KOG4814 872 consensus Uncharacterized conserved protein [Funct 97.18
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.18
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 97.17
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.15
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.11
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.08
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.08
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.07
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 97.04
COG0457 291 NrfG FOG: TPR repeat [General function prediction 97.02
COG2912269 Uncharacterized conserved protein [Function unknow 96.97
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.92
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.9
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.89
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.87
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.83
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.78
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.76
KOG2376 652 consensus Signal recognition particle, subunit Srp 96.71
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.71
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.69
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.67
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.61
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.57
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 96.55
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.45
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 96.4
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.24
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 96.17
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 96.11
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.05
KOG0529 421 consensus Protein geranylgeranyltransferase type I 96.05
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.01
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 95.99
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 95.98
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 95.92
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.84
COG5191 435 Uncharacterized conserved protein, contains HAT (H 95.67
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.65
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 95.61
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.59
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.58
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 95.48
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 95.48
KOG0530 318 consensus Protein farnesyltransferase, alpha subun 95.45
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 95.44
KOG1586288 consensus Protein required for fusion of vesicles 95.43
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 95.4
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.39
PLN03218 1060 maturation of RBCL 1; Provisional 95.39
KOG1310 758 consensus WD40 repeat protein [General function pr 95.31
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 95.23
PRK10941269 hypothetical protein; Provisional 95.23
COG4700 251 Uncharacterized protein conserved in bacteria cont 95.19
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.14
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 95.12
PLN03218 1060 maturation of RBCL 1; Provisional 95.07
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.01
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 94.98
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 94.94
PLN03077 857 Protein ECB2; Provisional 94.91
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.87
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 94.83
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 94.82
PRK04841 903 transcriptional regulator MalT; Provisional 94.8
PRK04841 903 transcriptional regulator MalT; Provisional 94.74
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.72
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.62
COG3629280 DnrI DNA-binding transcriptional activator of the 94.62
PLN03077 857 Protein ECB2; Provisional 94.26
KOG0529 421 consensus Protein geranylgeranyltransferase type I 94.25
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.23
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 94.06
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 94.03
KOG1915 677 consensus Cell cycle control protein (crooked neck 94.0
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.99
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 93.83
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 93.79
KOG1586 288 consensus Protein required for fusion of vesicles 93.64
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 92.88
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 92.47
PF0421269 MIT: MIT (microtubule interacting and transport) d 92.41
COG4455 273 ImpE Protein of avirulence locus involved in tempe 92.11
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 91.53
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 91.45
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 91.27
KOG1550 552 consensus Extracellular protein SEL-1 and related 91.23
COG3947361 Response regulator containing CheY-like receiver a 91.07
KOG1550 552 consensus Extracellular protein SEL-1 and related 91.04
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 90.85
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 90.82
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 90.82
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 90.78
COG4976 287 Predicted methyltransferase (contains TPR repeat) 90.68
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 90.44
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 90.17
KOG3783 546 consensus Uncharacterized conserved protein [Funct 90.11
KOG2758 432 consensus Translation initiation factor 3, subunit 90.11
COG2976207 Uncharacterized protein conserved in bacteria [Fun 90.07
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 89.87
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 89.83
KOG1585 308 consensus Protein required for fusion of vesicles 89.83
COG2912269 Uncharacterized conserved protein [Function unknow 89.71
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 89.6
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 89.52
KOG1941 518 consensus Acetylcholine receptor-associated protei 89.46
PF13281 374 DUF4071: Domain of unknown function (DUF4071) 89.29
KOG1070 1710 consensus rRNA processing protein Rrp5 [RNA proces 89.25
KOG1915 677 consensus Cell cycle control protein (crooked neck 88.97
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 88.94
KOG2610 491 consensus Uncharacterized conserved protein [Funct 88.67
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 88.56
KOG0686 466 consensus COP9 signalosome, subunit CSN1 [Posttran 88.3
smart0074577 MIT Microtubule Interacting and Trafficking molecu 88.05
cd0265675 MIT MIT: domain contained within Microtubule Inter 87.84
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 87.77
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 87.67
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 87.59
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 87.15
KOG2300 629 consensus Uncharacterized conserved protein [Funct 86.93
COG3898 531 Uncharacterized membrane-bound protein [Function u 86.25
COG5536 328 BET4 Protein prenyltransferase, alpha subunit [Pos 86.02
COG4941415 Predicted RNA polymerase sigma factor containing a 85.87
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 85.7
PF0421269 MIT: MIT (microtubule interacting and transport) d 85.65
PF1285434 PPR_1: PPR repeat 85.64
COG3947361 Response regulator containing CheY-like receiver a 85.4
KOG2047 835 consensus mRNA splicing factor [RNA processing and 85.1
KOG2471 696 consensus TPR repeat-containing protein [General f 84.83
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 84.58
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 83.85
KOG3364149 consensus Membrane protein involved in organellar 83.84
KOG1941 518 consensus Acetylcholine receptor-associated protei 83.83
cd0267979 MIT_spastin MIT: domain contained within Microtubu 83.5
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 83.38
PF07219108 HemY_N: HemY protein N-terminus; InterPro: IPR0108 82.91
KOG1585 308 consensus Protein required for fusion of vesicles 82.63
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 82.38
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 82.31
KOG4507 886 consensus Uncharacterized conserved protein, conta 82.12
KOG4563 400 consensus Cell cycle-regulated histone H1-binding 82.04
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 82.01
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 81.79
PF06957 422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 81.31
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 81.23
PF1304150 PPR_2: PPR repeat family 80.72
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 80.48
COG3898 531 Uncharacterized membrane-bound protein [Function u 80.16
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
Probab=99.74  E-value=1.2e-17  Score=116.65  Aligned_cols=86  Identities=35%  Similarity=0.446  Sum_probs=81.7

Q ss_pred             cHHHHHHHHHHHHHHHHhChhcHHHHHHHHHHHHhhccCCCcchHHHHHHHHHHHHHhcCHHHHHHHHHHHHhhCCCCHH
Q 033440           27 KESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVK  106 (119)
Q Consensus        27 ~~~~~~~~~~~g~~~~~~g~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~a~~~~~l~~~~~A~~~~~~al~l~p~~~~  106 (119)
                      +...++.++..||.+++.+  +|++|+..|++||++    +|.++.+|.|||.+|.++|.|+.|+++|+.+|.+||.+.+
T Consensus        77 ~~~~AE~LK~eGN~~m~~~--~Y~eAv~kY~~AI~l----~P~nAVyycNRAAAy~~Lg~~~~AVkDce~Al~iDp~ysk  150 (304)
T KOG0553|consen   77 DKALAESLKNEGNKLMKNK--DYQEAVDKYTEAIEL----DPTNAVYYCNRAAAYSKLGEYEDAVKDCESALSIDPHYSK  150 (304)
T ss_pred             HHHHHHHHHHHHHHHHHhh--hHHHHHHHHHHHHhc----CCCcchHHHHHHHHHHHhcchHHHHHHHHHHHhcChHHHH
Confidence            4457889999999999998  999999999999999    9999999999999999999999999999999999999999


Q ss_pred             HHHHhhccCcCC
Q 033440          107 VVILCSGSHPNQ  118 (119)
Q Consensus       107 a~~~~a~~~~~~  118 (119)
                      +|-++|.+|+.+
T Consensus       151 ay~RLG~A~~~~  162 (304)
T KOG0553|consen  151 AYGRLGLAYLAL  162 (304)
T ss_pred             HHHHHHHHHHcc
Confidence            999999998654



>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2758 consensus Translation initiation factor 3, subunit e (eIF-3e) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF07219 HemY_N: HemY protein N-terminus; InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 4e-06
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 1e-05
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 2e-05
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 3e-05
2c2l_A 281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 1e-04
2l6j_A111 Tah1 Complexed By Meevd Length = 111 2e-04
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 7e-04
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure

Iteration: 1

Score = 46.2 bits (108), Expect = 4e-06, Method: Compositional matrix adjust. Identities = 32/87 (36%), Positives = 45/87 (51%), Gaps = 6/87 (6%) Query: 23 IAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNL 82 +A + A E K KGNEY KKG Y A+ R N+ V D EN++LY+NRA Sbjct: 5 LAYINPELAQEEKNKGNEYFKKG--DYPTAM----RHYNEAVKRDPENAILYSNRAACLT 58 Query: 83 LLGNYRRAFTDAEEALKLCPTNVKVVI 109 L ++RA D + ++L +K I Sbjct: 59 KLMEFQRALDDCDTCIRLDSKFIKGYI 85
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|2L6J|A Chain A, Tah1 Complexed By Meevd Length = 111 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query119
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 5e-22
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 3e-21
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 4e-21
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-20
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-20
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 3e-20
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-20
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 5e-20
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 3e-19
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-19
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-19
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 6e-17
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-16
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-14
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 4e-14
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-13
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 6e-04
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-12
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 2e-08
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 6e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-05
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 2e-04
2gw1_A 514 Mitochondrial precursor proteins import receptor; 7e-12
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-08
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-08
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-06
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-06
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-04
2gw1_A 514 Mitochondrial precursor proteins import receptor; 6e-04
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-10
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-10
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-07
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-06
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-10
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-10
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-07
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-05
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 4e-10
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-10
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-06
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-05
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-08
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 6e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 3e-07
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-07
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-06
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-06
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-05
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-05
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-04
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-05
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-04
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-05
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-05
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-05
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-05
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-04
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-05
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 2e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-05
3urz_A 208 Uncharacterized protein; tetratricopeptide repeats 3e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-05
3u4t_A 272 TPR repeat-containing protein; structural genomics 3e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-04
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 7e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-04
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 3e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 8e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-04
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 7e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-04
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
 Score = 83.6 bits (207), Expect = 5e-22
 Identities = 28/101 (27%), Positives = 49/101 (48%), Gaps = 3/101 (2%)

Query: 6   DAESEPKTESEKADLDAIAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVL 65
              S              A    S+  +L+++GNE  K G   Y  A+  YT+A+  +  
Sbjct: 3   SGSSGMTVSGPGTPEPRPATPGASSVEQLRKEGNELFKCGD--YGGALAAYTQALGLD-A 59

Query: 66  SDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVK 106
           +  + +VL+ NRA  +L L +Y +A T+A +A++    +VK
Sbjct: 60  TPQDQAVLHRNRAACHLKLEDYDKAETEASKAIEKDGGDVK 100


>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.84
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.8
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.77
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.73
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.72
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.72
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.72
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.7
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.68
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.67
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.66
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.65
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.65
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.65
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.64
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.64
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.63
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.63
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.63
3k9i_A117 BH0479 protein; putative protein binding protein, 99.63
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.62
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.62
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.62
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.62
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.61
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.61
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.6
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.6
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.6
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.59
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.59
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.58
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.58
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.58
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.57
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.57
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.56
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.55
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.54
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.54
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.53
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.53
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.53
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.53
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.53
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.52
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.52
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.52
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.52
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.51
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.5
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.5
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.5
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.5
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.5
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.49
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.49
3urz_A 208 Uncharacterized protein; tetratricopeptide repeats 99.48
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.48
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.47
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.47
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.47
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.47
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.47
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.47
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.46
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.46
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.46
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.45
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.45
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.45
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.45
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.44
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.44
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.44
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.44
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.43
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.43
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.43
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.43
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.43
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.42
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 99.41
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.41
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.41
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.4
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.4
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.4
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.4
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.4
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.39
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.39
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.38
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.38
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.38
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.37
3u4t_A 272 TPR repeat-containing protein; structural genomics 99.36
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.36
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.36
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.36
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.35
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 99.35
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.35
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.35
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.34
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.34
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.34
3u4t_A272 TPR repeat-containing protein; structural genomics 99.34
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.34
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.33
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.32
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.31
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.3
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.3
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.3
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.3
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.3
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.29
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.28
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.27
3k9i_A117 BH0479 protein; putative protein binding protein, 99.27
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.26
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.26
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.26
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.26
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.25
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 99.23
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 99.22
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.21
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.2
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.19
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.17
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.17
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.16
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 99.15
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.15
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 99.14
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.13
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 99.13
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.12
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 99.12
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.12
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 99.11
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 99.11
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.1
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.1
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.09
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.08
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 99.04
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 99.04
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.03
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.02
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 99.02
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.01
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.0
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 98.97
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.96
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.96
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.96
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.94
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.94
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.92
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.92
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 98.92
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.9
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.88
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.88
3rjv_A 212 Putative SEL1 repeat protein; alpha-alpha superhel 98.88
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.88
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.87
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.87
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.85
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.85
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.85
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.85
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.85
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.81
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.81
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.81
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.76
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.76
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.73
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.71
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.67
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.62
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.62
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.62
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.59
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.58
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.57
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.56
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.56
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.51
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.48
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.46
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.45
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.42
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.42
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.39
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.33
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.27
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.23
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.22
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.1
3mv2_B 310 Coatomer subunit epsilon; vesicular membrane coat 98.04
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.02
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.93
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.91
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.82
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.71
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.7
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.66
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.64
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.62
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.46
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.32
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.28
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.08
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.96
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 96.66
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.41
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 96.28
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 96.18
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.99
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 95.55
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 95.19
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.1
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.01
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.69
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 94.52
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 94.42
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 93.08
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 92.55
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 91.32
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 91.08
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 90.91
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 90.75
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 90.69
2vkj_A106 TM1634; membrane protein, TPR motif joint center f 90.61
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 89.91
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 89.7
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 89.65
3kae_A 242 CDC27, possible protein of nuclear scaffold; tetra 88.33
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 88.1
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 87.99
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 87.48
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 87.22
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 86.98
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 86.84
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 86.63
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 85.64
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 85.01
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 84.77
3t5x_A 203 PCI domain-containing protein 2; PCI, mRNA nuclear 82.75
3myv_A 454 SUSD superfamily protein; RAGB, SUSD and hypotheti 82.57
3t5x_A 203 PCI domain-containing protein 2; PCI, mRNA nuclear 81.66
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 81.65
3lew_A 495 SUSD-like carbohydrate binding protein; structural 81.65
2ijq_A161 Hypothetical protein; structural genomics, PSI, pr 81.04
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 80.95
3kez_A 461 Putative sugar binding protein; structural genomic 80.86
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 80.82
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 80.59
3mcx_A 477 SUSD superfamily protein; structural genomics, joi 80.58
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.84  E-value=1.2e-20  Score=117.31  Aligned_cols=88  Identities=35%  Similarity=0.525  Sum_probs=73.5

Q ss_pred             HHHhcHHHHHHHHHHHHHHHHhChhcHHHHHHHHHHHHhhccCCCcchHHHHHHHHHHHHHhcCHHHHHHHHHHHHhhCC
Q 033440           23 IAALKESAAIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCP  102 (119)
Q Consensus        23 ~~~~~~~~~~~~~~~g~~~~~~g~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~a~~~~~l~~~~~A~~~~~~al~l~p  102 (119)
                      +..++|+.++.+.++|+.+++.|  +|++|+..|+++|++    +|.++.+++++|.|+..+|++++|+.+++++++++|
T Consensus         5 ~a~inP~~a~~~~~~G~~~~~~g--~~~~A~~~~~~al~~----~p~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p   78 (126)
T 4gco_A            5 LAYINPELAQEEKNKGNEYFKKG--DYPTAMRHYNEAVKR----DPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDS   78 (126)
T ss_dssp             --CCCHHHHHHHHHHHHHHHHTT--CHHHHHHHHHHHHHH----CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT
T ss_pred             HHHHCHHHHHHHHHHHHHHHHcC--CHHHHHHHHHHHHHh----CCCCHHHHHHHhhHHHhhccHHHHHHHHHHHHHhhh
Confidence            34578888888888888888887  888888888888888    888888888888888888888888888888888888


Q ss_pred             CCHHHHHHhhccCc
Q 033440          103 TNVKVVILCSGSHP  116 (119)
Q Consensus       103 ~~~~a~~~~a~~~~  116 (119)
                      +++.+|+.+|.++.
T Consensus        79 ~~~~a~~~lg~~~~   92 (126)
T 4gco_A           79 KFIKGYIRKAACLV   92 (126)
T ss_dssp             TCHHHHHHHHHHHH
T ss_pred             hhhHHHHHHHHHHH
Confidence            88888888888764



>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2vkj_A TM1634; membrane protein, TPR motif joint center for structural GENO JCSG, structural genomics; 1.65A {Thermotoga maritima} PDB: 2vko_A* Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>3myv_A SUSD superfamily protein; RAGB, SUSD and hypothetical proteins, structural genomics, J center for structural genomics, JCSG; HET: MSE; 1.80A {Bacteroides vulgatus} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3lew_A SUSD-like carbohydrate binding protein; structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 1PE 2PE; 1.70A {Bacteroides vulgatus} Back     alignment and structure
>2ijq_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.88A {Haloarcula marismortui} SCOP: a.246.2.1 Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>3kez_A Putative sugar binding protein; structural genomics, joint C structural genomics, JCSG, protein structure initiative; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>3mcx_A SUSD superfamily protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE GOL; 1.49A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 119
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-04
d1hh8a_ 192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 5e-04
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 6e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.002
d1xnfa_ 259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.4 bits (98), Expect = 3e-06
 Identities = 9/74 (12%), Positives = 24/74 (32%), Gaps = 6/74 (8%)

Query: 34  LKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTD 93
             E  +   + G   +  A     +   Q    + +N+ +    + ++       R+   
Sbjct: 2   PMELAHREYQAGD--FEAAERHCMQLWRQ----EPDNTGVLLLLSSIHFQCRRLDRSAHF 55

Query: 94  AEEALKLCPTNVKV 107
           +  A+K  P   + 
Sbjct: 56  STLAIKQNPLLAEA 69


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query119
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 99.77
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.73
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.69
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.69
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.66
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.65
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.64
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.63
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.62
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.62
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.62
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.61
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.61
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.6
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.59
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.59
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.58
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.57
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.56
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.55
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.55
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.54
d1hh8a_ 192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.54
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.51
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.49
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.47
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.35
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.3
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.2
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.18
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.13
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.1
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.94
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.94
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.92
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.87
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.81
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 98.71
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.7
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.64
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.63
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.32
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.25
d2onda1 308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.16
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.08
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.89
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.69
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.57
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.39
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 93.05
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 92.15
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 91.76
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 87.64
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 86.52
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 82.99
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 82.09
d3efza1223 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ 80.2
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.77  E-value=6.7e-19  Score=113.96  Aligned_cols=81  Identities=33%  Similarity=0.466  Sum_probs=76.8

Q ss_pred             HHHHHHHHHHHHHhChhcHHHHHHHHHHHHhhccCCCcchHHHHHHHHHHHHHhcCHHHHHHHHHHHHhhCCCCHHHHHH
Q 033440           31 AIELKEKGNEYVKKGKKHYSDAIDCYTRAINQNVLSDSENSVLYANRAHVNLLLGNYRRAFTDAEEALKLCPTNVKVVIL  110 (119)
Q Consensus        31 ~~~~~~~g~~~~~~g~~~~~~A~~~~~~al~~~~~~~~~~~~~~~~~a~~~~~l~~~~~A~~~~~~al~l~p~~~~a~~~  110 (119)
                      +..+.+.|+.+++.|  +|++|+..|+++|++    +|.++.+|+++|.||.++|+|++|+.+|+++++++|+++.+|++
T Consensus         4 a~~l~~~Gn~~~~~g--~~~~Ai~~~~kal~~----~p~~~~~~~~lg~~y~~~~~~~~Ai~~~~~al~l~p~~~~a~~~   77 (201)
T d2c2la1           4 AQELKEQGNRLFVGR--KYPEAAACYGRAITR----NPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFF   77 (201)
T ss_dssp             HHHHHHHHHHHHHTT--CHHHHHHHHHHHHHH----CSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHTTSCTTCHHHHHH
T ss_pred             HHHHHHHHHHHHHcC--CHHHHHHHHHHHHHh----CCCCHHHHHhHHHHHhhhhhhhhhhHHHHHHHHhCCCcHHHHHH
Confidence            667899999999998  999999999999999    99999999999999999999999999999999999999999999


Q ss_pred             hhccCcC
Q 033440          111 CSGSHPN  117 (119)
Q Consensus       111 ~a~~~~~  117 (119)
                      +|.+|..
T Consensus        78 lg~~~~~   84 (201)
T d2c2la1          78 LGQCQLE   84 (201)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            9998854



>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure