Citrus Sinensis ID: 033510

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MATLDSDVPMVPVGEASSSAGPSSSSKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH
ccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEcccccEEEEEcccccHHHHHHHcccccccccccccccccccccccHHHHHHHHHccccccccccccEEEcccc
ccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEEEEcccHHEHHccccccHHcccccccccccccEEEEEcccHHHHHHHHHHHHHcccccccccccEEEEEccc
matldsdvpmvpvgeasssagpsssskkpkrfeIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQanqasatseectvawgvcnhafhFHCISRwlktrqvcpldnsewefqkygh
matldsdvpmvpvgeasssagpsssskkpkrFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSewefqkygh
MATLDSDVPMVPVGEasssagpsssskkpkRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH
*******************************FEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF*****
***********************************KWSAVALWAWDIVVDNCAICRNHIMDLCIE**************VAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYG*
********PMVPV*******************EIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH
****************************PKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYG*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATLDSDVPMVPVGEASSSAGPSSSSKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query118 2.2.26 [Sep-21-2011]
Q940X7118 RING-box protein 1a OS=Ar yes no 1.0 1.0 0.932 6e-57
Q8QG64108 RING-box protein 1 OS=Sal N/A no 0.898 0.981 0.811 7e-49
Q9W5E1108 RING-box protein 1A OS=Dr yes no 0.822 0.898 0.928 8e-49
P62878108 E3 ubiquitin-protein liga yes no 0.915 1.0 0.825 8e-49
P62877108 E3 ubiquitin-protein liga yes no 0.915 1.0 0.825 8e-49
Q9M2B0115 RING-box protein 1b OS=Ar no no 0.974 1.0 0.864 8e-49
Q54K33104 RING-box protein 1 OS=Dic yes no 0.822 0.932 0.846 2e-45
Q23457110 RING-box protein 1 OS=Cae yes no 0.898 0.963 0.752 7e-45
O13959107 RING-box protein pip1 OS= yes no 0.788 0.869 0.838 1e-43
Q9NHX0122 RING-box protein 1B OS=Dr no no 0.847 0.819 0.660 4e-35
>sp|Q940X7|RBX1A_ARATH RING-box protein 1a OS=Arabidopsis thaliana GN=RBX1A PE=1 SV=1 Back     alignment and function desciption
 Score =  218 bits (556), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 112/118 (94%)

Query: 1   MATLDSDVPMVPVGEASSSAGPSSSSKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM 60
           MATLDSDV M+P GEASSS   SSS+KK KRFEIKKWSAVALWAWDIVVDNCAICRNHIM
Sbjct: 1   MATLDSDVTMIPAGEASSSVAASSSNKKAKRFEIKKWSAVALWAWDIVVDNCAICRNHIM 60

