Citrus Sinensis ID: 033598
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| 255536945 | 226 | ribulose-5-phosphate-3-epimerase, putati | 1.0 | 0.508 | 0.869 | 8e-52 | |
| 225452134 | 222 | PREDICTED: ribulose-phosphate 3-epimeras | 0.973 | 0.504 | 0.883 | 2e-50 | |
| 296090234 | 291 | unnamed protein product [Vitis vinifera] | 0.973 | 0.384 | 0.883 | 2e-50 | |
| 224060236 | 226 | predicted protein [Populus trichocarpa] | 1.0 | 0.508 | 0.852 | 2e-50 | |
| 356571509 | 228 | PREDICTED: ribulose-phosphate 3-epimeras | 0.991 | 0.5 | 0.850 | 6e-49 | |
| 6091725 | 233 | putative D-ribulose-5-phosphate 3-epimer | 1.0 | 0.493 | 0.817 | 1e-48 | |
| 18395962 | 225 | ribulose-phosphate 3-epimerase [Arabidop | 1.0 | 0.511 | 0.817 | 1e-48 | |
| 255629039 | 228 | unknown [Glycine max] | 0.991 | 0.5 | 0.842 | 2e-48 | |
| 449441680 | 226 | PREDICTED: ribulose-phosphate 3-epimeras | 1.0 | 0.508 | 0.808 | 5e-48 | |
| 388509346 | 157 | unknown [Lotus japonicus] | 0.991 | 0.726 | 0.833 | 6e-48 |
| >gi|255536945|ref|XP_002509539.1| ribulose-5-phosphate-3-epimerase, putative [Ricinus communis] gi|223549438|gb|EEF50926.1| ribulose-5-phosphate-3-epimerase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 207 bits (526), Expect = 8e-52, Method: Compositional matrix adjust.
Identities = 100/115 (86%), Positives = 109/115 (94%)
Query: 1 MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60
MRPGVALKPGTS+EEVYPLVE NPVEMVLVMTVEPGFGGQKFMP MM+KV++LR +YPS
Sbjct: 112 MRPGVALKPGTSIEEVYPLVECENPVEMVLVMTVEPGFGGQKFMPTMMEKVKTLRKKYPS 171
Query: 61 LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS 115
LDIEVDGGLGPSTI AASAGANCIVAGSSVFGAPEPAHVISLM+KSV++AQ+NS
Sbjct: 172 LDIEVDGGLGPSTIDLAASAGANCIVAGSSVFGAPEPAHVISLMKKSVQEAQENS 226
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225452134|ref|XP_002263010.1| PREDICTED: ribulose-phosphate 3-epimerase, cytoplasmic isoform-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296090234|emb|CBI40053.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224060236|ref|XP_002300099.1| predicted protein [Populus trichocarpa] gi|118488638|gb|ABK96131.1| unknown [Populus trichocarpa] gi|222847357|gb|EEE84904.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356571509|ref|XP_003553919.1| PREDICTED: ribulose-phosphate 3-epimerase, cytoplasmic isoform [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|6091725|gb|AAF03437.1|AC010797_13 putative D-ribulose-5-phosphate 3-epimerase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18395962|ref|NP_566153.1| ribulose-phosphate 3-epimerase [Arabidopsis thaliana] gi|30678440|ref|NP_850495.1| ribulose-phosphate 3-epimerase [Arabidopsis thaliana] gi|13877557|gb|AAK43856.1|AF370479_1 putative D-ribulose-5-phosphate 3-epimerase [Arabidopsis thaliana] gi|21592447|gb|AAM64398.1| putative D-ribulose-5-phosphate 3-epimerase [Arabidopsis thaliana] gi|25084145|gb|AAN72185.1| putative D-ribulose-5-phosphate 3-epimerase [Arabidopsis thaliana] gi|332640203|gb|AEE73724.1| ribulose-phosphate 3-epimerase [Arabidopsis thaliana] gi|332640204|gb|AEE73725.1| ribulose-phosphate 3-epimerase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|255629039|gb|ACU14864.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449441680|ref|XP_004138610.1| PREDICTED: ribulose-phosphate 3-epimerase, cytoplasmic isoform-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388509346|gb|AFK42739.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 115 | ||||||
| TAIR|locus:2038456 | 227 | AT1G63290 [Arabidopsis thalian | 1.0 | 0.506 | 0.834 | 2.6e-47 | |
| TAIR|locus:2082349 | 225 | AT3G01850 [Arabidopsis thalian | 0.973 | 0.497 | 0.839 | 3e-46 | |
| UNIPROTKB|G4NBH9 | 251 | MGG_00534 "Ribulose-phosphate | 0.921 | 0.422 | 0.605 | 3e-30 | |
| CGD|CAL0002810 | 230 | orf19.7108 [Candida albicans ( | 0.939 | 0.469 | 0.576 | 1.6e-29 | |
| UNIPROTKB|G5E6S3 | 187 | RPE "Uncharacterized protein" | 0.973 | 0.598 | 0.586 | 3.4e-29 | |
| UNIPROTKB|C9J6A7 | 159 | RPE "Ribulose-phosphate 3-epim | 0.973 | 0.704 | 0.577 | 4.4e-29 | |
| UNIPROTKB|C9JPQ7 | 160 | RPE "Ribulose-phosphate 3-epim | 0.973 | 0.7 | 0.577 | 4.4e-29 | |
| UNIPROTKB|Q96AT9 | 228 | RPE "Ribulose-phosphate 3-epim | 0.973 | 0.491 | 0.577 | 4.4e-29 | |
| UNIPROTKB|Q5R5Y2 | 228 | RPE "Ribulose-phosphate 3-epim | 0.973 | 0.491 | 0.577 | 4.4e-29 | |
| UNIPROTKB|F1NT24 | 243 | RPE "Ribulose-phosphate 3-epim | 0.956 | 0.452 | 0.578 | 5.6e-29 |
| TAIR|locus:2038456 AT1G63290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 495 (179.3 bits), Expect = 2.6e-47, P = 2.6e-47
Identities = 96/115 (83%), Positives = 105/115 (91%)
Query: 1 MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60
MRPGVALKPGT VE+VYPLVEG NPVEMVLVMTVEPGFGGQKFMP MMDKVR+LRN+YP+
Sbjct: 113 MRPGVALKPGTPVEQVYPLVEGTNPVEMVLVMTVEPGFGGQKFMPSMMDKVRALRNKYPT 172
Query: 61 LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS 115
LDIEVDGGLGPSTI AA+AGANCIVAGSSVFGAP+P VISL+R SVE AQ ++
Sbjct: 173 LDIEVDGGLGPSTIDAAAAAGANCIVAGSSVFGAPKPGDVISLLRASVEKAQPST 227
|
|
| TAIR|locus:2082349 AT3G01850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NBH9 MGG_00534 "Ribulose-phosphate 3-epimerase" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0002810 orf19.7108 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E6S3 RPE "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9J6A7 RPE "Ribulose-phosphate 3-epimerase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JPQ7 RPE "Ribulose-phosphate 3-epimerase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96AT9 RPE "Ribulose-phosphate 3-epimerase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R5Y2 RPE "Ribulose-phosphate 3-epimerase" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NT24 RPE "Ribulose-phosphate 3-epimerase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| PLN02334 | 229 | PLN02334, PLN02334, ribulose-phosphate 3-epimerase | 2e-64 | |
| PTZ00170 | 228 | PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epime | 8e-55 | |
| cd00429 | 211 | cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RP | 3e-50 | |
| PRK05581 | 220 | PRK05581, PRK05581, ribulose-phosphate 3-epimerase | 4e-45 | |
| COG0036 | 220 | COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Car | 3e-39 | |
| pfam00834 | 201 | pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 ep | 2e-34 | |
| TIGR01163 | 210 | TIGR01163, rpe, ribulose-phosphate 3-epimerase | 2e-33 | |
| PRK08745 | 223 | PRK08745, PRK08745, ribulose-phosphate 3-epimerase | 4e-22 | |
| PRK08883 | 220 | PRK08883, PRK08883, ribulose-phosphate 3-epimerase | 1e-20 | |
| PRK09722 | 229 | PRK09722, PRK09722, allulose-6-phosphate 3-epimera | 4e-18 | |
| PRK08005 | 210 | PRK08005, PRK08005, epimerase; Validated | 1e-10 | |
| COG0269 | 217 | COG0269, SgbH, 3-hexulose-6-phosphate synthase and | 5e-05 | |
| TIGR01334 | 277 | TIGR01334, modD, putative molybdenum utilization p | 1e-04 | |
| PRK14057 | 254 | PRK14057, PRK14057, epimerase; Provisional | 1e-04 | |
| cd01568 | 269 | cd01568, QPRTase_NadC, Quinolinate phosphoribosyl | 3e-04 | |
| TIGR03128 | 206 | TIGR03128, RuMP_HxlA, 3-hexulose-6-phosphate synth | 9e-04 | |
| cd00564 | 196 | cd00564, TMP_TenI, Thiamine monophosphate synthase | 0.002 | |
| pfam01729 | 169 | pfam01729, QRPTase_C, Quinolinate phosphoribosyl t | 0.002 |
| >gnl|CDD|215192 PLN02334, PLN02334, ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
Score = 194 bits (495), Expect = 2e-64
Identities = 77/115 (66%), Positives = 89/115 (77%), Gaps = 1/115 (0%)
Query: 1 MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60
M+ GV L PGT VE V P+VE V+MVLVM+VEPGFGGQ F+P MMDKVR+LR +YP
Sbjct: 116 MKAGVVLNPGTPVEAVEPVVEKGL-VDMVLVMSVEPGFGGQSFIPSMMDKVRALRKKYPE 174
Query: 61 LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS 115
LDIEVDGG+GPSTI +AA AGAN IVAGS+VFGAP+ A VIS +R SVE A
Sbjct: 175 LDIEVDGGVGPSTIDKAAEAGANVIVAGSAVFGAPDYAEVISGLRASVEKAAVAV 229
|
Length = 229 |
| >gnl|CDD|240303 PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238244 cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RPE) | Back alignment and domain information |
|---|
| >gnl|CDD|235515 PRK05581, PRK05581, ribulose-phosphate 3-epimerase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223114 COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|216142 pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 epimerase family | Back alignment and domain information |
|---|
| >gnl|CDD|130231 TIGR01163, rpe, ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
| >gnl|CDD|136958 PRK08745, PRK08745, ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181575 PRK08883, PRK08883, ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236616 PRK09722, PRK09722, allulose-6-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169179 PRK08005, PRK08005, epimerase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223347 COG0269, SgbH, 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130401 TIGR01334, modD, putative molybdenum utilization protein ModD | Back alignment and domain information |
|---|
| >gnl|CDD|172549 PRK14057, PRK14057, epimerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238802 cd01568, QPRTase_NadC, Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|132172 TIGR03128, RuMP_HxlA, 3-hexulose-6-phosphate synthase | Back alignment and domain information |
|---|
| >gnl|CDD|238317 cd00564, TMP_TenI, Thiamine monophosphate synthase (TMP synthase)/TenI | Back alignment and domain information |
|---|
| >gnl|CDD|216667 pfam01729, QRPTase_C, Quinolinate phosphoribosyl transferase, C-terminal domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| COG0036 | 220 | Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate | 100.0 | |
| PRK08745 | 223 | ribulose-phosphate 3-epimerase; Provisional | 100.0 | |
| PRK08091 | 228 | ribulose-phosphate 3-epimerase; Validated | 100.0 | |
| PRK08005 | 210 | epimerase; Validated | 100.0 | |
| PRK14057 | 254 | epimerase; Provisional | 100.0 | |
| PRK09722 | 229 | allulose-6-phosphate 3-epimerase; Provisional | 100.0 | |
| KOG3111 | 224 | consensus D-ribulose-5-phosphate 3-epimerase [Carb | 100.0 | |
| PRK08883 | 220 | ribulose-phosphate 3-epimerase; Provisional | 100.0 | |
| PF00834 | 201 | Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam | 99.97 | |
| PTZ00170 | 228 | D-ribulose-5-phosphate 3-epimerase; Provisional | 99.95 | |
| PLN02334 | 229 | ribulose-phosphate 3-epimerase | 99.94 | |
| PRK05581 | 220 | ribulose-phosphate 3-epimerase; Validated | 99.87 | |
| TIGR01163 | 210 | rpe ribulose-phosphate 3-epimerase. This family co | 99.84 | |
| cd00429 | 211 | RPE Ribulose-5-phosphate 3-epimerase (RPE). This e | 99.83 | |
| PRK13125 | 244 | trpA tryptophan synthase subunit alpha; Provisiona | 99.82 | |
| PRK13307 | 391 | bifunctional formaldehyde-activating enzyme/3-hexu | 99.81 | |
| TIGR03128 | 206 | RuMP_HxlA 3-hexulose-6-phosphate synthase. at the | 99.81 | |
| PRK13306 | 216 | ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; | 99.79 | |
| PRK13813 | 215 | orotidine 5'-phosphate decarboxylase; Provisional | 99.78 | |
| PRK00043 | 212 | thiE thiamine-phosphate pyrophosphorylase; Reviewe | 99.74 | |
| cd04726 | 202 | KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl | 99.73 | |
| TIGR00262 | 256 | trpA tryptophan synthase, alpha subunit. Tryptopha | 99.69 | |
| cd04724 | 242 | Tryptophan_synthase_alpha Ttryptophan synthase (TR | 99.69 | |
| cd00564 | 196 | TMP_TenI Thiamine monophosphate synthase (TMP synt | 99.68 | |
| COG0352 | 211 | ThiE Thiamine monophosphate synthase [Coenzyme met | 99.62 | |
| PRK07028 | 430 | bifunctional hexulose-6-phosphate synthase/ribonuc | 99.59 | |
| CHL00200 | 263 | trpA tryptophan synthase alpha subunit; Provisiona | 99.53 | |
| PRK12290 | 437 | thiE thiamine-phosphate pyrophosphorylase; Reviewe | 99.51 | |
| PRK03512 | 211 | thiamine-phosphate pyrophosphorylase; Provisional | 99.46 | |
| PRK06512 | 221 | thiamine-phosphate pyrophosphorylase; Provisional | 99.45 | |
| PRK02615 | 347 | thiamine-phosphate pyrophosphorylase; Provisional | 99.44 | |
| PRK07695 | 201 | transcriptional regulator TenI; Provisional | 99.43 | |
| TIGR00693 | 196 | thiE thiamine-phosphate pyrophosphorylase. This mo | 99.38 | |
| PLN02898 | 502 | HMP-P kinase/thiamin-monophosphate pyrophosphoryla | 99.35 | |
| PRK09140 | 206 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R | 99.29 | |
| COG0269 | 217 | SgbH 3-hexulose-6-phosphate synthase and related p | 99.28 | |
| PRK09517 | 755 | multifunctional thiamine-phosphate pyrophosphoryla | 99.21 | |
| cd01568 | 269 | QPRTase_NadC Quinolinate phosphoribosyl transferas | 99.14 | |
| cd04727 | 283 | pdxS PdxS is a subunit of the pyridoxal 5'-phospha | 99.12 | |
| PRK06552 | 213 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 99.12 | |
| TIGR00343 | 287 | pyridoxal 5'-phosphate synthase, synthase subunit | 99.09 | |
| PF02581 | 180 | TMP-TENI: Thiamine monophosphate synthase/TENI; In | 99.08 | |
| PRK07455 | 187 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 99.07 | |
| PRK04180 | 293 | pyridoxal biosynthesis lyase PdxS; Provisional | 99.03 | |
| PRK08999 | 312 | hypothetical protein; Provisional | 98.97 | |
| PRK07428 | 288 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.96 | |
| cd00452 | 190 | KDPG_aldolase KDPG and KHG aldolase. This family b | 98.94 | |
| cd01572 | 268 | QPRTase Quinolinate phosphoribosyl transferase (QA | 98.91 | |
| cd01573 | 272 | modD_like ModD; Quinolinate phosphoribosyl transfe | 98.84 | |
| PRK08072 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.81 | |
| cd00331 | 217 | IGPS Indole-3-glycerol phosphate synthase (IGPS); | 98.8 | |
| TIGR01949 | 258 | AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep | 98.8 | |
| TIGR00078 | 265 | nadC nicotinate-nucleotide pyrophosphorylase. Syno | 98.78 | |
| PF01729 | 169 | QRPTase_C: Quinolinate phosphoribosyl transferase, | 98.78 | |
| PRK06806 | 281 | fructose-bisphosphate aldolase; Provisional | 98.76 | |
| cd00958 | 235 | DhnA Class I fructose-1,6-bisphosphate (FBP) aldol | 98.75 | |
| PRK05742 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.72 | |
| cd00405 | 203 | PRAI Phosphoribosylanthranilate isomerase (PRAI) c | 98.71 | |
| PRK00278 | 260 | trpC indole-3-glycerol-phosphate synthase; Reviewe | 98.67 | |
| PRK00208 | 250 | thiG thiazole synthase; Reviewed | 98.67 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 98.65 | |
| PRK07226 | 267 | fructose-bisphosphate aldolase; Provisional | 98.64 | |
| cd04729 | 219 | NanE N-acetylmannosamine-6-phosphate epimerase (Na | 98.61 | |
| cd04730 | 236 | NPD_like 2-Nitropropane dioxygenase (NPD), one of | 98.58 | |
| PRK07896 | 289 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.57 | |
| PRK01130 | 221 | N-acetylmannosamine-6-phosphate 2-epimerase; Provi | 98.57 | |
| PLN02591 | 250 | tryptophan synthase | 98.57 | |
| PRK05848 | 273 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.55 | |
| cd04722 | 200 | TIM_phosphate_binding TIM barrel proteins share a | 98.55 | |
| TIGR01334 | 277 | modD putative molybdenum utilization protein ModD. | 98.47 | |
| PRK07315 | 293 | fructose-bisphosphate aldolase; Provisional | 98.46 | |
| PRK13305 | 218 | sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; | 98.45 | |
| PRK08385 | 278 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.45 | |
| PRK04302 | 223 | triosephosphate isomerase; Provisional | 98.44 | |
| PRK06096 | 284 | molybdenum transport protein ModD; Provisional | 98.42 | |
| PRK00230 | 230 | orotidine 5'-phosphate decarboxylase; Reviewed | 98.41 | |
| TIGR01182 | 204 | eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho | 98.34 | |
| PRK05718 | 212 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 98.31 | |
| PRK13111 | 258 | trpA tryptophan synthase subunit alpha; Provisiona | 98.3 | |
| PRK06106 | 281 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.25 | |
| PRK06559 | 290 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.21 | |
| PRK06978 | 294 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.18 | |
| PRK06015 | 201 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 98.16 | |
| COG0157 | 280 | NadC Nicotinate-nucleotide pyrophosphorylase [Coen | 98.15 | |
| PRK09016 | 296 | quinolinate phosphoribosyltransferase; Validated | 98.15 | |
| TIGR01037 | 300 | pyrD_sub1_fam dihydroorotate dehydrogenase (subfam | 98.15 | |
| TIGR01740 | 213 | pyrF orotidine 5'-phosphate decarboxylase, subfami | 98.14 | |
| TIGR01859 | 282 | fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, | 98.11 | |
| PRK06543 | 281 | nicotinate-nucleotide pyrophosphorylase; Provision | 98.11 | |
| PRK07259 | 301 | dihydroorotate dehydrogenase 1B; Reviewed | 98.11 | |
| PLN02716 | 308 | nicotinate-nucleotide diphosphorylase (carboxylati | 98.11 | |
| cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c | 98.1 | |
| PF04131 | 192 | NanE: Putative N-acetylmannosamine-6-phosphate epi | 98.1 | |
| PRK07114 | 222 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 98.08 | |
| PF01081 | 196 | Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 | 98.08 | |
| cd02810 | 289 | DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) | 98.02 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 98.02 | |
| COG3010 | 229 | NanE Putative N-acetylmannosamine-6-phosphate epim | 98.0 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.98 | |
| COG0214 | 296 | SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta | 97.95 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 97.91 | |
| PRK14114 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.89 | |
| cd02812 | 219 | PcrB_like PcrB_like proteins. One member of this f | 97.86 | |
| TIGR00259 | 257 | thylakoid_BtpA membrane complex biogenesis protein | 97.86 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 97.84 | |
| cd04738 | 327 | DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl | 97.82 | |
| PF00290 | 259 | Trp_syntA: Tryptophan synthase alpha chain; InterP | 97.82 | |
| PRK06801 | 286 | hypothetical protein; Provisional | 97.79 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.78 | |
| cd01571 | 302 | NAPRTase_B Nicotinate phosphoribosyltransferase (N | 97.77 | |
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 97.76 | |
| CHL00162 | 267 | thiG thiamin biosynthesis protein G; Validated | 97.75 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 97.74 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 97.74 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 97.73 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 97.69 | |
| cd02801 | 231 | DUS_like_FMN Dihydrouridine synthase-like (DUS-lik | 97.68 | |
| PRK11840 | 326 | bifunctional sulfur carrier protein/thiazole synth | 97.68 | |
| PF03437 | 254 | BtpA: BtpA family; InterPro: IPR005137 Photosystem | 97.66 | |
| cd02803 | 327 | OYE_like_FMN_family Old yellow enzyme (OYE)-like F | 97.64 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 97.63 | |
| TIGR02129 | 253 | hisA_euk phosphoribosylformimino-5-aminoimidazole | 97.62 | |
| COG0159 | 265 | TrpA Tryptophan synthase alpha chain [Amino acid t | 97.6 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.6 | |
| PRK04128 | 228 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.58 | |
| PRK01033 | 258 | imidazole glycerol phosphate synthase subunit HisF | 97.58 | |
| PRK04169 | 232 | geranylgeranylglyceryl phosphate synthase-like pro | 97.56 | |
| PF05690 | 247 | ThiG: Thiazole biosynthesis protein ThiG; InterPro | 97.55 | |
| PRK13586 | 232 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.54 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 97.54 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 97.49 | |
| PLN02446 | 262 | (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy | 97.49 | |
| PRK01033 | 258 | imidazole glycerol phosphate synthase subunit HisF | 97.49 | |
| PRK05286 | 344 | dihydroorotate dehydrogenase 2; Reviewed | 97.48 | |
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 97.48 | |
| cd04739 | 325 | DHOD_like Dihydroorotate dehydrogenase (DHOD) like | 97.46 | |
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 97.45 | |
| PRK01222 | 210 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 97.44 | |
| COG0135 | 208 | TrpF Phosphoribosylanthranilate isomerase [Amino a | 97.43 | |
| PRK07565 | 334 | dihydroorotate dehydrogenase 2; Reviewed | 97.42 | |
| PRK08662 | 343 | nicotinate phosphoribosyltransferase; Reviewed | 97.41 | |
| PRK14114 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.39 | |
| cd00516 | 281 | PRTase_typeII Phosphoribosyltransferase (PRTase) t | 97.38 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 97.35 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 97.35 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 97.34 | |
| cd04741 | 294 | DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c | 97.33 | |
| cd02940 | 299 | DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM | 97.3 | |
| cd04735 | 353 | OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN | 97.27 | |
| PF00218 | 254 | IGPS: Indole-3-glycerol phosphate synthase; InterP | 97.27 | |
| cd02809 | 299 | alpha_hydroxyacid_oxid_FMN Family of homologous FM | 97.25 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 97.25 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 97.24 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.23 | |
| PRK10415 | 321 | tRNA-dihydrouridine synthase B; Provisional | 97.23 | |
| PF01884 | 230 | PcrB: PcrB family; InterPro: IPR008205 This entry | 97.22 | |
| PLN02617 | 538 | imidazole glycerol phosphate synthase hisHF | 97.22 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.19 | |
| KOG1606 | 296 | consensus Stationary phase-induced protein, SOR/SN | 97.18 | |
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 97.17 | |
| TIGR01768 | 223 | GGGP-family geranylgeranylglyceryl phosphate synth | 97.13 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 97.1 | |
| cd04725 | 216 | OMP_decarboxylase_like Orotidine 5'-phosphate deca | 97.1 | |
| PRK04128 | 228 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 97.08 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 97.06 | |
| TIGR01919 | 243 | hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy | 97.04 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 97.02 | |
| PF00697 | 197 | PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isome | 97.01 | |
| TIGR03151 | 307 | enACPred_II putative enoyl-(acyl-carrier-protein) | 97.0 | |
| PLN02826 | 409 | dihydroorotate dehydrogenase | 96.96 | |
| PF01180 | 295 | DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP | 96.95 | |
| TIGR01769 | 205 | GGGP geranylgeranylglyceryl phosphate synthase. Th | 96.89 | |
| TIGR01036 | 335 | pyrD_sub2 dihydroorotate dehydrogenase, subfamily | 96.88 | |
| PRK10550 | 312 | tRNA-dihydrouridine synthase C; Provisional | 96.88 | |
| PRK08227 | 264 | autoinducer 2 aldolase; Validated | 96.87 | |
| COG0134 | 254 | TrpC Indole-3-glycerol phosphate synthase [Amino a | 96.86 | |
| COG1830 | 265 | FbaB DhnA-type fructose-1,6-bisphosphate aldolase | 96.83 | |
| TIGR00736 | 231 | nifR3_rel_arch TIM-barrel protein, putative. Membe | 96.81 | |
| COG0800 | 211 | Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca | 96.8 | |
| PRK13586 | 232 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 96.8 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 96.77 | |
| PRK02506 | 310 | dihydroorotate dehydrogenase 1A; Reviewed | 96.74 | |
| TIGR02151 | 333 | IPP_isom_2 isopentenyl-diphosphate delta-isomerase | 96.74 | |
| TIGR00737 | 319 | nifR3_yhdG putative TIM-barrel protein, nifR3 fami | 96.74 | |
| cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine m | 96.73 | |
| PRK11815 | 333 | tRNA-dihydrouridine synthase A; Provisional | 96.73 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 96.72 | |
| PF00215 | 226 | OMPdecase: Orotidine 5'-phosphate decarboxylase / | 96.69 | |
| PF03060 | 330 | NMO: Nitronate monooxygenase; InterPro: IPR004136 | 96.69 | |
| COG0284 | 240 | PyrF Orotidine-5'-phosphate decarboxylase [Nucleot | 96.66 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 96.66 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 96.65 | |
| COG0167 | 310 | PyrD Dihydroorotate dehydrogenase [Nucleotide tran | 96.65 | |
| TIGR01919 | 243 | hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy | 96.62 | |
| PF00478 | 352 | IMPDH: IMP dehydrogenase / GMP reductase domain; I | 96.59 | |
| TIGR00734 | 221 | hisAF_rel hisA/hisF family protein. This alignment | 96.57 | |
| PRK11572 | 248 | copper homeostasis protein CutC; Provisional | 96.57 | |
| PF06073 | 110 | DUF934: Bacterial protein of unknown function (DUF | 96.57 | |
| cd02933 | 338 | OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind | 96.56 | |
| PRK05437 | 352 | isopentenyl pyrophosphate isomerase; Provisional | 96.56 | |
| PRK13958 | 207 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 96.56 | |
| PRK07188 | 352 | nicotinate phosphoribosyltransferase; Provisional | 96.55 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 96.51 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 96.48 | |
| cd02808 | 392 | GltS_FMN Glutamate synthase (GltS) FMN-binding dom | 96.48 | |
| cd02071 | 122 | MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin | 96.47 | |
| cd04736 | 361 | MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin | 96.44 | |
| PLN02446 | 262 | (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy | 96.43 | |
| PRK05500 | 477 | bifunctional orotidine 5'-phosphate decarboxylase/ | 96.41 | |
| PLN02535 | 364 | glycolate oxidase | 96.4 | |
| cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin | 96.39 | |
| COG2022 | 262 | ThiG Uncharacterized enzyme of thiazole biosynthes | 96.36 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 96.32 | |
| COG0106 | 241 | HisA Phosphoribosylformimino-5-aminoimidazole carb | 96.31 | |
| PRK13523 | 337 | NADPH dehydrogenase NamA; Provisional | 96.3 | |
| PRK13803 | 610 | bifunctional phosphoribosylanthranilate isomerase/ | 96.28 | |
| PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisi | 96.27 | |
| PRK09427 | 454 | bifunctional indole-3-glycerol phosphate synthase/ | 96.27 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 96.27 | |
| PLN02495 | 385 | oxidoreductase, acting on the CH-CH group of donor | 96.26 | |
| cd04733 | 338 | OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN | 96.25 | |
| PRK06852 | 304 | aldolase; Validated | 96.24 | |
| PRK13802 | 695 | bifunctional indole-3-glycerol phosphate synthase/ | 96.21 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 96.2 | |
| PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisi | 96.1 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 96.09 | |
| COG0106 | 241 | HisA Phosphoribosylformimino-5-aminoimidazole carb | 96.07 | |
| PRK02261 | 137 | methylaspartate mutase subunit S; Provisional | 96.06 | |
| cd02911 | 233 | arch_FMN Archeal FMN-binding domain. This family o | 96.04 | |
| PLN02363 | 256 | phosphoribosylanthranilate isomerase | 95.99 | |
| COG0434 | 263 | SgcQ Predicted TIM-barrel enzyme [General function | 95.91 | |
| cd02811 | 326 | IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di | 95.89 | |
| PRK05096 | 346 | guanosine 5'-monophosphate oxidoreductase; Provisi | 95.88 | |
| TIGR01305 | 343 | GMP_reduct_1 guanosine monophosphate reductase, eu | 95.88 | |
| TIGR00640 | 132 | acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal | 95.85 | |
| PRK14565 | 237 | triosephosphate isomerase; Provisional | 95.84 | |
| PRK10605 | 362 | N-ethylmaleimide reductase; Provisional | 95.78 | |
| cd02067 | 119 | B12-binding B12 binding domain (B12-BD). This doma | 95.75 | |
| COG0107 | 256 | HisF Imidazoleglycerol-phosphate synthase [Amino a | 95.74 | |
| cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d | 95.71 | |
| COG1646 | 240 | Predicted phosphate-binding enzymes, TIM-barrel fo | 95.69 | |
| PF03932 | 201 | CutC: CutC family; InterPro: IPR005627 Copper tran | 95.69 | |
| cd02922 | 344 | FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom | 95.68 | |
| PLN02979 | 366 | glycolate oxidase | 95.63 | |
| TIGR02708 | 367 | L_lactate_ox L-lactate oxidase. Members of this pr | 95.62 | |
| PF04481 | 242 | DUF561: Protein of unknown function (DUF561); Inte | 95.59 | |
| PRK13957 | 247 | indole-3-glycerol-phosphate synthase; Provisional | 95.58 | |
| COG0042 | 323 | tRNA-dihydrouridine synthase [Translation, ribosom | 95.56 | |
| cd00331 | 217 | IGPS Indole-3-glycerol phosphate synthase (IGPS); | 95.45 | |
| PRK11197 | 381 | lldD L-lactate dehydrogenase; Provisional | 95.4 | |
| cd02931 | 382 | ER_like_FMN Enoate reductase (ER)-like FMN-binding | 95.39 | |
| PLN02460 | 338 | indole-3-glycerol-phosphate synthase | 95.38 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 95.37 | |
| TIGR02814 | 444 | pfaD_fam PfaD family protein. The protein PfaD is | 95.36 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 95.34 | |
| cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine m | 95.33 | |
| cd02932 | 336 | OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN | 95.31 | |
| TIGR02129 | 253 | hisA_euk phosphoribosylformimino-5-aminoimidazole | 95.31 | |
| PF01645 | 368 | Glu_synthase: Conserved region in glutamate syntha | 95.29 | |
| cd04742 | 418 | NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom | 95.29 | |
| COG0325 | 228 | Predicted enzyme with a TIM-barrel fold [General f | 95.26 | |
| cd04747 | 361 | OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN | 95.25 | |
| PRK08185 | 283 | hypothetical protein; Provisional | 95.24 | |
| cd04734 | 343 | OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN | 95.18 | |
| TIGR00734 | 221 | hisAF_rel hisA/hisF family protein. This alignment | 95.11 | |
| PF01070 | 356 | FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR | 95.1 | |
| KOG2335 | 358 | consensus tRNA-dihydrouridine synthase [Translatio | 95.03 | |
| TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase, ba | 94.9 | |
| TIGR00742 | 318 | yjbN tRNA dihydrouridine synthase A. Members of th | 94.87 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 94.82 | |
| PLN02411 | 391 | 12-oxophytodienoate reductase | 94.81 | |
| PLN02493 | 367 | probable peroxisomal (S)-2-hydroxy-acid oxidase | 94.75 | |
| COG2070 | 336 | Dioxygenases related to 2-nitropropane dioxygenase | 94.66 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 94.62 | |
| cd02930 | 353 | DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin | 94.56 | |
| cd02929 | 370 | TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) | 94.56 | |
| COG0149 | 251 | TpiA Triosephosphate isomerase [Carbohydrate trans | 94.46 | |
| PF02310 | 121 | B12-binding: B12 binding domain; InterPro: IPR0061 | 94.36 | |
| cd00945 | 201 | Aldolase_Class_I Class I aldolases. The class I al | 94.35 | |
| PRK14567 | 253 | triosephosphate isomerase; Provisional | 94.31 | |
| COG2185 | 143 | Sbm Methylmalonyl-CoA mutase, C-terminal domain/su | 94.02 | |
| PRK09427 | 454 | bifunctional indole-3-glycerol phosphate synthase/ | 94.0 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 93.97 | |
| cd06822 | 227 | PLPDE_III_YBL036c_euk Pyridoxal 5-phosphate (PLP)- | 93.95 | |
| TIGR01501 | 134 | MthylAspMutase methylaspartate mutase, S subunit. | 93.93 | |
| TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase, ba | 93.89 | |
| KOG0538 | 363 | consensus Glycolate oxidase [Energy production and | 93.85 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 93.78 | |
| PRK14905 | 355 | triosephosphate isomerase/PTS system glucose/sucro | 93.63 | |
| COG3142 | 241 | CutC Uncharacterized protein involved in copper re | 93.36 | |
| cd00311 | 242 | TIM Triosephosphate isomerase (TIM) is a glycolyti | 93.34 | |
| PF00478 | 352 | IMPDH: IMP dehydrogenase / GMP reductase domain; I | 92.97 | |
| TIGR01305 | 343 | GMP_reduct_1 guanosine monophosphate reductase, eu | 92.91 | |
| KOG4175 | 268 | consensus Tryptophan synthase alpha chain [Amino a | 92.86 | |
| cd02069 | 213 | methionine_synthase_B12_BD B12 binding domain of m | 92.52 | |
| KOG3055 | 263 | consensus Phosphoribosylformimino-5-aminoimidazole | 92.46 | |
| KOG1799 | 471 | consensus Dihydropyrimidine dehydrogenase [Nucleot | 92.29 | |
| PRK05437 | 352 | isopentenyl pyrophosphate isomerase; Provisional | 92.23 | |
| PRK05096 | 346 | guanosine 5'-monophosphate oxidoreductase; Provisi | 92.18 | |
| PRK00042 | 250 | tpiA triosephosphate isomerase; Provisional | 91.96 | |
| PLN02623 | 581 | pyruvate kinase | 91.75 | |
| PLN02429 | 315 | triosephosphate isomerase | 91.73 | |
| cd00959 | 203 | DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of | 91.37 | |
| PF01207 | 309 | Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 | 91.31 | |
| cd02811 | 326 | IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di | 91.2 | |
| COG1902 | 363 | NemA NADH:flavin oxidoreductases, Old Yellow Enzym | 91.15 | |
| COG1411 | 229 | Uncharacterized protein related to proFAR isomeras | 91.06 | |
| COG1692 | 266 | Calcineurin-like phosphoesterase [General function | 90.7 | |
| PLN02617 | 538 | imidazole glycerol phosphate synthase hisHF | 90.59 | |
| PRK09250 | 348 | fructose-bisphosphate aldolase; Provisional | 90.58 | |
| PRK05718 | 212 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 90.53 | |
| cd02072 | 128 | Glm_B12_BD B12 binding domain of glutamate mutase | 90.46 | |
| PF01791 | 236 | DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 | 90.35 | |
| PRK09426 | 714 | methylmalonyl-CoA mutase; Reviewed | 90.14 | |
| PRK15492 | 260 | triosephosphate isomerase; Provisional | 90.12 | |
| PF00724 | 341 | Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox | 90.08 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 90.06 | |
| PTZ00333 | 255 | triosephosphate isomerase; Provisional | 89.99 | |
| cd02070 | 201 | corrinoid_protein_B12-BD B12 binding domain of cor | 89.81 | |
| cd04743 | 320 | NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma | 89.23 | |
| TIGR00126 | 211 | deoC deoxyribose-phosphate aldolase. Deoxyribose-p | 88.95 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 88.88 | |
| cd08207 | 406 | RLP_NonPhot Ribulose bisphosphate carboxylase like | 88.87 | |
| PF04476 | 235 | DUF556: Protein of unknown function (DUF556); Inte | 88.61 | |
| PF13277 | 253 | YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. | 88.43 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 88.26 | |
| cd04726 | 202 | KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl | 88.17 | |
| TIGR00419 | 205 | tim triosephosphate isomerase. Triosephosphate iso | 88.05 | |
| TIGR01417 | 565 | PTS_I_fam phosphoenolpyruvate-protein phosphotrans | 88.04 | |
| PRK06464 | 795 | phosphoenolpyruvate synthase; Validated | 88.03 | |
| cd04824 | 320 | eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthas | 87.89 | |
| PRK10128 | 267 | 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional | 87.87 | |
| cd00956 | 211 | Transaldolase_FSA Transaldolase-like fructose-6-ph | 87.69 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 87.59 | |
| PRK08508 | 279 | biotin synthase; Provisional | 87.43 | |
| PRK02227 | 238 | hypothetical protein; Provisional | 87.39 | |
| PRK09196 | 347 | fructose-1,6-bisphosphate aldolase; Reviewed | 87.25 | |
| TIGR02320 | 285 | PEP_mutase phosphoenolpyruvate phosphomutase. A cl | 86.84 | |
| COG0069 | 485 | GltB Glutamate synthase domain 2 [Amino acid trans | 86.3 | |
| PLN02428 | 349 | lipoic acid synthase | 86.18 | |
| PRK00507 | 221 | deoxyribose-phosphate aldolase; Provisional | 86.18 | |
| PRK07565 | 334 | dihydroorotate dehydrogenase 2; Reviewed | 86.14 | |
| PRK13111 | 258 | trpA tryptophan synthase subunit alpha; Provisiona | 86.1 | |
| TIGR02370 | 197 | pyl_corrinoid methyltransferase cognate corrinoid | 86.01 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 85.87 | |
| cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d | 85.65 | |
| TIGR00045 | 375 | glycerate kinase. The only characterized member of | 85.55 | |
| PRK01362 | 214 | putative translaldolase; Provisional | 85.51 | |
| TIGR01521 | 347 | FruBisAldo_II_B fructose-bisphosphate aldolase, cl | 85.48 | |
| TIGR02127 | 261 | pyrF_sub2 orotidine 5'-phosphate decarboxylase, su | 85.42 | |
| TIGR03239 | 249 | GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co | 85.41 | |
| cd00452 | 190 | KDPG_aldolase KDPG and KHG aldolase. This family b | 85.38 | |
| cd03174 | 265 | DRE_TIM_metallolyase DRE-TIM metallolyase superfam | 85.2 | |
| TIGR00676 | 272 | fadh2 5,10-methylenetetrahydrofolate reductase, pr | 85.17 | |
| PF00121 | 244 | TIM: Triosephosphate isomerase; InterPro: IPR00065 | 85.07 | |
| TIGR01182 | 204 | eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho | 85.03 | |
| PRK07998 | 283 | gatY putative fructose-1,6-bisphosphate aldolase; | 84.93 | |
| PRK12857 | 284 | fructose-1,6-bisphosphate aldolase; Reviewed | 84.79 | |
| COG3749 | 167 | Uncharacterized protein conserved in bacteria [Fun | 84.7 | |
| PRK07084 | 321 | fructose-bisphosphate aldolase; Provisional | 84.6 | |
| TIGR00167 | 288 | cbbA ketose-bisphosphate aldolases. fructose-bisph | 84.08 | |
| TIGR01418 | 782 | PEP_synth phosphoenolpyruvate synthase. Also calle | 83.93 | |
| cd00429 | 211 | RPE Ribulose-5-phosphate 3-epimerase (RPE). This e | 83.8 | |
| PRK06015 | 201 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 83.65 | |
| COG1891 | 235 | Uncharacterized protein conserved in archaea [Func | 83.46 | |
| PRK08444 | 353 | hypothetical protein; Provisional | 83.44 | |
| TIGR01858 | 282 | tag_bisphos_ald class II aldolase, tagatose bispho | 83.32 | |
| TIGR00262 | 256 | trpA tryptophan synthase, alpha subunit. Tryptopha | 83.28 | |
| KOG3157 | 244 | consensus Proline synthetase co-transcribed protei | 83.26 | |
| PRK08610 | 286 | fructose-bisphosphate aldolase; Reviewed | 83.1 | |
| PRK09195 | 284 | gatY tagatose-bisphosphate aldolase; Reviewed | 83.07 | |
| PRK12737 | 284 | gatY tagatose-bisphosphate aldolase; Reviewed | 82.74 | |
| cd02068 | 127 | radical_SAM_B12_BD B12 binding domain_like associa | 82.72 | |
| PF01081 | 196 | Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 | 82.51 | |
| PF01116 | 287 | F_bP_aldolase: Fructose-bisphosphate aldolase clas | 82.37 | |
| TIGR02151 | 333 | IPP_isom_2 isopentenyl-diphosphate delta-isomerase | 82.11 | |
| COG1304 | 360 | idi Isopentenyl diphosphate isomerase (BS_ypgA, MT | 81.99 | |
| PLN02561 | 253 | triosephosphate isomerase | 81.96 | |
| COG3836 | 255 | HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola | 81.93 | |
| PRK10643 | 222 | DNA-binding transcriptional regulator BasR; Provis | 81.9 | |
| PRK12581 | 468 | oxaloacetate decarboxylase; Provisional | 81.79 | |
| cd02922 | 344 | FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom | 81.57 | |
| KOG4201 | 289 | consensus Anthranilate synthase component II [Amin | 81.54 | |
| PRK11613 | 282 | folP dihydropteroate synthase; Provisional | 81.52 | |
| PLN02493 | 367 | probable peroxisomal (S)-2-hydroxy-acid oxidase | 81.49 | |
| PRK12738 | 286 | kbaY tagatose-bisphosphate aldolase; Reviewed | 81.42 | |
| TIGR03326 | 412 | rubisco_III ribulose bisphosphate carboxylase, typ | 81.29 | |
| PF08029 | 75 | HisG_C: HisG, C-terminal domain; InterPro: IPR0131 | 81.25 | |
| cd07939 | 259 | DRE_TIM_NifV Streptomyces rubellomurinus FrbC and | 81.13 | |
| cd00408 | 281 | DHDPS-like Dihydrodipicolinate synthase family. A | 80.9 | |
| cd04736 | 361 | MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin | 80.78 | |
| PRK13399 | 347 | fructose-1,6-bisphosphate aldolase; Provisional | 80.75 | |
| cd00959 | 203 | DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of | 80.7 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 80.69 | |
| cd07948 | 262 | DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s | 80.57 | |
| cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin | 80.56 | |
| PTZ00413 | 398 | lipoate synthase; Provisional | 80.48 | |
| PLN02979 | 366 | glycolate oxidase | 80.37 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 80.04 |
| >COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.5e-35 Score=216.66 Aligned_cols=107 Identities=43% Similarity=0.782 Sum_probs=101.6
Q ss_pred CceEEEecCCCCHHhHHHhHhCCCCCCEEEEEeeeCCCCCcccchhHHHHHHHHHhhCC---CCcEEEEcCCChhhHHHH
Q 033598 1 MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYP---SLDIEVDGGLGPSTIAEA 77 (115)
Q Consensus 1 ~k~Glal~p~t~~~~~~~~~~~~~~vD~vlvm~v~pG~~gq~~~~~~~~ki~~l~~~~~---~~~i~~dGGI~~~ni~~l 77 (115)
+|+|++|||+||++.+++++ +.+|+|++|+|+|||+||+|++++++||+++|++.. ++.|+||||||.+|++++
T Consensus 110 ~kaGv~lnP~Tp~~~i~~~l---~~vD~VllMsVnPGfgGQ~Fi~~~l~Ki~~lr~~~~~~~~~~IeVDGGI~~~t~~~~ 186 (220)
T COG0036 110 VKAGLVLNPATPLEALEPVL---DDVDLVLLMSVNPGFGGQKFIPEVLEKIRELRAMIDERLDILIEVDGGINLETIKQL 186 (220)
T ss_pred CeEEEEECCCCCHHHHHHHH---hhCCEEEEEeECCCCcccccCHHHHHHHHHHHHHhcccCCeEEEEeCCcCHHHHHHH
Confidence 68999999999999999999 999999999999999999999999999999999876 678999999999999999
Q ss_pred HHcCCCEEEEcccccCCCCHHHHHHHHHHHHHH
Q 033598 78 ASAGANCIVAGSSVFGAPEPAHVISLMRKSVED 110 (115)
Q Consensus 78 ~~~Gad~iv~Gsaif~~~d~~~~~~~l~~~~~~ 110 (115)
.++|||++|+||++|+++|+++.+++++..+..
T Consensus 187 ~~AGad~~VaGSalF~~~d~~~~i~~~~~~~~~ 219 (220)
T COG0036 187 AAAGADVFVAGSALFGADDYKATIRELRGELLK 219 (220)
T ss_pred HHcCCCEEEEEEEEeCCccHHHHHHHHHHHhhc
Confidence 999999999999999999999999999987653
|
|
| >PRK08745 ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK08091 ribulose-phosphate 3-epimerase; Validated | Back alignment and domain information |
|---|
| >PRK08005 epimerase; Validated | Back alignment and domain information |
|---|
| >PRK14057 epimerase; Provisional | Back alignment and domain information |
|---|
| >PRK09722 allulose-6-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08883 ribulose-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 | Back alignment and domain information |
|---|
| >PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional | Back alignment and domain information |
|---|
| >PLN02334 ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
| >PRK05581 ribulose-phosphate 3-epimerase; Validated | Back alignment and domain information |
|---|
| >TIGR01163 rpe ribulose-phosphate 3-epimerase | Back alignment and domain information |
|---|
| >cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) | Back alignment and domain information |
|---|
| >PRK13125 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase | Back alignment and domain information |
|---|
| >PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK13813 orotidine 5'-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed | Back alignment and domain information |
|---|
| >cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) | Back alignment and domain information |
|---|
| >TIGR00262 trpA tryptophan synthase, alpha subunit | Back alignment and domain information |
|---|
| >cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) | Back alignment and domain information |
|---|
| >cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI | Back alignment and domain information |
|---|
| >COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated | Back alignment and domain information |
|---|
| >CHL00200 trpA tryptophan synthase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed | Back alignment and domain information |
|---|
| >PRK03512 thiamine-phosphate pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK06512 thiamine-phosphate pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK02615 thiamine-phosphate pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK07695 transcriptional regulator TenI; Provisional | Back alignment and domain information |
|---|
| >TIGR00693 thiE thiamine-phosphate pyrophosphorylase | Back alignment and domain information |
|---|
| >PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed | Back alignment and domain information |
|---|
| >COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa | Back alignment and domain information |
|---|
| >PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 | Back alignment and domain information |
|---|
| >PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 | Back alignment and domain information |
|---|
| >PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd00452 KDPG_aldolase KDPG and KHG aldolase | Back alignment and domain information |
|---|
| >cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport | Back alignment and domain information |
|---|
| >PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water | Back alignment and domain information |
|---|
| >TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase | Back alignment and domain information |
|---|
| >TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase | Back alignment and domain information |
|---|
| >PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 | Back alignment and domain information |
|---|
| >PRK06806 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) | Back alignment and domain information |
|---|
| >PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK00208 thiG thiazole synthase; Reviewed | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >PRK07226 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate | Back alignment and domain information |
|---|
| >cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites | Back alignment and domain information |
|---|
| >PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional | Back alignment and domain information |
|---|
| >PLN02591 tryptophan synthase | Back alignment and domain information |
|---|
| >PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure | Back alignment and domain information |
|---|
| >TIGR01334 modD putative molybdenum utilization protein ModD | Back alignment and domain information |
|---|
| >PRK07315 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK04302 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06096 molybdenum transport protein ModD; Provisional | Back alignment and domain information |
|---|
| >PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01182 eda Entner-Doudoroff aldolase | Back alignment and domain information |
|---|
| >PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK13111 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09016 quinolinate phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein | Back alignment and domain information |
|---|
| >TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 | Back alignment and domain information |
|---|
| >TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist | Back alignment and domain information |
|---|
| >PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK07259 dihydroorotate dehydrogenase 1B; Reviewed | Back alignment and domain information |
|---|
| >PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) | Back alignment and domain information |
|---|
| >cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain | Back alignment and domain information |
|---|
| >PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: |
Back alignment and domain information |
|---|
| >PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 | Back alignment and domain information |
|---|
| >cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02812 PcrB_like PcrB_like proteins | Back alignment and domain information |
|---|
| >TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 | Back alignment and domain information |
|---|
| >PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 | Back alignment and domain information |
|---|
| >PRK06801 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >CHL00162 thiG thiamin biosynthesis protein G; Validated | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional | Back alignment and domain information |
|---|
| >PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane | Back alignment and domain information |
|---|
| >cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type | Back alignment and domain information |
|---|
| >COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences | Back alignment and domain information |
|---|
| >PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | Back alignment and domain information |
|---|
| >PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >PRK05286 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07565 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >PRK08662 nicotinate phosphoribosyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain | Back alignment and domain information |
|---|
| >cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 | Back alignment and domain information |
|---|
| >PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 | Back alignment and domain information |
|---|
| >cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10415 tRNA-dihydrouridine synthase B; Provisional | Back alignment and domain information |
|---|
| >PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) | Back alignment and domain information |
|---|
| >PLN02617 imidazole glycerol phosphate synthase hisHF | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >PF00697 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isomerase; InterPro: IPR001240 Indole-3-glycerol phosphate synthase (IGPS) (see IPR001468 from INTERPRO) catalyzes the fourth step in the biosynthesis of tryptophan, the ring closure of 1-(2-carboxy-phenylamino)-1-deoxyribulose into indol-3-glycerol-phosphate | Back alignment and domain information |
|---|
| >TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II | Back alignment and domain information |
|---|
| >PLN02826 dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway | Back alignment and domain information |
|---|
| >TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase | Back alignment and domain information |
|---|
| >TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 | Back alignment and domain information |
|---|
| >PRK10550 tRNA-dihydrouridine synthase C; Provisional | Back alignment and domain information |
|---|
| >PRK08227 autoinducer 2 aldolase; Validated | Back alignment and domain information |
|---|
| >COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00736 nifR3_rel_arch TIM-barrel protein, putative | Back alignment and domain information |
|---|
| >COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK02506 dihydroorotate dehydrogenase 1A; Reviewed | Back alignment and domain information |
|---|
| >TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 | Back alignment and domain information |
|---|
| >TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family | Back alignment and domain information |
|---|
| >cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK11815 tRNA-dihydrouridine synthase A; Provisional | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >PF00215 OMPdecase: Orotidine 5'-phosphate decarboxylase / HUMPS family; InterPro: IPR001754 Orotidine 5'-phosphate decarboxylase (OMPdecase) [, ] catalyses the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP | Back alignment and domain information |
|---|
| >PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 | Back alignment and domain information |
|---|
| >COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase | Back alignment and domain information |
|---|
| >PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase | Back alignment and domain information |
|---|
| >TIGR00734 hisAF_rel hisA/hisF family protein | Back alignment and domain information |
|---|
| >PRK11572 copper homeostasis protein CutC; Provisional | Back alignment and domain information |
|---|
| >PF06073 DUF934: Bacterial protein of unknown function (DUF934); InterPro: IPR008318 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >PRK05437 isopentenyl pyrophosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07188 nicotinate phosphoribosyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain | Back alignment and domain information |
|---|
| >cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain | Back alignment and domain information |
|---|
| >cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase | Back alignment and domain information |
|---|
| >PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated | Back alignment and domain information |
|---|
| >PLN02535 glycolate oxidase | Back alignment and domain information |
|---|
| >cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13523 NADPH dehydrogenase NamA; Provisional | Back alignment and domain information |
|---|
| >PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02495 oxidoreductase, acting on the CH-CH group of donors | Back alignment and domain information |
|---|
| >cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 | Back alignment and domain information |
|---|
| >PRK06852 aldolase; Validated | Back alignment and domain information |
|---|
| >PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK02261 methylaspartate mutase subunit S; Provisional | Back alignment and domain information |
|---|
| >cd02911 arch_FMN Archeal FMN-binding domain | Back alignment and domain information |
|---|
| >PLN02363 phosphoribosylanthranilate isomerase | Back alignment and domain information |
|---|
| >COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
|---|
| >TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain | Back alignment and domain information |
|---|
| >PRK14565 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10605 N-ethylmaleimide reductase; Provisional | Back alignment and domain information |
|---|
| >cd02067 B12-binding B12 binding domain (B12-BD) | Back alignment and domain information |
|---|
| >COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF | Back alignment and domain information |
|---|
| >cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
| >PLN02979 glycolate oxidase | Back alignment and domain information |
|---|
| >TIGR02708 L_lactate_ox L-lactate oxidase | Back alignment and domain information |
|---|
| >PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae | Back alignment and domain information |
|---|
| >PRK13957 indole-3-glycerol-phosphate synthase; Provisional | Back alignment and domain information |
|---|
| >COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water | Back alignment and domain information |
|---|
| >PRK11197 lldD L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain | Back alignment and domain information |
|---|
| >PLN02460 indole-3-glycerol-phosphate synthase | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02814 pfaD_fam PfaD family protein | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain | Back alignment and domain information |
|---|
| >TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type | Back alignment and domain information |
|---|
| >PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] | Back alignment and domain information |
|---|
| >cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD | Back alignment and domain information |
|---|
| >COG0325 Predicted enzyme with a TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 | Back alignment and domain information |
|---|
| >PRK08185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 | Back alignment and domain information |
|---|
| >TIGR00734 hisAF_rel hisA/hisF family protein | Back alignment and domain information |
|---|
| >PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related | Back alignment and domain information |
|---|
| >KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial | Back alignment and domain information |
|---|
| >TIGR00742 yjbN tRNA dihydrouridine synthase A | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02411 12-oxophytodienoate reductase | Back alignment and domain information |
|---|
| >PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
| >COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain | Back alignment and domain information |
|---|
| >cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain | Back alignment and domain information |
|---|
| >COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) | Back alignment and domain information |
|---|
| >cd00945 Aldolase_Class_I Class I aldolases | Back alignment and domain information |
|---|
| >PRK14567 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd06822 PLPDE_III_YBL036c_euk Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Eukaryotic YBL036c-like proteins | Back alignment and domain information |
|---|
| >TIGR01501 MthylAspMutase methylaspartate mutase, S subunit | Back alignment and domain information |
|---|
| >TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial | Back alignment and domain information |
|---|
| >KOG0538 consensus Glycolate oxidase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional | Back alignment and domain information |
|---|
| >COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate | Back alignment and domain information |
|---|
| >PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase | Back alignment and domain information |
|---|
| >TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
|---|
| >KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase | Back alignment and domain information |
|---|
| >KOG3055 consensus Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1799 consensus Dihydropyrimidine dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05437 isopentenyl pyrophosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK00042 tpiA triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PLN02623 pyruvate kinase | Back alignment and domain information |
|---|
| >PLN02429 triosephosphate isomerase | Back alignment and domain information |
|---|
| >cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family | Back alignment and domain information |
|---|
| >PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA | Back alignment and domain information |
|---|
| >cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain | Back alignment and domain information |
|---|
| >COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1692 Calcineurin-like phosphoesterase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02617 imidazole glycerol phosphate synthase hisHF | Back alignment and domain information |
|---|
| >PRK09250 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) | Back alignment and domain information |
|---|
| >PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism | Back alignment and domain information |
|---|
| >PRK09426 methylmalonyl-CoA mutase; Reviewed | Back alignment and domain information |
|---|
| >PRK15492 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00333 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins | Back alignment and domain information |
|---|
| >cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) | Back alignment and domain information |
|---|
| >TIGR00126 deoC deoxyribose-phosphate aldolase | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >cd08207 RLP_NonPhot Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria | Back alignment and domain information |
|---|
| >PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised | Back alignment and domain information |
|---|
| >PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) | Back alignment and domain information |
|---|
| >TIGR00419 tim triosephosphate isomerase | Back alignment and domain information |
|---|
| >TIGR01417 PTS_I_fam phosphoenolpyruvate-protein phosphotransferase | Back alignment and domain information |
|---|
| >PRK06464 phosphoenolpyruvate synthase; Validated | Back alignment and domain information |
|---|
| >cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll | Back alignment and domain information |
|---|
| >PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK08508 biotin synthase; Provisional | Back alignment and domain information |
|---|
| >PRK02227 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase | Back alignment and domain information |
|---|
| >COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02428 lipoic acid synthase | Back alignment and domain information |
|---|
| >PRK00507 deoxyribose-phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >PRK07565 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >PRK13111 trpA tryptophan synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR00045 glycerate kinase | Back alignment and domain information |
|---|
| >PRK01362 putative translaldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype | Back alignment and domain information |
|---|
| >TIGR02127 pyrF_sub2 orotidine 5'-phosphate decarboxylase, subfamily 2 | Back alignment and domain information |
|---|
| >TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase | Back alignment and domain information |
|---|
| >cd00452 KDPG_aldolase KDPG and KHG aldolase | Back alignment and domain information |
|---|
| >cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily | Back alignment and domain information |
|---|
| >TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase, prokaryotic form | Back alignment and domain information |
|---|
| >PF00121 TIM: Triosephosphate isomerase; InterPro: IPR000652 Triosephosphate isomerase (5 | Back alignment and domain information |
|---|
| >TIGR01182 eda Entner-Doudoroff aldolase | Back alignment and domain information |
|---|
| >PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >COG3749 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK07084 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00167 cbbA ketose-bisphosphate aldolases | Back alignment and domain information |
|---|
| >TIGR01418 PEP_synth phosphoenolpyruvate synthase | Back alignment and domain information |
|---|
| >cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) | Back alignment and domain information |
|---|
| >PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >COG1891 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PRK08444 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family | Back alignment and domain information |
|---|
| >TIGR00262 trpA tryptophan synthase, alpha subunit | Back alignment and domain information |
|---|
| >KOG3157 consensus Proline synthetase co-transcribed protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08610 fructose-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain | Back alignment and domain information |
|---|
| >PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 | Back alignment and domain information |
|---|
| >PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate | Back alignment and domain information |
|---|
| >TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 | Back alignment and domain information |
|---|
| >COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02561 triosephosphate isomerase | Back alignment and domain information |
|---|
| >COG3836 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10643 DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >PRK12581 oxaloacetate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
| >KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11613 folP dihydropteroate synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
| >PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III | Back alignment and domain information |
|---|
| >PF08029 HisG_C: HisG, C-terminal domain; InterPro: IPR013115 ATP phosphoribosyltransferase (2 | Back alignment and domain information |
|---|
| >cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain | Back alignment and domain information |
|---|
| >cd00408 DHDPS-like Dihydrodipicolinate synthase family | Back alignment and domain information |
|---|
| >cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >PRK13399 fructose-1,6-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain | Back alignment and domain information |
|---|
| >cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >PTZ00413 lipoate synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02979 glycolate oxidase | Back alignment and domain information |
|---|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 115 | ||||
| 1h1y_A | 228 | The Structure Of The Cytosolic D-Ribulose-5-Phospha | 3e-49 | ||
| 3ovp_A | 228 | Crystal Structure Of Hrpe Length = 228 | 3e-31 | ||
| 1tqx_A | 227 | Crystal Structure Of Pfal009167 A Putative D-Ribulo | 1e-27 | ||
| 3qc3_A | 225 | Crystal Structure Of A D-Ribulose-5-Phosphate-3-Epi | 2e-26 | ||
| 1tqj_A | 230 | Crystal Structure Of D-Ribulose 5-Phosphate 3-Epime | 9e-18 | ||
| 3inp_A | 246 | 2.05 Angstrom Resolution Crystal Structure Of D-Rib | 1e-17 | ||
| 2fli_A | 220 | The Crystal Structure Of D-Ribulose 5-Phosphate 3-E | 2e-17 | ||
| 1rpx_A | 230 | D-Ribulose-5-Phosphate 3-Epimerase From Solanum Tub | 8e-17 | ||
| 3ct7_A | 231 | Crystal Structure Of D-Allulose 6-Phosphate 3-Epime | 2e-11 |
| >pdb|1H1Y|A Chain A, The Structure Of The Cytosolic D-Ribulose-5-Phosphate 3- Epimerase From Rice Complexed With Sulfate Length = 228 | Back alignment and structure |
|
| >pdb|3OVP|A Chain A, Crystal Structure Of Hrpe Length = 228 | Back alignment and structure |
| >pdb|1TQX|A Chain A, Crystal Structure Of Pfal009167 A Putative D-Ribulose 5-Phosphate 3- Epimerase From P.Falciparum Length = 227 | Back alignment and structure |
| >pdb|3QC3|A Chain A, Crystal Structure Of A D-Ribulose-5-Phosphate-3-Epimerase (Np_954699) From Homo Sapiens At 2.20 A Resolution Length = 225 | Back alignment and structure |
| >pdb|1TQJ|A Chain A, Crystal Structure Of D-Ribulose 5-Phosphate 3-Epimerase From Synechocystis To 1.6 Angstrom Resolution Length = 230 | Back alignment and structure |
| >pdb|3INP|A Chain A, 2.05 Angstrom Resolution Crystal Structure Of D-Ribulose-Phosphate 3- Epimerase From Francisella Tularensis Length = 246 | Back alignment and structure |
| >pdb|2FLI|A Chain A, The Crystal Structure Of D-Ribulose 5-Phosphate 3-Epimerase From Streptococus Pyogenes Complexed With D-Xylitol 5- Phosphate Length = 220 | Back alignment and structure |
| >pdb|1RPX|A Chain A, D-Ribulose-5-Phosphate 3-Epimerase From Solanum Tuberosum Chloroplasts Length = 230 | Back alignment and structure |
| >pdb|3CT7|A Chain A, Crystal Structure Of D-Allulose 6-Phosphate 3-Epimerase From Escherichia Coli K-12 Length = 231 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 115 | |||
| 1h1y_A | 228 | D-ribulose-5-phosphate 3-epimerase; oxidative pent | 8e-63 | |
| 1tqx_A | 227 | D-ribulose-5-phosphate 3-epimerase, putative; stru | 6e-59 | |
| 3ovp_A | 228 | Ribulose-phosphate 3-epimerase; iron binding, isom | 2e-57 | |
| 2fli_A | 220 | Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr | 2e-42 | |
| 1tqj_A | 230 | Ribulose-phosphate 3-epimerase; beta-alpha barrel | 7e-42 | |
| 3inp_A | 246 | D-ribulose-phosphate 3-epimerase; IDP02542, isomer | 9e-42 | |
| 1rpx_A | 230 | Protein (ribulose-phosphate 3-epimerase); chloropl | 4e-41 | |
| 3ctl_A | 231 | D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p | 4e-39 | |
| 3cu2_A | 237 | Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib | 4e-36 | |
| 3exr_A | 221 | RMPD (hexulose-6-phosphate synthase); beta barrel, | 8e-20 | |
| 3jr2_A | 218 | Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon | 4e-18 | |
| 1q6o_A | 216 | Humps, 3-keto-L-gulonate 6-phosphate decarboxylase | 4e-18 | |
| 3f4w_A | 211 | Putative hexulose 6 phosphate synthase; humps, mal | 2e-16 | |
| 3ajx_A | 207 | 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf | 1e-15 |
| >1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Length = 228 | Back alignment and structure |
|---|
Score = 189 bits (483), Expect = 8e-63
Identities = 92/115 (80%), Positives = 102/115 (88%)
Query: 1 MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60
MRPGV+L+PGT VEEV+PLVE NPVE+VLVMTVEPGFGGQKFMPEMM+KVR+LR +YPS
Sbjct: 114 MRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPS 173
Query: 61 LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS 115
LDIEVDGGLGPSTI AASAGANCIVAGSS+FGA EP VIS +RKSVE +Q S
Sbjct: 174 LDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGSQNKS 228
|
| >1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Length = 227 | Back alignment and structure |
|---|
| >3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} PDB: 3ovq_A* 3ovr_A* 3qc3_A Length = 228 | Back alignment and structure |
|---|
| >2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Length = 220 | Back alignment and structure |
|---|
| >1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Length = 230 | Back alignment and structure |
|---|
| >3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Length = 246 | Back alignment and structure |
|---|
| >1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Length = 230 | Back alignment and structure |
|---|
| >3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Length = 231 | Back alignment and structure |
|---|
| >3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Length = 237 | Back alignment and structure |
|---|
| >3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} PDB: 3exs_A* 3ext_A Length = 221 | Back alignment and structure |
|---|
| >3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} PDB: 3ieb_A* Length = 218 | Back alignment and structure |
|---|
| >1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Length = 216 | Back alignment and structure |
|---|
| >3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} Length = 211 | Back alignment and structure |
|---|
| >3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Length = 207 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| 1tqx_A | 227 | D-ribulose-5-phosphate 3-epimerase, putative; stru | 100.0 | |
| 3inp_A | 246 | D-ribulose-phosphate 3-epimerase; IDP02542, isomer | 99.97 | |
| 3ovp_A | 228 | Ribulose-phosphate 3-epimerase; iron binding, isom | 99.97 | |
| 3ctl_A | 231 | D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p | 99.97 | |
| 3cu2_A | 237 | Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib | 99.96 | |
| 1tqj_A | 230 | Ribulose-phosphate 3-epimerase; beta-alpha barrel | 99.95 | |
| 1h1y_A | 228 | D-ribulose-5-phosphate 3-epimerase; oxidative pent | 99.95 | |
| 1rpx_A | 230 | Protein (ribulose-phosphate 3-epimerase); chloropl | 99.89 | |
| 2fli_A | 220 | Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr | 99.89 | |
| 3jr2_A | 218 | Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon | 99.79 | |
| 2czd_A | 208 | Orotidine 5'-phosphate decarboxylase; pyrimidine b | 99.77 | |
| 3f4w_A | 211 | Putative hexulose 6 phosphate synthase; humps, mal | 99.76 | |
| 3ajx_A | 207 | 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf | 99.71 | |
| 2yyu_A | 246 | Orotidine 5'-phosphate decarboxylase; TIM barrel, | 99.68 | |
| 3o63_A | 243 | Probable thiamine-phosphate pyrophosphorylase; thi | 99.67 | |
| 3exr_A | 221 | RMPD (hexulose-6-phosphate synthase); beta barrel, | 99.66 | |
| 1q6o_A | 216 | Humps, 3-keto-L-gulonate 6-phosphate decarboxylase | 99.66 | |
| 1geq_A | 248 | Tryptophan synthase alpha-subunit; hyperthermophIl | 99.64 | |
| 1eix_A | 245 | Orotidine 5'-monophosphate decarboxylase; alpha-be | 99.64 | |
| 2tps_A | 227 | Protein (thiamin phosphate synthase); thiamin bios | 99.64 | |
| 1dbt_A | 239 | Orotidine 5'-phosphate decarboxylase; UMP, TIM bar | 99.63 | |
| 1yad_A | 221 | Regulatory protein TENI; TIM barrel, transcription | 99.63 | |
| 1xi3_A | 215 | Thiamine phosphate pyrophosphorylase; structural g | 99.63 | |
| 1rd5_A | 262 | Tryptophan synthase alpha chain, chloroplast; hydr | 99.55 | |
| 1qop_A | 268 | Tryptophan synthase alpha chain; lyase, carbon-oxy | 99.52 | |
| 3nl6_A | 540 | Thiamine biosynthetic bifunctional enzyme; thiamin | 99.5 | |
| 2v82_A | 212 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l | 99.44 | |
| 1yxy_A | 234 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 99.37 | |
| 1wa3_A | 205 | 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, | 99.33 | |
| 1y0e_A | 223 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 99.31 | |
| 2yw3_A | 207 | 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox | 99.25 | |
| 3ceu_A | 210 | Thiamine phosphate pyrophosphorylase; TIM barrel-l | 99.25 | |
| 3vnd_A | 267 | TSA, tryptophan synthase alpha chain; psychrophili | 99.22 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 99.21 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 99.17 | |
| 2zbt_A | 297 | Pyridoxal biosynthesis lyase PDXS; pyridoxine bios | 99.14 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 99.12 | |
| 1xm3_A | 264 | Thiazole biosynthesis protein THIG; structural gen | 99.07 | |
| 1mxs_A | 225 | KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a | 99.05 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 99.04 | |
| 1wbh_A | 214 | KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} | 98.99 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 98.95 | |
| 1vhc_A | 224 | Putative KHG/KDPG aldolase; structural genomics, u | 98.94 | |
| 3m47_A | 228 | Orotidine 5'-phosphate decarboxylase; orotidine 5' | 98.93 | |
| 4adt_A | 297 | Pyridoxine biosynthetic enzyme PDX1 homologue, PU; | 98.93 | |
| 2h6r_A | 219 | Triosephosphate isomerase; beta-alpha barrel; 2.30 | 98.9 | |
| 2yzr_A | 330 | Pyridoxal biosynthesis lyase PDXS; redox protein, | 98.84 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 98.81 | |
| 1w8s_A | 263 | FBP aldolase, fructose-bisphosphate aldolase class | 98.8 | |
| 2ekc_A | 262 | AQ_1548, tryptophan synthase alpha chain; structur | 98.8 | |
| 3ve9_A | 215 | Orotidine-5'-phosphate decarboxylase; TIM barrel f | 98.8 | |
| 2b7n_A | 273 | Probable nicotinate-nucleotide pyrophosphorylase; | 98.75 | |
| 2gjl_A | 328 | Hypothetical protein PA1024; 2-nitropropane dioxyg | 98.73 | |
| 2nv1_A | 305 | Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b | 98.72 | |
| 1o4u_A | 285 | Type II quinolic acid phosphoribosyltransferase; s | 98.71 | |
| 3o07_A | 291 | Pyridoxine biosynthesis protein SNZ1; (beta/alpha) | 98.71 | |
| 3nav_A | 271 | Tryptophan synthase alpha chain; alpha subunit, st | 98.69 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 98.69 | |
| 2jbm_A | 299 | Nicotinate-nucleotide pyrophosphorylase; NAD, enzy | 98.68 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 98.68 | |
| 1qpo_A | 284 | Quinolinate acid phosphoribosyl transferase; type | 98.66 | |
| 1x1o_A | 286 | Nicotinate-nucleotide pyrophosphorylase; transfera | 98.61 | |
| 3ru6_A | 303 | Orotidine 5'-phosphate decarboxylase; structural g | 98.61 | |
| 2qjg_A | 273 | Putative aldolase MJ0400; beta-alpha barrel, lyase | 98.6 | |
| 1vc4_A | 254 | Indole-3-glycerol phosphate synthase; lyase, trypt | 98.59 | |
| 1ujp_A | 271 | Tryptophan synthase alpha chain; riken structural | 98.58 | |
| 4e38_A | 232 | Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho | 98.57 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 98.55 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 98.54 | |
| 3c2e_A | 294 | Nicotinate-nucleotide pyrophosphorylase; qprtase, | 98.52 | |
| 3tfx_A | 259 | Orotidine 5'-phosphate decarboxylase; PSI-biology, | 98.51 | |
| 1to3_A | 304 | Putative aldolase YIHT; beta-alpha barrel, structu | 98.49 | |
| 1vqt_A | 213 | Orotidine 5'-phosphate decarboxylase; TM0332, stru | 98.48 | |
| 4dbe_A | 222 | Orotidine 5'-phosphate decarboxylase; TIM barrel, | 98.48 | |
| 3bw2_A | 369 | 2-nitropropane dioxygenase; TIM barrel, oxidoreduc | 98.45 | |
| 1ep3_A | 311 | Dihydroorotate dehydrogenase B (PYRD subunit); het | 98.45 | |
| 2htm_A | 268 | Thiazole biosynthesis protein THIG; thiamin biosyn | 98.39 | |
| 3tha_A | 252 | Tryptophan synthase alpha chain; structural genomi | 98.37 | |
| 3lab_A | 217 | Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) | 98.35 | |
| 3tqv_A | 287 | Nicotinate-nucleotide pyrophosphorylase; glycosylt | 98.33 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 98.32 | |
| 3bo9_A | 326 | Putative nitroalkan dioxygenase; TM0800, structura | 98.31 | |
| 1qap_A | 296 | Quinolinic acid phosphoribosyltransferase; glycosy | 98.31 | |
| 3paj_A | 320 | Nicotinate-nucleotide pyrophosphorylase, carboxyl; | 98.29 | |
| 3l0g_A | 300 | Nicotinate-nucleotide pyrophosphorylase; ssgcid, N | 98.28 | |
| 3tr2_A | 239 | Orotidine 5'-phosphate decarboxylase; purines, pyr | 98.28 | |
| 3gnn_A | 298 | Nicotinate-nucleotide pyrophosphorylase; decode bi | 98.26 | |
| 2z6i_A | 332 | Trans-2-enoyl-ACP reductase II; fatty acid synthes | 98.21 | |
| 3ldv_A | 255 | Orotidine 5'-phosphate decarboxylase; structural g | 98.17 | |
| 1jub_A | 311 | Dihydroorotate dehydrogenase A; homodimer, alpha-b | 98.15 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 98.13 | |
| 2e6f_A | 314 | Dihydroorotate dehydrogenase; chagas disease, pyri | 98.12 | |
| 3glc_A | 295 | Aldolase LSRF; TIM barrel, lyase, schiff base; HET | 98.07 | |
| 3khj_A | 361 | Inosine-5-monophosphate dehydrogenase; enzyme-inhi | 98.07 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 98.06 | |
| 3vzx_A | 228 | Heptaprenylglyceryl phosphate synthase; biosynthes | 97.99 | |
| 3oix_A | 345 | Putative dihydroorotate dehydrogenase; dihydrooro | 97.97 | |
| 4ef8_A | 354 | Dihydroorotate dehydrogenase; phenyl isothiocyanat | 97.95 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 97.94 | |
| 1i4n_A | 251 | Indole-3-glycerol phosphate synthase; thermostable | 97.93 | |
| 4fo4_A | 366 | Inosine 5'-monophosphate dehydrogenase; structural | 97.88 | |
| 3zwt_A | 367 | Dihydroorotate dehydrogenase (quinone), mitochond; | 97.86 | |
| 3iwp_A | 287 | Copper homeostasis protein CUTC homolog; conserved | 97.78 | |
| 4gj1_A | 243 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 97.77 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 97.76 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 97.74 | |
| 3w01_A | 235 | Heptaprenylglyceryl phosphate synthase; biosynthes | 97.73 | |
| 3b0p_A | 350 | TRNA-dihydrouridine synthase; TIM barrel, oxidored | 97.62 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 97.61 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 97.58 | |
| 1w0m_A | 226 | TIM, triosephosphate isomerase; glycolysis, glucon | 97.56 | |
| 1z41_A | 338 | YQJM, probable NADH-dependent flavin oxidoreductas | 97.55 | |
| 1f76_A | 336 | Dihydroorotate dehydrogenase; monomer, alpha-beta- | 97.54 | |
| 3gr7_A | 340 | NADPH dehydrogenase; flavin, FMN, beta-alpha-barre | 97.53 | |
| 3i65_A | 415 | Dihydroorotate dehydrogenase homolog, mitochondria | 97.5 | |
| 3ffs_A | 400 | Inosine-5-monophosphate dehydrogenase; beta-alpha | 97.49 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 97.47 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 97.47 | |
| 1eep_A | 404 | Inosine 5'-monophosphate dehydrogenase; alpha-beta | 97.46 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 97.46 | |
| 2f6u_A | 234 | GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy | 97.45 | |
| 3hgj_A | 349 | Chromate reductase; TIM barrel, oxidoreductase; HE | 97.44 | |
| 3eww_A | 260 | Ompdecase, orotidine-5'-phosphate decarboxylase; T | 97.43 | |
| 1vhn_A | 318 | Putative flavin oxidoreducatase; structural genomi | 97.43 | |
| 1tv5_A | 443 | Dhodehase, dihydroorotate dehydrogenase homolog, m | 97.42 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.42 | |
| 2gou_A | 365 | Oxidoreductase, FMN-binding; OLD yeallow enzyme, f | 97.41 | |
| 3vk5_A | 286 | MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S | 97.38 | |
| 1hg3_A | 225 | Triosephosphate isomerase; thermostability, tetram | 97.37 | |
| 2r14_A | 377 | Morphinone reductase; H-tunnelling, flavoprotein, | 97.36 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 97.35 | |
| 1gox_A | 370 | (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu | 97.34 | |
| 3qw3_A | 255 | Orotidine-5-phosphate decarboxylase/orotate phosph | 97.33 | |
| 2agk_A | 260 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 97.33 | |
| 1vyr_A | 364 | Pentaerythritol tetranitrate reductase; oxidoreduc | 97.31 | |
| 1viz_A | 240 | PCRB protein homolog; structural genomics, unknown | 97.31 | |
| 3tjx_A | 354 | Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh | 97.3 | |
| 1pii_A | 452 | N-(5'phosphoribosyl)anthranilate isomerase; bifunc | 97.29 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 97.28 | |
| 2i1o_A | 398 | Nicotinate phosphoribosyltransferase; ZIN ION, zin | 97.27 | |
| 3aty_A | 379 | Tcoye, prostaglandin F2A synthase; alpha/beta barr | 97.24 | |
| 2fds_A | 352 | Orotidine-monophosphate-decarboxylase; TIM barrel, | 97.24 | |
| 2agk_A | 260 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 97.23 | |
| 4gj1_A | 243 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 97.21 | |
| 3l5l_A | 363 | Xenobiotic reductase A; TIM barrel, oxidoreductase | 97.17 | |
| 1vcf_A | 332 | Isopentenyl-diphosphate delta-isomerase; TIM barre | 97.16 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 97.14 | |
| 1v5x_A | 203 | PRA isomerase, phosphoribosylanthranilate isomeras | 97.13 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 97.13 | |
| 1jvn_A | 555 | Glutamine, bifunctional histidine biosynthesis pro | 97.12 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 97.08 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 97.05 | |
| 2c6q_A | 351 | GMP reductase 2; TIM barrel, metal-binding, NADP, | 97.02 | |
| 3gka_A | 361 | N-ethylmaleimide reductase; decode biostructures, | 96.97 | |
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 96.97 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 96.96 | |
| 1nsj_A | 205 | PRAI, phosphoribosyl anthranilate isomerase; therm | 96.89 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 96.86 | |
| 3qw4_B | 453 | UMP synthase; N-terminal orotidine monophosphate d | 96.85 | |
| 2ffc_A | 353 | Orotidine 5-monophosphate decarboxylase; PV-PF10_0 | 96.83 | |
| 3kru_A | 343 | NADH:flavin oxidoreductase/NADH oxidase; homotetra | 96.83 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 96.79 | |
| 2p10_A | 286 | MLL9387 protein; putative phosphonopyruvate hydrol | 96.79 | |
| 4ab4_A | 362 | Xenobiotic reductase B; oxidoreductase, OLD yellow | 96.76 | |
| 2yxb_A | 161 | Coenzyme B12-dependent mutase; alpha/beta, structu | 96.73 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 96.72 | |
| 4a29_A | 258 | Engineered retro-aldol enzyme RA95.0; de novo prot | 96.72 | |
| 3g3d_A | 312 | UMP synthase, uridine 5'-monophosphate synthase; C | 96.71 | |
| 2hsa_B | 402 | 12-oxophytodienoate reductase 3; alpha beta 8 barr | 96.7 | |
| 1ypf_A | 336 | GMP reductase; GUAC, purines, pyrimidines, nucleos | 96.7 | |
| 4aaj_A | 228 | N-(5'-phosphoribosyl)anthranilate isomerase; alpha | 96.69 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 96.68 | |
| 1twd_A | 256 | Copper homeostasis protein CUTC; TIM-like protein, | 96.63 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 96.59 | |
| 1icp_A | 376 | OPR1, 12-oxophytodienoate reductase 1; beta-alpha- | 96.56 | |
| 2bdq_A | 224 | Copper homeostasis protein CUTC; alpha beta protei | 96.55 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 96.55 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 96.5 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 96.41 | |
| 3gdm_A | 267 | Orotidine 5'-phosphate decarboxylase; orotidine 5' | 96.25 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 96.21 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 96.19 | |
| 2i14_A | 395 | Nicotinate-nucleotide pyrophosphorylase; ligand bi | 96.17 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 96.08 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 95.98 | |
| 3l5a_A | 419 | NADH/flavin oxidoreductase/NADH oxidase; OLD yello | 95.97 | |
| 2fli_A | 220 | Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr | 95.92 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 95.81 | |
| 3f4w_A | 211 | Putative hexulose 6 phosphate synthase; humps, mal | 95.75 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 95.71 | |
| 1vc4_A | 254 | Indole-3-glycerol phosphate synthase; lyase, trypt | 95.61 | |
| 3n3m_A | 342 | Orotidine 5'-phosphate decarboxylase; P. falciparu | 95.6 | |
| 4fo4_A | 366 | Inosine 5'-monophosphate dehydrogenase; structural | 95.53 | |
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 95.51 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 95.5 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 95.46 | |
| 1eep_A | 404 | Inosine 5'-monophosphate dehydrogenase; alpha-beta | 95.25 | |
| 3kts_A | 192 | Glycerol uptake operon antiterminator regulatory; | 95.19 | |
| 1pii_A | 452 | N-(5'phosphoribosyl)anthranilate isomerase; bifunc | 95.11 | |
| 1geq_A | 248 | Tryptophan synthase alpha-subunit; hyperthermophIl | 95.07 | |
| 3ffs_A | 400 | Inosine-5-monophosphate dehydrogenase; beta-alpha | 94.96 | |
| 1ccw_A | 137 | Protein (glutamate mutase); coenzyme B12, radical | 94.95 | |
| 3khj_A | 361 | Inosine-5-monophosphate dehydrogenase; enzyme-inhi | 94.85 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 94.82 | |
| 2c6q_A | 351 | GMP reductase 2; TIM barrel, metal-binding, NADP, | 94.61 | |
| 2jgq_A | 233 | Triosephosphate isomerase; glycolysis, pentose shu | 94.49 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 94.48 | |
| 1o94_A | 729 | Tmadh, trimethylamine dehydrogenase; electron tran | 94.48 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 94.36 | |
| 1yya_A | 250 | Triosephosphate isomerase; riken structural genomi | 94.31 | |
| 3sy1_A | 245 | UPF0001 protein YGGS; engineered protein, structur | 94.17 | |
| 4a3u_A | 358 | NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET | 94.17 | |
| 2j27_A | 250 | Triosephosphate isomerase glycosomal; TIM, 2PG, LO | 94.15 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 94.1 | |
| 2yc6_A | 257 | Triosephosphate isomerase; glycolysis; HET: PGA; 1 | 93.92 | |
| 2btm_A | 252 | TIM, protein (triosephosphate isomerase); thermoph | 93.9 | |
| 1o5x_A | 248 | TIM, triosephosphate isomerase; 2- phosphoglycerat | 93.89 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 93.85 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 93.85 | |
| 1aw2_A | 256 | Triosephosphate isomerase; psychrophilic, vibrio m | 93.69 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 93.58 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 93.55 | |
| 3fok_A | 307 | Uncharacterized protein CGL0159; CGL0159 ,brevibac | 93.5 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 93.49 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 93.38 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 93.29 | |
| 1rpx_A | 230 | Protein (ribulose-phosphate 3-epimerase); chloropl | 93.08 | |
| 2uva_G | 2060 | Fatty acid synthase beta subunits; fungal, dehydra | 92.99 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 92.92 | |
| 1tre_A | 255 | Triosephosphate isomerase; intramolecular oxidored | 92.9 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 92.86 | |
| 1mzh_A | 225 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 92.72 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 92.7 | |
| 2f7f_A | 494 | Nicotinate phosphoribosyltransferase, putative; st | 92.57 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 92.4 | |
| 1ub3_A | 220 | Aldolase protein; schiff base, deoxyribose phospha | 92.37 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 92.26 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 92.05 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 91.86 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 91.8 | |
| 1ea0_A | 1479 | Glutamate synthase [NADPH] large chain; oxidoreduc | 91.77 | |
| 2xij_A | 762 | Methylmalonyl-COA mutase, mitochondrial; isomerase | 91.6 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 91.6 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 91.59 | |
| 3oa3_A | 288 | Aldolase; structural genomics, seattle structural | 91.48 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 91.36 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 91.36 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 91.3 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 91.23 | |
| 3tjl_A | 407 | NADPH dehydrogenase; OLD yellow enzyme, flavin mon | 91.2 | |
| 4adt_A | 297 | Pyridoxine biosynthetic enzyme PDX1 homologue, PU; | 91.07 | |
| 1y80_A | 210 | Predicted cobalamin binding protein; corrinoid, fa | 91.02 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 90.99 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 90.94 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 90.9 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 90.85 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 90.84 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 90.78 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 90.66 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 90.66 | |
| 2i2x_B | 258 | MTAC, methyltransferase 1; TIM barrel and helix bu | 90.65 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 90.61 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 90.58 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 90.56 | |
| 3ezx_A | 215 | MMCP 1, monomethylamine corrinoid protein 1; N ter | 90.51 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 90.37 | |
| 1b9b_A | 255 | TIM, protein (triosephosphate isomerase); thermoph | 90.33 | |
| 1vkf_A | 188 | Glycerol uptake operon antiterminator-related Pro; | 90.22 | |
| 2vp8_A | 318 | Dihydropteroate synthase 2; RV1207 transferase, fo | 90.03 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 90.02 | |
| 2ekc_A | 262 | AQ_1548, tryptophan synthase alpha chain; structur | 89.89 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 89.75 | |
| 1ct5_A | 256 | Protein (yeast hypothetical protein, selenoMet); T | 89.64 | |
| 1ofd_A | 1520 | Ferredoxin-dependent glutamate synthase 2; oxidore | 89.6 | |
| 1mo0_A | 275 | TIM, triosephosphate isomerase; structural genomic | 89.54 | |
| 3r79_A | 244 | Uncharacterized protein; PSI-biology, structural g | 89.51 | |
| 1ypf_A | 336 | GMP reductase; GUAC, purines, pyrimidines, nucleos | 89.49 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 89.42 | |
| 3m9y_A | 254 | Triosephosphate isomerase; TIM barrel, glycolysis, | 89.28 | |
| 1req_A | 727 | Methylmalonyl-COA mutase; isomerase, intramolecula | 89.28 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 89.2 | |
| 1tx2_A | 297 | DHPS, dihydropteroate synthase; folate biosynthesi | 89.04 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 89.0 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 88.96 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 88.86 | |
| 2i9e_A | 259 | Triosephosphate isomerase; 2.00A {Tenebrio molitor | 88.75 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 88.67 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 88.63 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 88.59 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 88.53 | |
| 1h7n_A | 342 | 5-aminolaevulinic acid dehydratase; lyase, aldolas | 88.48 | |
| 2vxn_A | 251 | Triosephosphate isomerase; fatty acid biosynthesis | 88.47 | |
| 1n7k_A | 234 | Deoxyribose-phosphate aldolase; A.pernix, tetramer | 88.41 | |
| 3ajx_A | 207 | 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf | 88.29 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 88.23 | |
| 3r0j_A | 250 | Possible two component system response transcript | 88.17 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 88.11 | |
| 3lab_A | 217 | Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) | 87.95 | |
| 1pv8_A | 330 | Delta-aminolevulinic acid dehydratase; porphobilin | 87.79 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 87.64 | |
| 1yxy_A | 234 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 87.55 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 87.5 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 87.18 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 87.18 | |
| 1nvm_A | 345 | HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered | 87.18 | |
| 3ndo_A | 231 | Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid | 87.14 | |
| 1vhc_A | 224 | Putative KHG/KDPG aldolase; structural genomics, u | 86.99 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 86.9 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 86.88 | |
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 86.85 | |
| 1qop_A | 268 | Tryptophan synthase alpha chain; lyase, carbon-oxy | 86.73 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 86.62 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 86.54 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 86.34 | |
| 1wbh_A | 214 | KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} | 86.25 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 86.08 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 86.0 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 85.93 | |
| 3vnd_A | 267 | TSA, tryptophan synthase alpha chain; psychrophili | 85.93 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 85.85 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 85.84 | |
| 4gbu_A | 400 | NADPH dehydrogenase 1; alpha/beta barrel, enenone | 85.53 | |
| 1y0e_A | 223 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 85.49 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 85.42 | |
| 2nv1_A | 305 | Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b | 85.25 | |
| 1r2r_A | 248 | TIM, triosephosphate isomerase; closed loop confor | 85.21 | |
| 3krs_A | 271 | Triosephosphate isomerase; ssgcid, SBRI, emerald b | 85.18 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 85.17 | |
| 3jr2_A | 218 | Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon | 85.15 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 85.0 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 84.73 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 84.72 | |
| 3nav_A | 271 | Tryptophan synthase alpha chain; alpha subunit, st | 84.71 | |
| 3r12_A | 260 | Deoxyribose-phosphate aldolase; TIM beta/alpha-bar | 84.7 | |
| 4e38_A | 232 | Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho | 84.7 | |
| 1ney_A | 247 | TIM, triosephosphate isomerase; yeast, DHAP, dihyd | 84.62 | |
| 2csu_A | 457 | 457AA long hypothetical protein; structural genomi | 84.46 | |
| 2dqw_A | 294 | Dihydropteroate synthase; dimer, structural genomi | 84.41 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 84.38 | |
| 1viz_A | 240 | PCRB protein homolog; structural genomics, unknown | 84.28 | |
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 84.08 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 84.0 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 83.85 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 83.72 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 83.63 | |
| 1m6j_A | 261 | TIM, TPI, triosephosphate isomerase; asymmetry, mo | 83.56 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 83.31 | |
| 2v82_A | 212 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l | 83.22 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 83.13 | |
| 2f6u_A | 234 | GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy | 82.85 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 82.84 | |
| 1ujp_A | 271 | Tryptophan synthase alpha chain; riken structural | 82.76 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 82.74 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 82.69 | |
| 3ngj_A | 239 | Deoxyribose-phosphate aldolase; lyase, structural | 82.58 | |
| 3qst_A | 255 | Triosephosphate isomerase, putative; TIM barrel; 1 | 81.62 | |
| 2uv8_G | 2051 | Fatty acid synthase subunit beta (FAS1); fatty aci | 81.46 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 81.41 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 81.35 | |
| 3na8_A | 315 | Putative dihydrodipicolinate synthetase; lyase; HE | 81.3 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 81.28 | |
| 3s6d_A | 310 | Putative triosephosphate isomerase; seattle struct | 81.14 | |
| 1mxs_A | 225 | KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a | 81.13 | |
| 3to5_A | 134 | CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p | 81.08 | |
| 1tqj_A | 230 | Ribulose-phosphate 3-epimerase; beta-alpha barrel | 80.98 | |
| 1dxe_A | 256 | 2-dehydro-3-deoxy-galactarate aldolase; class II a | 80.83 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 80.48 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 80.46 | |
| 3l21_A | 304 | DHDPS, dihydrodipicolinate synthase; DAPA, dimer, | 80.45 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 80.2 | |
| 3qz6_A | 261 | HPCH/HPAI aldolase; structural genomics, PSI-biolo | 80.19 | |
| 3hl2_A | 501 | O-phosphoseryl-tRNA(SEC) selenium transferase; sel | 80.05 |
| >1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-32 Score=204.81 Aligned_cols=111 Identities=50% Similarity=0.804 Sum_probs=104.1
Q ss_pred CceEEEecCCCCHHhHHHhHhCCC--CCCEEEEEeeeCCCCCcccchhHHHHHHHHHhhCCCCcEEEEcCCChhhHHHHH
Q 033598 1 MRPGVALKPGTSVEEVYPLVEGAN--PVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPSLDIEVDGGLGPSTIAEAA 78 (115)
Q Consensus 1 ~k~Glal~p~t~~~~~~~~~~~~~--~vD~vlvm~v~pG~~gq~~~~~~~~ki~~l~~~~~~~~i~~dGGI~~~ni~~l~ 78 (115)
+|+|+++||+||++.+++++ + .+|+|++|+|+|||+||+|.+..++|++++|++.++++|+||||||.+|++++.
T Consensus 115 ~k~gvalnp~tp~~~~~~~l---~~g~~D~VlvmsV~pGf~gq~f~~~~l~ki~~lr~~~~~~~I~VdGGI~~~ti~~~~ 191 (227)
T 1tqx_A 115 LWCGISIKPKTDVQKLVPIL---DTNLINTVLVMTVEPGFGGQSFMHDMMGKVSFLRKKYKNLNIQVDGGLNIETTEISA 191 (227)
T ss_dssp CEEEEEECTTSCGGGGHHHH---TTTCCSEEEEESSCTTCSSCCCCGGGHHHHHHHHHHCTTCEEEEESSCCHHHHHHHH
T ss_pred CeEEEEeCCCCcHHHHHHHh---hcCCcCEEEEeeeccCCCCcccchHHHHHHHHHHHhccCCeEEEECCCCHHHHHHHH
Confidence 58999999999999999999 8 899999999999999999999999999999998778999999999999999999
Q ss_pred HcCCCEEEEcccccCCCCHHHHHHHHHHHHHHHhhc
Q 033598 79 SAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKN 114 (115)
Q Consensus 79 ~~Gad~iv~Gsaif~~~d~~~~~~~l~~~~~~~~~~ 114 (115)
++|||++|+||+||+++||++++++|++.+++.++|
T Consensus 192 ~aGAd~~V~GsaIf~~~d~~~~i~~l~~~~~~~~~~ 227 (227)
T 1tqx_A 192 SHGANIIVAGTSIFNAEDPKYVIDTMRVSVQKYLNN 227 (227)
T ss_dssp HHTCCEEEESHHHHTCSSHHHHHHHHHHHHHHC---
T ss_pred HcCCCEEEEeHHHhCCCCHHHHHHHHHHHHHHHhcC
Confidence 999999999999999999999999999988877654
|
| >3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A | Back alignment and structure |
|---|
| >3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* | Back alignment and structure |
|---|
| >3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} | Back alignment and structure |
|---|
| >1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A | Back alignment and structure |
|---|
| >1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* | Back alignment and structure |
|---|
| >2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* | Back alignment and structure |
|---|
| >3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} | Back alignment and structure |
|---|
| >2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* | Back alignment and structure |
|---|
| >3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A | Back alignment and structure |
|---|
| >1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* | Back alignment and structure |
|---|
| >1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A | Back alignment and structure |
|---|
| >1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A | Back alignment and structure |
|---|
| >2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* | Back alignment and structure |
|---|
| >1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 | Back alignment and structure |
|---|
| >1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* | Back alignment and structure |
|---|
| >1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 | Back alignment and structure |
|---|
| >1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A | Back alignment and structure |
|---|
| >1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... | Back alignment and structure |
|---|
| >3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* | Back alignment and structure |
|---|
| >2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* | Back alignment and structure |
|---|
| >1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A | Back alignment and structure |
|---|
| >1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A | Back alignment and structure |
|---|
| >3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A | Back alignment and structure |
|---|
| >1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... | Back alignment and structure |
|---|
| >4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A | Back alignment and structure |
|---|
| >2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A | Back alignment and structure |
|---|
| >2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A | Back alignment and structure |
|---|
| >2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* | Back alignment and structure |
|---|
| >2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* | Back alignment and structure |
|---|
| >2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A | Back alignment and structure |
|---|
| >1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A | Back alignment and structure |
|---|
| >3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* | Back alignment and structure |
|---|
| >1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A | Back alignment and structure |
|---|
| >1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* | Back alignment and structure |
|---|
| >4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* | Back alignment and structure |
|---|
| >3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} | Back alignment and structure |
|---|
| >1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 | Back alignment and structure |
|---|
| >4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* | Back alignment and structure |
|---|
| >1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* | Back alignment and structure |
|---|
| >2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} | Back alignment and structure |
|---|
| >3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* | Back alignment and structure |
|---|
| >3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* | Back alignment and structure |
|---|
| >1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* | Back alignment and structure |
|---|
| >3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O | Back alignment and structure |
|---|
| >3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A | Back alignment and structure |
|---|
| >3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} | Back alignment and structure |
|---|
| >4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A | Back alignment and structure |
|---|
| >4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A | Back alignment and structure |
|---|
| >3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... | Back alignment and structure |
|---|
| >3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A | Back alignment and structure |
|---|
| >3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A | Back alignment and structure |
|---|
| >3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* | Back alignment and structure |
|---|
| >1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* | Back alignment and structure |
|---|
| >3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* | Back alignment and structure |
|---|
| >3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* | Back alignment and structure |
|---|
| >1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* | Back alignment and structure |
|---|
| >3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* | Back alignment and structure |
|---|
| >3eww_A Ompdecase, orotidine-5'-phosphate decarboxylase; TIM barrel, unusual catalysis, disease mutati glycosyltransferase, lyase, multifunctional enzyme; HET: U1P; 1.10A {Homo sapiens} PDB: 2qcl_A* 2qcm_A* 3ewu_A* 2qcf_A* 3ex6_A* 3ex4_A* 2qcd_A* 2qcc_A 2qcg_A* 2qch_A* 2qcn_A* 2qce_A* 3ewz_A* 3ex1_A* 3ex2_A* 3ex3_A* 3ex0_A* 3ex5_A* 3l0k_A* 3l0n_A* ... | Back alignment and structure |
|---|
| >1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* | Back alignment and structure |
|---|
| >3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* | Back alignment and structure |
|---|
| >1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 | Back alignment and structure |
|---|
| >3qw3_A Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltransferase, putative (OMPDCASE-OPRTASE,...; orotidine monophosphate decarboxylase; 1.70A {Leishmania infantum} | Back alignment and structure |
|---|
| >2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... | Back alignment and structure |
|---|
| >1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* | Back alignment and structure |
|---|
| >1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger M structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A | Back alignment and structure |
|---|
| >3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* | Back alignment and structure |
|---|
| >2fds_A Orotidine-monophosphate-decarboxylase; TIM barrel, structural genomics, structural genomics consortium, SGC, unknown function; 1.72A {Plasmodium berghei} SCOP: c.1.2.3 PDB: 2aqw_A | Back alignment and structure |
|---|
| >2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* | Back alignment and structure |
|---|
| >1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* | Back alignment and structure |
|---|
| >3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 | Back alignment and structure |
|---|
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} | Back alignment and structure |
|---|
| >2ffc_A Orotidine 5-monophosphate decarboxylase; PV-PF10_0225, SGC, structural genomics, struc genomics consortium, lyase; HET: U5P; 1.70A {Plasmodium vivax} SCOP: c.1.2.3 PDB: 2guu_A* | Back alignment and structure |
|---|
| >3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 | Back alignment and structure |
|---|
| >4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* | Back alignment and structure |
|---|
| >4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... | Back alignment and structure |
|---|
| >3g3d_A UMP synthase, uridine 5'-monophosphate synthase; C-terminal domain, orotidine 5'-monophosphate decarboxylase, human, 5-fluoro-6-azido-UMP; HET: 5FU; 1.70A {Homo sapiens} PDB: 3bvj_A* 3mw7_A* 4hib_A* 4hkp_A* 2p1f_A 2eaw_A 3bgg_A* 3bgj_A* | Back alignment and structure |
|---|
| >2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* | Back alignment and structure |
|---|
| >1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* | Back alignment and structure |
|---|
| >4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* | Back alignment and structure |
|---|
| >1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* | Back alignment and structure |
|---|
| >2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3gdm_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, K93R mutant, lyase, phosphoprotein; 1.60A {Saccharomyces cerevisiae} SCOP: c.1.2.3 PDB: 3gdl_A* 3gdk_A* 3gdt_A* 3gdr_A* 1dqw_A 1dqx_A* | Back alignment and structure |
|---|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2i14_A Nicotinate-nucleotide pyrophosphorylase; ligand binding, phosphoribosylpyrophosphate, Zn metal ION, structural genomics, PSI; HET: PCP; 2.90A {Pyrococcus furiosus} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >3n3m_A Orotidine 5'-phosphate decarboxylase; P. falciparum, 5'-monophosphate decarboxylase, 6- UMP, lyase; HET: PGE NUP; 1.47A {Plasmodium falciparum} SCOP: c.1.2.3 PDB: 2qaf_A* 3bar_A* 2q8z_A* 3mwa_A* 3n2m_A* 3bpw_A* 3n34_A* 3s9y_A* 2f84_A 2q8l_A 2za1_A* 2za2_A 2za3_A* 2zcg_A 3vi2_A* | Back alignment and structure |
|---|
| >4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A | Back alignment and structure |
|---|
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A | Back alignment and structure |
|---|
| >1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A | Back alignment and structure |
|---|
| >3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* | Back alignment and structure |
|---|
| >3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* | Back alignment and structure |
|---|
| >2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3sy1_A UPF0001 protein YGGS; engineered protein, structural genomics, PSI-biology, protei structure initiative; HET: MES; 1.47A {Escherichia coli} PDB: 1w8g_A* | Back alignment and structure |
|---|
| >4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} | Back alignment and structure |
|---|
| >2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A | Back alignment and structure |
|---|
| >2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A | Back alignment and structure |
|---|
| >1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} | Back alignment and structure |
|---|
| >1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >2f7f_A Nicotinate phosphoribosyltransferase, putative; structural genomics, PSI; 2.00A {Enterococcus faecalis} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* | Back alignment and structure |
|---|
| >2xij_A Methylmalonyl-COA mutase, mitochondrial; isomerase, organic aciduria, vitamin B12; HET: B12 5AD BTB; 1.95A {Homo sapiens} PDB: 2xiq_A* 3bic_A | Back alignment and structure |
|---|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* | Back alignment and structure |
|---|
| >4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A | Back alignment and structure |
|---|
| >1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* | Back alignment and structure |
|---|
| >2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A | Back alignment and structure |
|---|
| >3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 | Back alignment and structure |
|---|
| >2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} | Back alignment and structure |
|---|
| >2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1ct5_A Protein (yeast hypothetical protein, selenoMet); TIM barrel, pyridoxal-5'-phosphate, selenomethionine, structural genomics, PSI; HET: PLP; 2.00A {Saccharomyces cerevisiae} SCOP: c.1.6.2 PDB: 1b54_A* | Back alignment and structure |
|---|
| >1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* | Back alignment and structure |
|---|
| >1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >3r79_A Uncharacterized protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium, TIM barrel; HET: PLP; 1.90A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} SCOP: c.1.1.1 PDB: 3uwv_A* 3uwu_A* 3uww_A* 3uwy_A 3uwz_A* | Back alignment and structure |
|---|
| >1req_A Methylmalonyl-COA mutase; isomerase, intramolecular transferase; HET: B12 DCA; 2.00A {Propionibacterium freudenreichii subspshermanii} SCOP: c.1.19.1 c.23.6.1 PDB: 2req_A* 3req_A* 4req_A* 6req_A* 7req_A* 5req_A* 1e1c_A* | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B | Back alignment and structure |
|---|
| >1h7n_A 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae} SCOP: c.1.10.3 PDB: 1h7p_A* 1h7r_A* 1ohl_A* 1qml_A 1qnv_A 1w31_A* 1h7o_A* 1eb3_A* 1gjp_A* 1ylv_A* 1aw5_A | Back alignment and structure |
|---|
| >2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* | Back alignment and structure |
|---|
| >1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} | Back alignment and structure |
|---|
| >1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 | Back alignment and structure |
|---|
| >3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A | Back alignment and structure |
|---|
| >1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} | Back alignment and structure |
|---|
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* | Back alignment and structure |
|---|
| >1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A | Back alignment and structure |
|---|
| >1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* | Back alignment and structure |
|---|
| >1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A | Back alignment and structure |
|---|
| >1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... | Back alignment and structure |
|---|
| >3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* | Back alignment and structure |
|---|
| >3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* | Back alignment and structure |
|---|
| >4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} | Back alignment and structure |
|---|
| >1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* | Back alignment and structure |
|---|
| >2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 | Back alignment and structure |
|---|
| >2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* | Back alignment and structure |
|---|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* | Back alignment and structure |
|---|
| >1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A | Back alignment and structure |
|---|
| >2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3s6d_A Putative triosephosphate isomerase; seattle structural genomics center for infectious disease, S pathogenic fungus, eukaryote; 2.20A {Coccidioides immitis RS} | Back alignment and structure |
|---|
| >1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 | Back alignment and structure |
|---|
| >1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A | Back alignment and structure |
|---|
| >3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A | Back alignment and structure |
|---|
| >3qz6_A HPCH/HPAI aldolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.00A {Desulfitobacterium hafniense} SCOP: c.1.12.0 | Back alignment and structure |
|---|
| >3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 115 | ||||
| d1h1ya_ | 220 | c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {R | 1e-29 | |
| d1rpxa_ | 230 | c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {P | 7e-29 | |
| d1tqja_ | 221 | c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {S | 5e-27 | |
| d1tqxa_ | 221 | c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {P | 2e-24 | |
| d2flia1 | 217 | c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimera | 4e-23 | |
| d1q6oa_ | 213 | c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarbo | 4e-22 | |
| d2czda1 | 206 | c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decar | 4e-07 | |
| d1km4a_ | 212 | c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxyl | 1e-04 | |
| d1dbta_ | 237 | c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxyl | 2e-04 | |
| d1o4ua1 | 170 | c.1.17.1 (A:104-273) Quinolinic acid phosphoribosy | 4e-04 | |
| d1eixa_ | 231 | c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxyl | 0.002 |
| >d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Length = 220 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: Ribulose-phoshate binding barrel family: D-ribulose-5-phosphate 3-epimerase domain: D-ribulose-5-phosphate 3-epimerase species: Rice (Oryza sativa) [TaxId: 4530]
Score = 104 bits (259), Expect = 1e-29
Identities = 91/112 (81%), Positives = 101/112 (90%)
Query: 1 MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60
MRPGV+L+PGT VEEV+PLVE NPVE+VLVMTVEPGFGGQKFMPEMM+KVR+LR +YPS
Sbjct: 109 MRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPS 168
Query: 61 LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQ 112
LDIEVDGGLGPSTI AASAGANCIVAGSS+FGA EP VIS +RKSVE +Q
Sbjct: 169 LDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGSQ 220
|
| >d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 230 | Back information, alignment and structure |
|---|
| >d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 221 | Back information, alignment and structure |
|---|
| >d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Length = 221 | Back information, alignment and structure |
|---|
| >d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Length = 217 | Back information, alignment and structure |
|---|
| >d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Length = 213 | Back information, alignment and structure |
|---|
| >d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Length = 206 | Back information, alignment and structure |
|---|
| >d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 212 | Back information, alignment and structure |
|---|
| >d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Length = 237 | Back information, alignment and structure |
|---|
| >d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 170 | Back information, alignment and structure |
|---|
| >d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Length = 231 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 115 | |||
| d1h1ya_ | 220 | D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa | 100.0 | |
| d1tqxa_ | 221 | D-ribulose-5-phosphate 3-epimerase {Plasmodium fal | 100.0 | |
| d1rpxa_ | 230 | D-ribulose-5-phosphate 3-epimerase {Potato (Solanu | 99.98 | |
| d2flia1 | 217 | D-ribulose-5-phosphate 3-epimerase {Streptococcus | 99.97 | |
| d1tqja_ | 221 | D-ribulose-5-phosphate 3-epimerase {Synechocystis | 99.97 | |
| d1q6oa_ | 213 | 3-keto-L-gulonate 6-phosphate decarboxylase {Esche | 99.69 | |
| d1xi3a_ | 206 | Thiamin phosphate synthase {Archaeon (Pyrococcus f | 99.68 | |
| d2tpsa_ | 226 | Thiamin phosphate synthase {Bacillus subtilis [Tax | 99.58 | |
| d1y0ea_ | 222 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 98.88 | |
| d1w0ma_ | 226 | Triosephosphate isomerase {Thermoproteus tenax [Ta | 98.88 | |
| d1qpoa1 | 169 | Quinolinic acid phosphoribosyltransferase (Nicotin | 98.83 | |
| d1o4ua1 | 170 | Quinolinic acid phosphoribosyltransferase (Nicotin | 98.8 | |
| d1yxya1 | 230 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 98.74 | |
| d2czda1 | 206 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 98.74 | |
| d1wa3a1 | 202 | KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | 98.53 | |
| d1qapa1 | 167 | Quinolinic acid phosphoribosyltransferase (Nicotin | 98.47 | |
| d1rd5a_ | 261 | Trp synthase alpha-subunit {Maize (Zea mays) [TaxI | 98.45 | |
| d1km4a_ | 212 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 98.42 | |
| d1dbta_ | 237 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 98.26 | |
| d1qopa_ | 267 | Trp synthase alpha-subunit {Salmonella typhimurium | 98.24 | |
| d1eixa_ | 231 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 98.19 | |
| d1hg3a_ | 224 | Triosephosphate isomerase {Archaeon Pyrococcus woe | 98.15 | |
| d1gtea2 | 312 | Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su | 98.15 | |
| d1znna1 | 254 | Pyridoxal biosynthesis lyase PdxS {Bacillus stearo | 98.13 | |
| d1geqa_ | 248 | Trp synthase alpha-subunit {Archaeon Pyrococcus fu | 98.1 | |
| d1vhca_ | 212 | Hypothetical protein HI0047 {Haemophilus influenza | 98.08 | |
| d1wbha1 | 213 | KDPG aldolase {Escherichia coli [TaxId: 562]} | 98.02 | |
| d1wv2a_ | 243 | Thiazole biosynthesis protein ThiG {Pseudomonas ae | 97.89 | |
| d1mxsa_ | 216 | KDPG aldolase {Pseudomonas putida [TaxId: 303]} | 97.66 | |
| d1ujpa_ | 271 | Trp synthase alpha-subunit {Thermus thermophilus [ | 97.66 | |
| d1h5ya_ | 252 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.56 | |
| d1thfd_ | 253 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.52 | |
| d1ka9f_ | 251 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.5 | |
| d1xm3a_ | 251 | Thiazole biosynthesis protein ThiG {Bacillus subti | 97.47 | |
| d2b4ga1 | 312 | Dihydroorotate dehydrogenase {Trypanosoma brucei [ | 97.47 | |
| d1thfd_ | 253 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.43 | |
| d1h5ya_ | 252 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.34 | |
| d1viza_ | 229 | PcrB protein homolog YerE {Bacillus subtilis [TaxI | 97.33 | |
| d1ep3a_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 97.27 | |
| d1ka9f_ | 251 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.22 | |
| d1jvna1 | 323 | Cyclase subunit (or domain) of imidazoleglycerolph | 97.21 | |
| d1juba_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 97.19 | |
| d1qo2a_ | 241 | Phosphoribosylformimino-5-aminoimidazole carboxami | 97.13 | |
| d1i4na_ | 251 | Indole-3-glycerophosphate synthase, IPGS {Thermoto | 97.01 | |
| d1dqwa_ | 267 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 97.0 | |
| d2f6ua1 | 231 | (S)-3-O-geranylgeranylglyceryl phosphate synthase | 96.92 | |
| d1vqta1 | 198 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 96.87 | |
| d1f76a_ | 336 | Dihydroorotate dehydrogenase {Escherichia coli [Ta | 96.85 | |
| d1twda_ | 247 | Copper homeostasis protein CutC {Shigella flexneri | 96.82 | |
| d1d3ga_ | 367 | Dihydroorotate dehydrogenase {Human (Homo sapiens) | 96.81 | |
| d1vzwa1 | 239 | Phosphoribosylformimino-5-aminoimidazole carboxami | 96.77 | |
| d1vc4a_ | 254 | Indole-3-glycerophosphate synthase, IPGS {Thermus | 96.68 | |
| d1tv5a1 | 409 | Dihydroorotate dehydrogenase {Plasmodium falciparu | 96.67 | |
| d1vzwa1 | 239 | Phosphoribosylformimino-5-aminoimidazole carboxami | 96.66 | |
| d1z41a1 | 337 | NADPH dehydrogenase NamA {Bacillus subtilis [TaxId | 96.65 | |
| d1ojxa_ | 251 | Archaeal fructose 1,6-bisphosphate aldolase {Archa | 96.63 | |
| d1piia2 | 254 | Indole-3-glycerophosphate synthase, IPGS {Escheric | 96.51 | |
| d1qo2a_ | 241 | Phosphoribosylformimino-5-aminoimidazole carboxami | 96.46 | |
| d1piia1 | 198 | N-(5'phosphoribosyl)antranilate isomerase, PRAI {E | 96.32 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 96.27 | |
| d1eepa_ | 388 | Inosine monophosphate dehydrogenase (IMPDH) {Lyme | 96.26 | |
| d2ffca1 | 332 | Orotidine 5'-monophosphate decarboxylase (OMP deca | 96.16 | |
| d1p0ka_ | 329 | Isopentenyl-diphosphate delta-isomerase {Bacillus | 96.03 | |
| d1ccwa_ | 137 | Glutamate mutase, small subunit {Clostridium cochl | 95.89 | |
| d1ps9a1 | 330 | 2,4-dienoyl-CoA reductase, N-terminal domain {Esch | 95.82 | |
| d1vcfa1 | 310 | Isopentenyl-diphosphate delta-isomerase {Thermus t | 95.75 | |
| d1a53a_ | 247 | Indole-3-glycerophosphate synthase, IPGS {Archaeon | 95.71 | |
| d1icpa_ | 364 | 12-oxophytodienoate reductase (OPR, OYE homolog) { | 95.58 | |
| d2q8za1 | 323 | Protozoan orotidine monophosphate decarboxylase {P | 95.51 | |
| d1vyra_ | 363 | Pentaerythritol tetranirate reductase {Enterobacte | 95.41 | |
| d1vrda1 | 330 | Inosine monophosphate dehydrogenase (IMPDH) {Therm | 95.37 | |
| d1nsja_ | 205 | N-(5'phosphoribosyl)antranilate isomerase, PRAI {T | 95.33 | |
| d1gwja_ | 374 | Morphinone reductase {Pseudomonas putida [TaxId: 3 | 95.25 | |
| d1jr1a1 | 378 | Inosine monophosphate dehydrogenase (IMPDH) {Chine | 95.22 | |
| d1djqa1 | 340 | Trimethylamine dehydrogenase, N-terminal domain {M | 95.22 | |
| d1v5xa_ | 200 | N-(5'phosphoribosyl)antranilate isomerase, PRAI {T | 95.16 | |
| d1vrda1 | 330 | Inosine monophosphate dehydrogenase (IMPDH) {Therm | 95.1 | |
| d2csua3 | 163 | Acetate-CoA ligase alpha chain, AcdA, domains 2 an | 95.04 | |
| d1jr1a1 | 378 | Inosine monophosphate dehydrogenase (IMPDH) {Chine | 95.02 | |
| d2fdsa1 | 324 | Protozoan orotidine monophosphate decarboxylase {P | 94.99 | |
| d1tb3a1 | 349 | Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI | 94.89 | |
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 94.76 | |
| d1dxea_ | 253 | 2-dehydro-3-deoxy-galactarate aldolase {Escherichi | 94.65 | |
| d1zfja1 | 365 | Inosine monophosphate dehydrogenase (IMPDH) {Strep | 94.58 | |
| d1q45a_ | 380 | 12-oxophytodienoate reductase (OPR, OYE homolog) { | 94.45 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 94.42 | |
| d1zfja1 | 365 | Inosine monophosphate dehydrogenase (IMPDH) {Strep | 94.3 | |
| d7reqa2 | 168 | Methylmalonyl-CoA mutase alpha subunit, C-terminal | 94.12 | |
| d2ayxa1 | 133 | Sensor kinase protein RcsC, C-terminal domain {Esc | 93.94 | |
| d1izca_ | 299 | Macrophomate synthase {Macrophoma commelinae [TaxI | 93.72 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 93.72 | |
| d1ea0a2 | 771 | Alpha subunit of glutamate synthase, central and F | 93.71 | |
| d7reqb2 | 163 | Methylmalonyl-CoA mutase beta subunit, C-terminal | 93.71 | |
| d1pvna1 | 362 | Inosine monophosphate dehydrogenase (IMPDH) {Tritr | 93.57 | |
| d1eepa_ | 388 | Inosine monophosphate dehydrogenase (IMPDH) {Lyme | 93.47 | |
| d1jvna1 | 323 | Cyclase subunit (or domain) of imidazoleglycerolph | 93.37 | |
| d2cu0a1 | 368 | Inosine monophosphate dehydrogenase (IMPDH) {Pyroc | 93.31 | |
| d1vhna_ | 305 | Putative flavin oxidoreducatase TM0096 {Thermotoga | 93.3 | |
| d1mvoa_ | 121 | PhoP receiver domain {Bacillus subtilis [TaxId: 14 | 93.12 | |
| d1ys7a2 | 121 | Transcriptional regulatory protein PrrA, N-termina | 93.06 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 92.52 | |
| d2i14a1 | 279 | Nicotinate-nucleotide pyrophosphorylase PF1904 {Py | 92.5 | |
| d3bula2 | 156 | Methionine synthase, C-terminal domain {Escherichi | 92.5 | |
| d1kbia1 | 414 | Flavocytochrome b2, C-terminal domain {Baker's yea | 92.45 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 92.42 | |
| d1goxa_ | 359 | Glycolate oxidase {Spinach (Spinacia oleracea) [Ta | 92.39 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 92.34 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 91.65 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 91.51 | |
| d1ytda1 | 270 | Nicotinate phosphoribosyltransferase Ta1145 {Therm | 91.32 | |
| d1p4ca_ | 353 | Membrane-associated (S)-mandelate dehydrogenase {P | 91.19 | |
| d1to3a_ | 291 | Putative aldolase YihT {Salmonella typhimurium [Ta | 91.08 | |
| d2r25b1 | 128 | Response regulator Sin1 {Baker's yeast (Saccharomy | 91.07 | |
| d1h7na_ | 340 | 5-aminolaevulinate dehydratase, ALAD (porphobilino | 90.9 | |
| d1ykwa1 | 283 | Ribulose 1,5-bisphosphate carboxylase-oxygenase {C | 90.56 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 89.89 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 89.13 | |
| d1k68a_ | 140 | Response regulator for cyanobacterial phytochrome | 88.33 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 88.19 | |
| d2z06a1 | 252 | Hypothetical protein TTHA0625 {Thermus thermophilu | 88.12 | |
| d1pv8a_ | 320 | 5-aminolaevulinate dehydratase, ALAD (porphobilino | 88.03 | |
| d1zh2a1 | 119 | Transcriptional regulatory protein KdpE, N-termina | 88.02 | |
| d1ofda2 | 809 | Alpha subunit of glutamate synthase, central and F | 87.93 | |
| d5ruba1 | 320 | Ribulose 1,5-bisphosphate carboxylase-oxygenase {R | 87.76 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 87.58 | |
| d1oyaa_ | 399 | Old yellow enzyme (OYE) {Lager yeast (Saccharomyce | 86.91 | |
| d1wbha1 | 213 | KDPG aldolase {Escherichia coli [TaxId: 562]} | 86.9 | |
| d1t70a_ | 255 | Putative phosphatase DR1281 {Deinococcus radiodura | 86.77 | |
| d1k66a_ | 149 | Response regulator for cyanobacterial phytochrome | 86.73 | |
| d1rvga_ | 305 | Fructose-bisphosphate aldolase (FBP aldolase) {The | 86.41 | |
| d1l6sa_ | 323 | 5-aminolaevulinate dehydratase, ALAD (porphobilino | 86.28 | |
| d1n7ka_ | 234 | Deoxyribose-phosphate aldolase DeoC {Archaeon Aero | 85.96 | |
| d2f7fa1 | 345 | Putative nicotinate phosphoribosyltransferase EF26 | 85.91 | |
| d1mxsa_ | 216 | KDPG aldolase {Pseudomonas putida [TaxId: 303]} | 85.82 | |
| d1zesa1 | 121 | PhoB receiver domain {Escherichia coli [TaxId: 562 | 85.46 | |
| d1pvna1 | 362 | Inosine monophosphate dehydrogenase (IMPDH) {Tritr | 85.32 | |
| d1p0ka_ | 329 | Isopentenyl-diphosphate delta-isomerase {Bacillus | 85.13 | |
| d1vhca_ | 212 | Hypothetical protein HI0047 {Haemophilus influenza | 84.8 | |
| d1s8na_ | 190 | Probable two-component system transcriptional regu | 84.62 | |
| d1xrsb1 | 160 | D-lysine 5,6-aminomutase beta subunit KamE, C-term | 83.88 | |
| d1a2oa1 | 140 | Methylesterase CheB, N-terminal domain {Salmonella | 83.44 | |
| d1i3ca_ | 144 | Response regulator for cyanobacterial phytochrome | 83.39 | |
| d1ub3a_ | 211 | Deoxyribose-phosphate aldolase DeoC {Thermus therm | 83.14 | |
| d1w25a2 | 153 | Response regulator PleD, receiver domain {Caulobac | 82.66 | |
| d2d69a1 | 291 | Ribulose 1,5-bisphosphate carboxylase-oxygenase {A | 82.43 | |
| d1dcfa_ | 134 | Receiver domain of the ethylene receptor {Thale cr | 81.84 | |
| d1mzha_ | 225 | Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli | 81.61 | |
| d1t71a_ | 281 | Hypothetical protein MPN349 {Mycoplasma pneumoniae | 81.53 | |
| d1w25a1 | 139 | Response regulator PleD, receiver domain {Caulobac | 81.17 | |
| d1trea_ | 255 | Triosephosphate isomerase {Escherichia coli [TaxId | 81.16 | |
| d1eo1a_ | 124 | Hypothetical protein MTH1175 {Archaeon Methanobact | 81.12 | |
| d1yioa2 | 128 | Response regulatory protein StyR, N-terminal domai | 80.32 |
| >d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: Ribulose-phoshate binding barrel family: D-ribulose-5-phosphate 3-epimerase domain: D-ribulose-5-phosphate 3-epimerase species: Rice (Oryza sativa) [TaxId: 4530]
Probab=100.00 E-value=4.8e-34 Score=209.25 Aligned_cols=112 Identities=81% Similarity=1.285 Sum_probs=106.2
Q ss_pred CceEEEecCCCCHHhHHHhHhCCCCCCEEEEEeeeCCCCCcccchhHHHHHHHHHhhCCCCcEEEEcCCChhhHHHHHHc
Q 033598 1 MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPSLDIEVDGGLGPSTIAEAASA 80 (115)
Q Consensus 1 ~k~Glal~p~t~~~~~~~~~~~~~~vD~vlvm~v~pG~~gq~~~~~~~~ki~~l~~~~~~~~i~~dGGI~~~ni~~l~~~ 80 (115)
+++|||+||+||++.+++++...+.+|+|++|+|+|||+||+|.+.+++|++++|+.+++++|+||||||.+|++.+.++
T Consensus 109 ~~~Glal~p~t~~~~~~~~l~~~~~~d~vlim~v~PG~~GQ~f~~~~l~kI~~l~~~~~~~~I~VDGGIn~~~i~~l~~a 188 (220)
T d1h1ya_ 109 MRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDGGLGPSTIDVAASA 188 (220)
T ss_dssp CEEEEEECTTSCGGGGHHHHHSSSCCSEEEEESSCTTCSSCCCCGGGHHHHHHHHHHCTTSEEEEESSCSTTTHHHHHHH
T ss_pred CCcceeeccccchhHHHHHHhcccccceEEEEecCCCCcccccchhhhHHHHHHHhcCCCceEEEEecCCHHHHHHHHHC
Confidence 58999999999999999998655678999999999999999999999999999999999999999999999999999999
Q ss_pred CCCEEEEcccccCCCCHHHHHHHHHHHHHHHh
Q 033598 81 GANCIVAGSSVFGAPEPAHVISLMRKSVEDAQ 112 (115)
Q Consensus 81 Gad~iv~Gsaif~~~d~~~~~~~l~~~~~~~~ 112 (115)
|||.+|+||+||+++|+.+++++||+.+++++
T Consensus 189 Gad~~V~GS~if~~~d~~~~i~~lr~~~~~a~ 220 (220)
T d1h1ya_ 189 GANCIVAGSSIFGAAEPGEVISALRKSVEGSQ 220 (220)
T ss_dssp TCCEEEESHHHHTSSCHHHHHHHHHHHHHHC-
T ss_pred CCCEEEECHHHHCCCCHHHHHHHHHHHHHhcC
Confidence 99999999999999999999999999998764
|
| >d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
| >d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} | Back information, alignment and structure |
|---|
| >d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dqwa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vqta1 c.1.2.3 (A:1-198) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} | Back information, alignment and structure |
|---|
| >d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d2ffca1 c.1.2.3 (A:20-351) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Plasmodium vivax [TaxId: 5855]} | Back information, alignment and structure |
|---|
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} | Back information, alignment and structure |
|---|
| >d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d2q8za1 c.1.2.3 (A:1-323) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]} | Back information, alignment and structure |
|---|
| >d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} | Back information, alignment and structure |
|---|
| >d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2fdsa1 c.1.2.3 (A:1-324) Protozoan orotidine monophosphate decarboxylase {Plasmodium berghei [TaxId: 5821]} | Back information, alignment and structure |
|---|
| >d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} | Back information, alignment and structure |
|---|
| >d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2i14a1 c.1.17.1 (A:111-389) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ytda1 c.1.17.1 (A:120-389) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d5ruba1 c.1.14.1 (A:138-457) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} | Back information, alignment and structure |
|---|
| >d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2f7fa1 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eo1a_ c.55.5.1 (A:) Hypothetical protein MTH1175 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|