Query: 61  DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH 118
           DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH
Sbjct: 61  DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH 118
Component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex, which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. The SCF complex plays a crucial role in regulating response to auxin and is essential for growth and development. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme, to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL1.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8QG64|RBX1_SALSA RING-box protein 1 OS=Salmo salar GN=rbx1 PE=2 SV=2 Back     alignment and function description
>sp|Q9W5E1|RBX1A_DROME RING-box protein 1A OS=Drosophila melanogaster GN=Roc1a PE=1 SV=1 Back     alignment and function description
>sp|P62878|RBX1_MOUSE E3 ubiquitin-protein ligase RBX1 OS=Mus musculus GN=Rbx1 PE=1 SV=1 Back     alignment and function description
>sp|P62877|RBX1_HUMAN E3 ubiquitin-protein ligase RBX1 OS=Homo sapiens GN=RBX1 PE=1 SV=1 Back     alignment and function description
>sp|Q9M2B0|RBX1B_ARATH RING-box protein 1b OS=Arabidopsis thaliana GN=RBX1B PE=2 SV=1 Back     alignment and function description
>sp|Q54K33|RBX1_DICDI RING-box protein 1 OS=Dictyostelium discoideum GN=rbx1 PE=3 SV=1 Back     alignment and function description
>sp|Q23457|RBX1_CAEEL RING-box protein 1 OS=Caenorhabditis elegans GN=rbx-1 PE=1 SV=1 Back     alignment and function description
>sp|O13959|RBX1_SCHPO RING-box protein pip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pip1 PE=1 SV=2 Back     alignment and function description
>sp|Q9NHX0|RBX1B_DROME RING-box protein 1B OS=Drosophila melanogaster GN=Roc1b PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
351723009118 uncharacterized protein LOC100526919 [Gl 1.0 1.0 0.940 2e-60
356517622116 PREDICTED: RING-box protein 1a-like [Gly 0.983 1.0 0.957 1e-59
351725533116 uncharacterized protein LOC100500045 [Gl 0.983 1.0 0.949 3e-59
388518043117 unknown [Lotus japonicus] 0.974 0.982 0.957 4e-59
388495478117 unknown [Lotus japonicus] 0.974 0.982 0.948 1e-58
224068466117 predicted protein [Populus trichocarpa] 0.991 1.0 0.915 4e-58
357521749118 RING-box protein [Medicago truncatula] g 1.0 1.0 0.915 2e-57
75214626115 putative ring-box Roc1/Rbx1/Hrt1 protein 0.974 1.0 0.923 3e-57
82470793116 RBX1-like protein [Petunia integrifolia 0.983 1.0 0.889 3e-56
284520998118 putative ring-box Roc1/Rbx1/Hrt1 protein 1.0 1.0 0.966 1e-55
>gi|351723009|ref|NP_001235984.1| uncharacterized protein LOC100526919 [Glycine max] gi|255631147|gb|ACU15939.1| unknown [Glycine max] Back     alignment and taxonomy information
 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 115/118 (97%)

Query: 1   MATLDSDVPMVPVGEASSSAGPSSSSKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM 60
           MATLDSDV MVP GE S+SAGPSSS+KKPKRFEIKKW+AV+LWAWDIVVDNCAICRNHIM
Sbjct: 1   MATLDSDVTMVPAGEPSTSAGPSSSTKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIM 60

Query: 61  DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH 118
           DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH
Sbjct: 61  DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH 118

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356517622|ref|XP_003527486.1| PREDICTED: RING-box protein 1a-like [Glycine max] gi|83701143|gb|ABC41134.1| RING-box protein [Arachis hypogaea] Back     alignment and taxonomy information
>gi|351725533|ref|NP_001236072.1| uncharacterized protein LOC100500045 [Glycine max] gi|255628789|gb|ACU14739.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388518043|gb|AFK47083.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388495478|gb|AFK35805.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224068466|ref|XP_002326127.1| predicted protein [Populus trichocarpa] gi|222833320|gb|EEE71797.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357521749|ref|XP_003597006.1| RING-box protein [Medicago truncatula] gi|355486054|gb|AES67257.1| RING-box protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|75214626|gb|ABA18098.1| putative ring-box Roc1/Rbx1/Hrt1 protein [Olimarabidopsis pumila] Back     alignment and taxonomy information
>gi|82470793|gb|ABB77433.1| RBX1-like protein [Petunia integrifolia subsp. inflata] Back     alignment and taxonomy information
>gi|284520998|gb|ADB93074.1| putative ring-box Roc1/Rbx1/Hrt1 protein [Jatropha curcas] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query118
TAIR|locus:2099341115 AT3G42830 [Arabidopsis thalian 0.974 1.0 0.788 5.2e-49
UNIPROTKB|Q2HJI9108 RBX1 "Uncharacterized protein" 0.745 0.814 0.965 3.7e-48
UNIPROTKB|P62877108 RBX1 "E3 ubiquitin-protein lig 0.745 0.814 0.965 3.7e-48
UNIPROTKB|Q8QG64108 rbx1 "RING-box protein 1" [Sal 0.745 0.814 0.965 3.7e-48
MGI|MGI:1891829108 Rbx1 "ring-box 1" [Mus musculu 0.745 0.814 0.965 3.7e-48
RGD|1308453108 Rbx1 "ring-box 1, E3 ubiquitin 0.745 0.814 0.965 3.7e-48
ZFIN|ZDB-GENE-041008-106122 rbx1 "ring-box 1" [Danio rerio 0.745 0.721 0.965 3.7e-48
FB|FBgn0025638108 Roc1a "Roc1a" [Drosophila mela 0.745 0.814 0.954 7.7e-48
UNIPROTKB|E1BL52108 LOC780968 "Uncharacterized pro 0.745 0.814 0.943 5.4e-47
UNIPROTKB|G4MV42119 MGG_08844 "RING-box protein 1" 0.737 0.731 0.931 2.3e-46
TAIR|locus:2099341 AT3G42830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 511 (184.9 bits), Expect = 5.2e-49, P = 5.2e-49
 Identities = 93/118 (78%), Positives = 96/118 (81%)

Query:     1 MATLDSDVPMVPVGEXXXXXXXXXXXXXXXRFEIKKWSAVALWAWDIVVDNCAICRNHIM 60
             MA+L+SDV M   GE               RFE+KKWSAVALWAWDIVVDNCAICRNHIM
Sbjct:     1 MASLNSDVIM---GESSSISVPSSSSKNSKRFELKKWSAVALWAWDIVVDNCAICRNHIM 57

Query:    61 DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH 118
             DLCIEC ANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLD  EWEFQKYGH
Sbjct:    58 DLCIECLANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDVCEWEFQKYGH 115
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000151 "ubiquitin ligase complex" evidence=TAS
GO:0004842 "ubiquitin-protein ligase activity" evidence=TAS
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS
GO:0042023 "DNA endoreduplication" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0043248 "proteasome assembly" evidence=RCA
GO:0051510 "regulation of unidimensional cell growth" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
UNIPROTKB|Q2HJI9 RBX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P62877 RBX1 "E3 ubiquitin-protein ligase RBX1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8QG64 rbx1 "RING-box protein 1" [Salmo salar (taxid:8030)] Back     alignment and assigned GO terms
MGI|MGI:1891829 Rbx1 "ring-box 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308453 Rbx1 "ring-box 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041008-106 rbx1 "ring-box 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0025638 Roc1a "Roc1a" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BL52 LOC780968 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G4MV42 MGG_08844 "RING-box protein 1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P62878RBX1_MOUSE6, ., 3, ., 2, ., -0.82560.91521.0yesno
Q08273RBX1_YEASTNo assigned EC number0.58490.88130.8595yesno
O13959RBX1_SCHPONo assigned EC number0.83870.78810.8691yesno
Q9W5E1RBX1A_DROMENo assigned EC number0.92850.82200.8981yesno
Q9M2B0RBX1B_ARATHNo assigned EC number0.86440.97451.0nono
Q940X7RBX1A_ARATHNo assigned EC number0.93221.01.0yesno
Q8QG64RBX1_SALSANo assigned EC number0.81190.89830.9814N/Ano
Q23457RBX1_CAEELNo assigned EC number0.75220.89830.9636yesno
Q54K33RBX1_DICDINo assigned EC number0.84690.82200.9326yesno
P62877RBX1_HUMAN6, ., 3, ., 2, ., -0.82560.91521.0yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pm.C_280017
hypothetical protein (117 aa)
(Populus trichocarpa)
Predicted Functional Partners:
estExt_Genewise1_v1.C_LG_X4345
hypothetical protein (742 aa)
    ••• 0.829
estExt_fgenesh4_pm.C_570017
SubName- Full=Putative uncharacterized protein; (158 aa)
    ••  0.810
estExt_fgenesh4_pg.C_LG_V1566
SubName- Full=Putative uncharacterized protein; (157 aa)
    ••  0.809
gw1.I.8546.1
hypothetical protein (150 aa)
     •  0.800
gw1.713.2.1
annotation not avaliable (134 aa)
     •  0.800
eugene3.01970019
RecName- Full=Ubiquitin carrier protein; EC=6.3.2.-; (149 aa)
     •  0.800
estExt_fgenesh4_pg.C_1400017
hypothetical protein (149 aa)
     •  0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 8e-45
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 5e-39
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 2e-15
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 8e-06
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 9e-05
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 5e-04
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information 
 Score =  140 bits (354), Expect = 8e-45
 Identities = 52/89 (58%), Positives = 58/89 (65%), Gaps = 2/89 (2%)

Query: 30  KRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAF 89
            + +IKKW AVALW+WDI +D CAICRNHIM  C ECQ        +EC V WGVCNHAF
Sbjct: 1   MKVKIKKWHAVALWSWDIPIDVCAICRNHIMGTCPECQFG--MTPGDECPVVWGVCNHAF 58

Query: 90  HFHCISRWLKTRQVCPLDNSEWEFQKYGH 118
           H HCI RWL T+ VCPLD   W     G 
Sbjct: 59  HDHCIYRWLDTKGVCPLDRQTWVLADGGA 87

Length = 88
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 118
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 100.0
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 99.95
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.92
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.91
KOG149384 consensus Anaphase-promoting complex (APC), subuni 99.88
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.65
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.47
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.4
PHA02929238 N1R/p28-like protein; Provisional 99.39
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.24
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.23
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.19
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.18
PHA02926242 zinc finger-like protein; Provisional 99.14
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.11
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.1
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.1
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 99.08
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 99.03
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.02
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.02
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.97
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.95
PF1463444 zf-RING_5: zinc-RING finger domain 98.92
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.84
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.77
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.63
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.58
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.57
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.53
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.53
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.52
COG52191525 Uncharacterized conserved protein, contains RING Z 98.5
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.46
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 98.45
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.42
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.36
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.32
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.23
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.19
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.16
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.87
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.85
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.83
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.77
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.73
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.56
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.54
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.49
KOG1941518 consensus Acetylcholine receptor-associated protei 97.45
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.41
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.36
PHA02862156 5L protein; Provisional 97.26
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.23
PHA02825162 LAP/PHD finger-like protein; Provisional 97.22
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.11
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 97.02
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 96.94
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.91
COG5152259 Uncharacterized conserved protein, contains RING a 96.9
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.83
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.79
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.71
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.65
KOG1002 791 consensus Nucleotide excision repair protein RAD16 96.62
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.59
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.54
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.54
PHA03096284 p28-like protein; Provisional 96.53
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.45
KOG2660 331 consensus Locus-specific chromosome binding protei 96.37
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 96.28
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.21
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.98
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 95.91
PF04641260 Rtf2: Rtf2 RING-finger 95.83
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.76
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.71
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 95.52
KOG4739 233 consensus Uncharacterized protein involved in syna 95.42
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 95.15
KOG1940276 consensus Zn-finger protein [General function pred 95.15
KOG03091081 consensus Conserved WD40 repeat-containing protein 94.94
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 94.81
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 94.64
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 94.53
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.51
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 93.32
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 93.1
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 92.39
KOG4718235 consensus Non-SMC (structural maintenance of chrom 92.3
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 92.25
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 91.95
PF10272358 Tmpp129: Putative transmembrane protein precursor; 91.61
PF13901202 DUF4206: Domain of unknown function (DUF4206) 91.19
COG5222427 Uncharacterized conserved protein, contains RING Z 90.88
KOG0298 1394 consensus DEAD box-containing helicase-like transc 90.05
KOG3053 293 consensus Uncharacterized conserved protein [Funct 89.64
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 89.52
KOG3899381 consensus Uncharacterized conserved protein [Funct 88.84
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 88.58
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 87.29
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 87.06
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 87.0
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 86.54
KOG1829580 consensus Uncharacterized conserved protein, conta 86.34
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 85.45
KOG1609 323 consensus Protein involved in mRNA turnover and st 85.32
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 85.04
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 84.43
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 83.62
KOG3002 299 consensus Zn finger protein [General function pred 82.97
KOG4367 699 consensus Predicted Zn-finger protein [Function un 82.62
KOG3113 293 consensus Uncharacterized conserved protein [Funct 80.78
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 80.61
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 80.18
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.7e-33  Score=185.73  Aligned_cols=98  Identities=86%  Similarity=1.568  Sum_probs=91.5

Q ss_pred             CCCCCCCCCCcceeEeeceeeeeeecCCCcccccccccchhhhhHHHhhhcccCCCCcceeeecCCCCcccHhHHHHHHh
Q 033510           20 AGPSSSSKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLK   99 (118)
Q Consensus        20 ~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~H~FH~~Ci~~Wl~   99 (118)
                      .+.++.....++|.+|+|+++++|+||+..|+|+||++.+.++|++|++++ +.+.++|.+.++.|+|.||.+||.+||+
T Consensus        17 ~~~~s~~~~~krF~lKKWnAvAlWaWDi~vDnCAICRnHIMd~CieCQa~~-~~~~~EC~VaWG~CNHaFH~hCisrWlk   95 (114)
T KOG2930|consen   17 KSSSSNEGGKKRFELKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ-SATSEECTVAWGVCNHAFHFHCISRWLK   95 (114)
T ss_pred             cccccCCCCCcceEEeeeeeeeeeeeeeeechhHHHHHHHHHHHHhhccCC-CCCCCceEEEeeecchHHHHHHHHHHHh
Confidence            334445555899999999999999999999999999999999999999998 8889999999999999999999999999


Q ss_pred             CCCCCcCCccCccccccCC
Q 033510          100 TRQVCPLDNSEWEFQKYGH  118 (118)
Q Consensus       100 ~~~~CP~Cr~~~~~~~~~~  118 (118)
                      +++.||+|.++|+|++||+
T Consensus        96 tr~vCPLdn~eW~~qr~g~  114 (114)
T KOG2930|consen   96 TRNVCPLDNKEWVFQRYGH  114 (114)
T ss_pred             hcCcCCCcCcceeEeecCC
Confidence            9999999999999999986

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
4a0k_B117 Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp 2e-47
1u6g_B108 Crystal Structure Of The Cand1-Cul1-Roc1 Complex Le 2e-47
3dpl_R106 Structural Insights Into Nedd8 Activation Of Cullin 2e-47
4a0c_D98 Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 3e-47
1ldj_B90 Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiqu 7e-47
3dqv_R106 Structural Insights Into Nedd8 Activation Of Cullin 2e-46
2lgv_A100 Rbx1 Length = 100 1e-43
2ecl_A81 Solution Structure Of The Ring Domain Of The Human 2e-15
>pdb|4A0K|B Chain B, Structure Of Ddb1-Ddb2-Cul4a-Rbx1 Bound To A 12 Bp Abasic Site Containing Dna-Duplex Length = 117 Back     alignment and structure 
Iteration: 1

 Score =  183 bits (465), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 85/88 (96%), Positives = 87/88 (98%)
Query: 31  RFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFH 90
           RFE+KKW+AVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFH
Sbjct: 30  RFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFH 89
Query: 91  FHCISRWLKTRQVCPLDNSEWEFQKYGH 118
           FHCISRWLKTRQVCPLDN EWEFQKYGH
Sbjct: 90  FHCISRWLKTRQVCPLDNREWEFQKYGH 117
>pdb|1U6G|B Chain B, Crystal Structure Of The Cand1-Cul1-Roc1 Complex Length = 108 Back     alignment and structure
>pdb|3DPL|R Chain R, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation. Length = 106 Back     alignment and structure
>pdb|4A0C|D Chain D, Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 98 Back     alignment and structure
>pdb|1LDJ|B Chain B, Structure Of The Cul1-rbx1-skp1-f Boxskp2 Scf Ubiquitin Ligase Complex Length = 90 Back     alignment and structure
>pdb|3DQV|R Chain R, Structural Insights Into Nedd8 Activation Of Cullin-Ring Ligases: Conformational Control Of Conjugation Length = 106 Back     alignment and structure
>pdb|2LGV|A Chain A, Rbx1 Length = 100 Back     alignment and structure
>pdb|2ECL|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring-Box Protein 2 Length = 81 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query118
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 1e-38
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 2e-37
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 3e-34
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 1e-09
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 8e-08
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 3e-06
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 8e-06
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 1e-05
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 1e-05
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 1e-05
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 1e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 1e-05
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-05
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-05
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-05
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 4e-05
2ect_A78 Ring finger protein 126; metal binding protein, st 5e-05
3nw0_A238 Non-structural maintenance of chromosomes element 6e-05
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
 Score =  124 bits (313), Expect = 1e-38
 Identities = 87/104 (83%), Positives = 91/104 (87%)

Query: 15  EASSSAGPSSSSKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASAT 74
                   ++S    KRFE+KKW+AVALWAWDIVVDNCAICRNHIMDLCIECQANQASAT
Sbjct: 14  YFQGGGRGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASAT 73

Query: 75  SEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH 118
           SEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDN EWEFQKYGH
Sbjct: 74  SEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH 117
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.96
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.96
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.9
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.69
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.66
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.64
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.63
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.61
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.61
2ect_A78 Ring finger protein 126; metal binding protein, st 99.61
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.6
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.6
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.59
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.57
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.57
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.56
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.53
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.51
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.49
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.48
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.47
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.47
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.46
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.44
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.44
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.44
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.43
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.43
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.43
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.42
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.4
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.39
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.39
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.38
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.37
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.37
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.35
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.34
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.33
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.32
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.3
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.29
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.27
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.26
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.25
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.25
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.22
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.21
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.21
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.16
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.15
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.15
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.15
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.14
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.11
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.07
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.05
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 99.02
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.0
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.97
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.96
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.95
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.88
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.81
2ea5_A68 Cell growth regulator with ring finger domain prot 98.78
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.77
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.7
3nw0_A238 Non-structural maintenance of chromosomes element 98.64
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.6
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.59
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.59
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.16
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 95.41
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.64
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.49
1weu_A91 Inhibitor of growth family, member 4; structural g 93.0
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 92.31
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 90.89
2k16_A75 Transcription initiation factor TFIID subunit 3; p 90.01
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 89.57
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 89.54
2yt5_A66 Metal-response element-binding transcription facto 89.06
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 89.04
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 88.95
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 88.64
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 88.4
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 87.2
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 86.51
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 86.17
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 84.95
1wil_A89 KIAA1045 protein; ring finger domain, structural g 84.78
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 84.49
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 84.41
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 84.08
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 83.98
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 83.84
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 83.68
1we9_A64 PHD finger family protein; structural genomics, PH 83.2
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 83.17
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 82.92
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 82.35
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 82.03
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 81.9
2ro1_A 189 Transcription intermediary factor 1-beta; KAP, TIF 80.21
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
Probab=99.96  E-value=8.5e-30  Score=170.88  Aligned_cols=95  Identities=92%  Similarity=1.647  Sum_probs=83.8

Q ss_pred             CCCCCCcceeEeeceeeeeeecCCCcccccccccchhhhhHHHhhhcccCCCCcceeeecCCCCcccHhHHHHHHhCCCC
Q 033510           24 SSSKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQV  103 (118)
Q Consensus        24 ~~~~~~~~~~i~~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~H~FH~~Ci~~Wl~~~~~  103 (118)
                      ......+||+|++|++++.|+|+.+++.|+||++.|.++|+.|+.+....+++++.+++++|+|.||.+||.+||..+.+
T Consensus        12 ~~~~~~~r~~ik~~~~v~~w~~d~~~d~CaIC~~~~~~~c~~C~~~~~~~~~~~~~~~~~~C~H~FH~~Ci~~Wl~~~~~   91 (106)
T 3dpl_R           12 NSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQV   91 (106)
T ss_dssp             -----CCSEEEEEEEEEEEEEESSCSCCCSSSCSCTTSCCTTHHHHTTCC---CCCEEEETTSCEEEHHHHHHHHTTCSB
T ss_pred             ccccccCceeEEEEEEeeEeecCCCCCCCccCChhHhCcCchhhccccccCCccceEeecccCcEECHHHHHHHHHcCCc
Confidence            34556899999999999999999999999999999999999999888888888888999999999999999999999999


Q ss_pred             CcCCccCccccccCC
Q 033510          104 CPLDNSEWEFQKYGH  118 (118)
Q Consensus       104 CP~Cr~~~~~~~~~~  118 (118)
                      ||+||++|.++++||
T Consensus        92 CP~Cr~~~~~~~~g~  106 (106)
T 3dpl_R           92 CPLDNREWEFQKYGH  106 (106)
T ss_dssp             CSSSCSBCCEEECCC
T ss_pred             CcCCCCcceeecCCC
Confidence            999999999999986
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 118
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 2e-32
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 3e-08
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 1e-05
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 3e-05
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  107 bits (267), Expect = 2e-32
 Identities = 84/87 (96%), Positives = 86/87 (98%)

Query: 30  KRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAF 89
           KRFE+KKW+AVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAF
Sbjct: 2   KRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAF 61

Query: 90  HFHCISRWLKTRQVCPLDNSEWEFQKY 116
           HFHCISRWLKTRQVCPLDN EWEFQKY
Sbjct: 62  HFHCISRWLKTRQVCPLDNREWEFQKY 88
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query118
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.94
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.71
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.69
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.63
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.63
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.6
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.49
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.47
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.38
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.38
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.32
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.22
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.2
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.19
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.01
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.6
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 93.85
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 92.96
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 90.8
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 90.76
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 89.65
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 88.25
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 88.17
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 84.19
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 83.76
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 81.49
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=3.5e-28  Score=156.26  Aligned_cols=88  Identities=95%  Similarity=1.723  Sum_probs=78.3

Q ss_pred             CcceeEeeceeeeeeecCCCcccccccccchhhhhHHHhhhcccCCCCcceeeecCCCCcccHhHHHHHHhCCCCCcCCc
Q 033510           29 PKRFEIKKWSAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDN  108 (118)
Q Consensus        29 ~~~~~i~~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~H~FH~~Ci~~Wl~~~~~CP~Cr  108 (118)
                      .+|++|++|++++.|+|+..++.|+||++.+.+++..+.............++.++|||.||.+||.+||+.+++||+||
T Consensus         1 ~~~~~ik~~~av~~w~~d~~~d~C~IC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~H~FH~~Ci~~Wl~~~~~CP~CR   80 (88)
T d3dplr1           1 KKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDN   80 (88)
T ss_dssp             CCSEEEEEEEEEEEEEESSCSCCCSSSCSCTTSCCTTHHHHTTCC---CCCEEEETTSCEEEHHHHHHHHTTCSBCSSSC
T ss_pred             CCceEEeeEEEEEEEeecCCCCcCEEccchhhCccccccccccccccccCCeEEccccCcccHHHHHHHHHHCCcCCCCC
Confidence            37899999999999999999999999999999988888776666666666788899999999999999999999999999


Q ss_pred             cCcccccc
Q 033510          109 SEWEFQKY  116 (118)
Q Consensus       109 ~~~~~~~~  116 (118)
                      ++|.+++|
T Consensus        81 ~~~~~~~~   88 (88)
T d3dplr1          81 REWEFQKY   88 (88)
T ss_dssp             SBCCEEEC
T ss_pred             CccccccC
Confidence            99999986
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure