Citrus Sinensis ID: 033625


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPSLDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS
cccEEEcccccccHHHHHHHcccccccEEEEEEcccccccccccHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHHcc
cEEEEEEcccccHHHHHHHHHccccccEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHcccEEEEcHHHHccccHHHHHHHHHHHHHHHHccc
mrpgvalkpgtsveevyplveganPVEMVLVMtvepgfggqkfmpEMMDKVRSLrnrypsldievdgglgpsTIAEAASAGAncivagssvfgapepaHVISLMRKSVEDAQKNS
mrpgvalkpgtsveevyplVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPSLDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS
MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPSLDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS
*************EEVYPLVEGANPVEMVLVMTVEPGFGGQKFMP*****V**LRNRYPSLDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAP****V***************
MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPSLDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLM***********
MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPSLDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRK*********
MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPSLDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVED*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPSLDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query115 2.2.26 [Sep-21-2011]
Q9SE42228 Ribulose-phosphate 3-epim yes no 1.0 0.504 0.8 4e-48
Q96AT9228 Ribulose-phosphate 3-epim yes no 0.973 0.491 0.577 4e-30
Q5R5Y2228 Ribulose-phosphate 3-epim yes no 0.973 0.491 0.577 4e-30
Q8VEE0228 Ribulose-phosphate 3-epim yes no 0.973 0.491 0.560 1e-29
P46969238 Ribulose-phosphate 3-epim yes no 0.913 0.441 0.574 5e-28
Q755M2239 Ribulose-phosphate 3-epim yes no 0.930 0.447 0.572 6e-28
Q6FL81246 Ribulose-phosphate 3-epim yes no 0.956 0.447 0.548 8e-28
O14105228 Ribulose-phosphate 3-epim yes no 0.973 0.491 0.565 4e-27
Q9L0Z5228 Ribulose-phosphate 3-epim yes no 0.930 0.469 0.421 7e-17
P65760229 Ribulose-phosphate 3-epim yes no 0.895 0.449 0.418 7e-17
>sp|Q9SE42|RPE1_ORYSJ Ribulose-phosphate 3-epimerase, cytoplasmic isoform OS=Oryza sativa subsp. japonica GN=Os09g0505700 PE=1 SV=1 Back     alignment and function desciption
 Score =  189 bits (480), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 92/115 (80%), Positives = 102/115 (88%)

Query: 1   MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60
           MRPGV+L+PGT VEEV+PLVE  NPVE+VLVMTVEPGFGGQKFMPEMM+KVR+LR +YPS
Sbjct: 114 MRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPS 173

Query: 61  LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS 115
           LDIEVDGGLGPSTI  AASAGANCIVAGSS+FGA EP  VIS +RKSVE +Q  S
Sbjct: 174 LDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGSQNKS 228




Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 5EC: .EC: 1EC: .EC: 3EC: .EC: 1
>sp|Q96AT9|RPE_HUMAN Ribulose-phosphate 3-epimerase OS=Homo sapiens GN=RPE PE=1 SV=1 Back     alignment and function description
>sp|Q5R5Y2|RPE_PONAB Ribulose-phosphate 3-epimerase OS=Pongo abelii GN=RPE PE=2 SV=1 Back     alignment and function description
>sp|Q8VEE0|RPE_MOUSE Ribulose-phosphate 3-epimerase OS=Mus musculus GN=Rpe PE=2 SV=1 Back     alignment and function description
>sp|P46969|RPE_YEAST Ribulose-phosphate 3-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPE1 PE=1 SV=1 Back     alignment and function description
>sp|Q755M2|RPE_ASHGO Ribulose-phosphate 3-epimerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPE1 PE=3 SV=1 Back     alignment and function description
>sp|Q6FL81|RPE_CANGA Ribulose-phosphate 3-epimerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPE1 PE=3 SV=1 Back     alignment and function description
>sp|O14105|RPE_SCHPO Ribulose-phosphate 3-epimerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.05c PE=3 SV=1 Back     alignment and function description
>sp|Q9L0Z5|RPE_STRCO Ribulose-phosphate 3-epimerase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpe PE=3 SV=1 Back     alignment and function description
>sp|P65760|RPE_MYCTU Ribulose-phosphate 3-epimerase OS=Mycobacterium tuberculosis GN=rpe PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
255536945 226 ribulose-5-phosphate-3-epimerase, putati 1.0 0.508 0.869 8e-52
225452134 222 PREDICTED: ribulose-phosphate 3-epimeras 0.973 0.504 0.883 2e-50
296090234 291 unnamed protein product [Vitis vinifera] 0.973 0.384 0.883 2e-50
224060236 226 predicted protein [Populus trichocarpa] 1.0 0.508 0.852 2e-50
356571509 228 PREDICTED: ribulose-phosphate 3-epimeras 0.991 0.5 0.850 6e-49
6091725 233 putative D-ribulose-5-phosphate 3-epimer 1.0 0.493 0.817 1e-48
18395962 225 ribulose-phosphate 3-epimerase [Arabidop 1.0 0.511 0.817 1e-48
255629039 228 unknown [Glycine max] 0.991 0.5 0.842 2e-48
449441680 226 PREDICTED: ribulose-phosphate 3-epimeras 1.0 0.508 0.808 5e-48
388509346157 unknown [Lotus japonicus] 0.991 0.726 0.833 6e-48
>gi|255536945|ref|XP_002509539.1| ribulose-5-phosphate-3-epimerase, putative [Ricinus communis] gi|223549438|gb|EEF50926.1| ribulose-5-phosphate-3-epimerase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  207 bits (526), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 100/115 (86%), Positives = 109/115 (94%)

Query: 1   MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60
           MRPGVALKPGTS+EEVYPLVE  NPVEMVLVMTVEPGFGGQKFMP MM+KV++LR +YPS
Sbjct: 112 MRPGVALKPGTSIEEVYPLVECENPVEMVLVMTVEPGFGGQKFMPTMMEKVKTLRKKYPS 171

Query: 61  LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS 115
           LDIEVDGGLGPSTI  AASAGANCIVAGSSVFGAPEPAHVISLM+KSV++AQ+NS
Sbjct: 172 LDIEVDGGLGPSTIDLAASAGANCIVAGSSVFGAPEPAHVISLMKKSVQEAQENS 226




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225452134|ref|XP_002263010.1| PREDICTED: ribulose-phosphate 3-epimerase, cytoplasmic isoform-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090234|emb|CBI40053.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224060236|ref|XP_002300099.1| predicted protein [Populus trichocarpa] gi|118488638|gb|ABK96131.1| unknown [Populus trichocarpa] gi|222847357|gb|EEE84904.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356571509|ref|XP_003553919.1| PREDICTED: ribulose-phosphate 3-epimerase, cytoplasmic isoform [Glycine max] Back     alignment and taxonomy information
>gi|6091725|gb|AAF03437.1|AC010797_13 putative D-ribulose-5-phosphate 3-epimerase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18395962|ref|NP_566153.1| ribulose-phosphate 3-epimerase [Arabidopsis thaliana] gi|30678440|ref|NP_850495.1| ribulose-phosphate 3-epimerase [Arabidopsis thaliana] gi|13877557|gb|AAK43856.1|AF370479_1 putative D-ribulose-5-phosphate 3-epimerase [Arabidopsis thaliana] gi|21592447|gb|AAM64398.1| putative D-ribulose-5-phosphate 3-epimerase [Arabidopsis thaliana] gi|25084145|gb|AAN72185.1| putative D-ribulose-5-phosphate 3-epimerase [Arabidopsis thaliana] gi|332640203|gb|AEE73724.1| ribulose-phosphate 3-epimerase [Arabidopsis thaliana] gi|332640204|gb|AEE73725.1| ribulose-phosphate 3-epimerase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255629039|gb|ACU14864.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449441680|ref|XP_004138610.1| PREDICTED: ribulose-phosphate 3-epimerase, cytoplasmic isoform-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388509346|gb|AFK42739.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
TAIR|locus:2038456227 AT1G63290 [Arabidopsis thalian 1.0 0.506 0.834 2.6e-47
TAIR|locus:2082349225 AT3G01850 [Arabidopsis thalian 0.973 0.497 0.839 3e-46
UNIPROTKB|G4NBH9251 MGG_00534 "Ribulose-phosphate 0.921 0.422 0.605 3e-30
CGD|CAL0002810230 orf19.7108 [Candida albicans ( 0.939 0.469 0.576 1.6e-29
UNIPROTKB|G5E6S3187 RPE "Uncharacterized protein" 0.973 0.598 0.586 3.4e-29
UNIPROTKB|C9J6A7159 RPE "Ribulose-phosphate 3-epim 0.973 0.704 0.577 4.4e-29
UNIPROTKB|C9JPQ7160 RPE "Ribulose-phosphate 3-epim 0.973 0.7 0.577 4.4e-29
UNIPROTKB|Q96AT9228 RPE "Ribulose-phosphate 3-epim 0.973 0.491 0.577 4.4e-29
UNIPROTKB|Q5R5Y2228 RPE "Ribulose-phosphate 3-epim 0.973 0.491 0.577 4.4e-29
UNIPROTKB|F1NT24243 RPE "Ribulose-phosphate 3-epim 0.956 0.452 0.578 5.6e-29
TAIR|locus:2038456 AT1G63290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 495 (179.3 bits), Expect = 2.6e-47, P = 2.6e-47
 Identities = 96/115 (83%), Positives = 105/115 (91%)

Query:     1 MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60
             MRPGVALKPGT VE+VYPLVEG NPVEMVLVMTVEPGFGGQKFMP MMDKVR+LRN+YP+
Sbjct:   113 MRPGVALKPGTPVEQVYPLVEGTNPVEMVLVMTVEPGFGGQKFMPSMMDKVRALRNKYPT 172

Query:    61 LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS 115
             LDIEVDGGLGPSTI  AA+AGANCIVAGSSVFGAP+P  VISL+R SVE AQ ++
Sbjct:   173 LDIEVDGGLGPSTIDAAAAAGANCIVAGSSVFGAPKPGDVISLLRASVEKAQPST 227




GO:0003824 "catalytic activity" evidence=IEA
GO:0004750 "ribulose-phosphate 3-epimerase activity" evidence=IEA;ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0005975 "carbohydrate metabolic process" evidence=IEA;ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2082349 AT3G01850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4NBH9 MGG_00534 "Ribulose-phosphate 3-epimerase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
CGD|CAL0002810 orf19.7108 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|G5E6S3 RPE "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9J6A7 RPE "Ribulose-phosphate 3-epimerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JPQ7 RPE "Ribulose-phosphate 3-epimerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q96AT9 RPE "Ribulose-phosphate 3-epimerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R5Y2 RPE "Ribulose-phosphate 3-epimerase" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|F1NT24 RPE "Ribulose-phosphate 3-epimerase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SE42RPE1_ORYSJ5, ., 1, ., 3, ., 10.81.00.5043yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.1.3.10.914
3rd Layer5.1.30.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
PLN02334229 PLN02334, PLN02334, ribulose-phosphate 3-epimerase 2e-64
PTZ00170228 PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epime 8e-55
cd00429211 cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RP 3e-50
PRK05581220 PRK05581, PRK05581, ribulose-phosphate 3-epimerase 4e-45
COG0036220 COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Car 3e-39
pfam00834201 pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 ep 2e-34
TIGR01163210 TIGR01163, rpe, ribulose-phosphate 3-epimerase 2e-33
PRK08745223 PRK08745, PRK08745, ribulose-phosphate 3-epimerase 4e-22
PRK08883220 PRK08883, PRK08883, ribulose-phosphate 3-epimerase 1e-20
PRK09722229 PRK09722, PRK09722, allulose-6-phosphate 3-epimera 4e-18
PRK08005210 PRK08005, PRK08005, epimerase; Validated 1e-10
COG0269217 COG0269, SgbH, 3-hexulose-6-phosphate synthase and 5e-05
TIGR01334277 TIGR01334, modD, putative molybdenum utilization p 1e-04
PRK14057254 PRK14057, PRK14057, epimerase; Provisional 1e-04
cd01568269 cd01568, QPRTase_NadC, Quinolinate phosphoribosyl 3e-04
TIGR03128206 TIGR03128, RuMP_HxlA, 3-hexulose-6-phosphate synth 9e-04
cd00564196 cd00564, TMP_TenI, Thiamine monophosphate synthase 0.002
pfam01729169 pfam01729, QRPTase_C, Quinolinate phosphoribosyl t 0.002
>gnl|CDD|215192 PLN02334, PLN02334, ribulose-phosphate 3-epimerase Back     alignment and domain information
 Score =  194 bits (495), Expect = 2e-64
 Identities = 77/115 (66%), Positives = 89/115 (77%), Gaps = 1/115 (0%)

Query: 1   MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60
           M+ GV L PGT VE V P+VE    V+MVLVM+VEPGFGGQ F+P MMDKVR+LR +YP 
Sbjct: 116 MKAGVVLNPGTPVEAVEPVVEKGL-VDMVLVMSVEPGFGGQSFIPSMMDKVRALRKKYPE 174

Query: 61  LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS 115
           LDIEVDGG+GPSTI +AA AGAN IVAGS+VFGAP+ A VIS +R SVE A    
Sbjct: 175 LDIEVDGGVGPSTIDKAAEAGANVIVAGSAVFGAPDYAEVISGLRASVEKAAVAV 229


Length = 229

>gnl|CDD|240303 PTZ00170, PTZ00170, D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|238244 cd00429, RPE, Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>gnl|CDD|235515 PRK05581, PRK05581, ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>gnl|CDD|223114 COG0036, Rpe, Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|216142 pfam00834, Ribul_P_3_epim, Ribulose-phosphate 3 epimerase family Back     alignment and domain information
>gnl|CDD|130231 TIGR01163, rpe, ribulose-phosphate 3-epimerase Back     alignment and domain information
>gnl|CDD|136958 PRK08745, PRK08745, ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|181575 PRK08883, PRK08883, ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|236616 PRK09722, PRK09722, allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|169179 PRK08005, PRK08005, epimerase; Validated Back     alignment and domain information
>gnl|CDD|223347 COG0269, SgbH, 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130401 TIGR01334, modD, putative molybdenum utilization protein ModD Back     alignment and domain information
>gnl|CDD|172549 PRK14057, PRK14057, epimerase; Provisional Back     alignment and domain information
>gnl|CDD|238802 cd01568, QPRTase_NadC, Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>gnl|CDD|132172 TIGR03128, RuMP_HxlA, 3-hexulose-6-phosphate synthase Back     alignment and domain information
>gnl|CDD|238317 cd00564, TMP_TenI, Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>gnl|CDD|216667 pfam01729, QRPTase_C, Quinolinate phosphoribosyl transferase, C-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 115
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 100.0
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 100.0
PRK08091228 ribulose-phosphate 3-epimerase; Validated 100.0
PRK08005210 epimerase; Validated 100.0
PRK14057254 epimerase; Provisional 100.0
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 100.0
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 100.0
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 100.0
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 99.97
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 99.95
PLN02334229 ribulose-phosphate 3-epimerase 99.94
PRK05581220 ribulose-phosphate 3-epimerase; Validated 99.87
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 99.84
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 99.83
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 99.82
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 99.81
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 99.81
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; 99.79
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 99.78
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 99.74
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 99.73
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 99.69
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 99.69
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 99.68
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 99.62
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 99.59
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 99.53
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 99.51
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 99.46
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 99.45
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 99.44
PRK07695201 transcriptional regulator TenI; Provisional 99.43
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 99.38
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 99.35
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 99.29
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 99.28
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 99.21
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 99.14
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 99.12
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.12
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 99.09
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 99.08
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.07
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 99.03
PRK08999312 hypothetical protein; Provisional 98.97
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 98.96
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 98.94
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 98.91
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 98.84
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 98.81
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 98.8
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 98.8
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 98.78
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 98.78
PRK06806281 fructose-bisphosphate aldolase; Provisional 98.76
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 98.75
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 98.72
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 98.71
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 98.67
PRK00208250 thiG thiazole synthase; Reviewed 98.67
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 98.65
PRK07226267 fructose-bisphosphate aldolase; Provisional 98.64
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 98.61
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 98.58
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 98.57
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 98.57
PLN02591250 tryptophan synthase 98.57
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 98.55
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 98.55
TIGR01334277 modD putative molybdenum utilization protein ModD. 98.47
PRK07315293 fructose-bisphosphate aldolase; Provisional 98.46
PRK13305218 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; 98.45
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 98.45
PRK04302223 triosephosphate isomerase; Provisional 98.44
PRK06096284 molybdenum transport protein ModD; Provisional 98.42
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 98.41
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 98.34
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.31
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 98.3
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 98.25
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 98.21
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 98.18
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.16
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 98.15
PRK09016296 quinolinate phosphoribosyltransferase; Validated 98.15
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 98.15
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 98.14
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 98.11
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 98.11
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 98.11
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 98.11
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 98.1
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 98.1
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.08
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 98.08
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 98.02
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.02
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 98.0
PRK13585 241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.98
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 97.95
cd04732 234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 97.91
PRK14114 241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.89
cd02812219 PcrB_like PcrB_like proteins. One member of this f 97.86
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 97.86
TIGR00735 254 hisF imidazoleglycerol phosphate synthase, cyclase 97.84
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 97.82
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 97.82
PRK06801286 hypothetical protein; Provisional 97.79
PRK00748 233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.78
cd01571302 NAPRTase_B Nicotinate phosphoribosyltransferase (N 97.77
PRK02083 253 imidazole glycerol phosphate synthase subunit HisF 97.76
CHL00162267 thiG thiamin biosynthesis protein G; Validated 97.75
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 97.74
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 97.74
TIGR00007 230 phosphoribosylformimino-5-aminoimidazole carboxami 97.73
cd04731 243 HisF The cyclase subunit of imidazoleglycerol phos 97.69
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 97.68
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 97.68
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 97.66
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 97.64
TIGR03572 232 WbuZ glycosyl amidation-associated protein WbuZ. T 97.63
TIGR02129 253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.62
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 97.6
PRK13587 234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.6
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.58
PRK01033 258 imidazole glycerol phosphate synthase subunit HisF 97.58
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 97.56
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 97.55
PRK13586 232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.54
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.54
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 97.49
PLN02446 262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 97.49
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 97.49
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 97.48
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 97.48
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 97.46
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 97.45
PRK01222210 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 97.44
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino a 97.43
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 97.42
PRK08662343 nicotinate phosphoribosyltransferase; Reviewed 97.41
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.39
cd00516281 PRTase_typeII Phosphoribosyltransferase (PRTase) t 97.38
PRK14024 241 phosphoribosyl isomerase A; Provisional 97.35
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 97.35
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 97.34
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 97.33
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 97.3
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 97.27
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 97.27
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 97.25
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.25
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 97.24
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.23
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 97.23
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 97.22
PLN02617 538 imidazole glycerol phosphate synthase hisHF 97.22
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.19
KOG1606296 consensus Stationary phase-induced protein, SOR/SN 97.18
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 97.17
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 97.13
PRK06843 404 inosine 5-monophosphate dehydrogenase; Validated 97.1
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate deca 97.1
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.08
PLN02274505 inosine-5'-monophosphate dehydrogenase 97.06
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.04
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 97.02
PF00697197 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isome 97.01
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 97.0
PLN02826409 dihydroorotate dehydrogenase 96.96
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 96.95
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 96.89
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 96.88
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 96.88
PRK08227264 autoinducer 2 aldolase; Validated 96.87
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 96.86
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 96.83
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 96.81
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 96.8
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.8
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 96.77
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 96.74
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 96.74
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 96.74
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 96.73
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 96.73
PRK14024241 phosphoribosyl isomerase A; Provisional 96.72
PF00215226 OMPdecase: Orotidine 5'-phosphate decarboxylase / 96.69
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 96.69
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleot 96.66
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 96.66
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 96.65
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 96.65
TIGR01919 243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 96.62
PF00478 352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 96.59
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 96.57
PRK11572248 copper homeostasis protein CutC; Provisional 96.57
PF06073110 DUF934: Bacterial protein of unknown function (DUF 96.57
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 96.56
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 96.56
PRK13958207 N-(5'-phosphoribosyl)anthranilate isomerase; Provi 96.56
PRK07188352 nicotinate phosphoribosyltransferase; Provisional 96.55
TIGR01302 450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 96.51
PLN02274 505 inosine-5'-monophosphate dehydrogenase 96.48
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 96.48
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 96.47
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 96.44
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 96.43
PRK05500 477 bifunctional orotidine 5'-phosphate decarboxylase/ 96.41
PLN02535364 glycolate oxidase 96.4
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 96.39
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 96.36
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 96.32
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 96.31
PRK13523337 NADPH dehydrogenase NamA; Provisional 96.3
PRK13803 610 bifunctional phosphoribosylanthranilate isomerase/ 96.28
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 96.27
PRK09427454 bifunctional indole-3-glycerol phosphate synthase/ 96.27
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 96.27
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 96.26
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 96.25
PRK06852304 aldolase; Validated 96.24
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 96.21
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 96.2
PRK05458 326 guanosine 5'-monophosphate oxidoreductase; Provisi 96.1
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 96.09
COG0106 241 HisA Phosphoribosylformimino-5-aminoimidazole carb 96.07
PRK02261137 methylaspartate mutase subunit S; Provisional 96.06
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 96.04
PLN02363256 phosphoribosylanthranilate isomerase 95.99
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 95.91
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 95.89
PRK05096 346 guanosine 5'-monophosphate oxidoreductase; Provisi 95.88
TIGR01305 343 GMP_reduct_1 guanosine monophosphate reductase, eu 95.88
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 95.85
PRK14565237 triosephosphate isomerase; Provisional 95.84
PRK10605362 N-ethylmaleimide reductase; Provisional 95.78
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 95.75
COG0107 256 HisF Imidazoleglycerol-phosphate synthase [Amino a 95.74
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 95.71
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 95.69
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 95.69
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 95.68
PLN02979366 glycolate oxidase 95.63
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 95.62
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 95.59
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 95.58
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 95.56
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 95.45
PRK11197381 lldD L-lactate dehydrogenase; Provisional 95.4
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 95.39
PLN02460338 indole-3-glycerol-phosphate synthase 95.38
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 95.37
TIGR02814 444 pfaD_fam PfaD family protein. The protein PfaD is 95.36
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 95.34
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 95.33
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 95.31
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 95.31
PF01645368 Glu_synthase: Conserved region in glutamate syntha 95.29
cd04742 418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 95.29
COG0325228 Predicted enzyme with a TIM-barrel fold [General f 95.26
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 95.25
PRK08185283 hypothetical protein; Provisional 95.24
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 95.18
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 95.11
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 95.1
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 95.03
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 94.9
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 94.87
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 94.82
PLN02411391 12-oxophytodienoate reductase 94.81
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 94.75
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 94.66
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 94.62
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 94.56
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 94.56
COG0149251 TpiA Triosephosphate isomerase [Carbohydrate trans 94.46
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 94.36
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 94.35
PRK14567253 triosephosphate isomerase; Provisional 94.31
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 94.02
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 94.0
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 93.97
cd06822227 PLPDE_III_YBL036c_euk Pyridoxal 5-phosphate (PLP)- 93.95
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 93.93
TIGR01306 321 GMP_reduct_2 guanosine monophosphate reductase, ba 93.89
KOG0538363 consensus Glycolate oxidase [Energy production and 93.85
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 93.78
PRK14905355 triosephosphate isomerase/PTS system glucose/sucro 93.63
COG3142241 CutC Uncharacterized protein involved in copper re 93.36
cd00311242 TIM Triosephosphate isomerase (TIM) is a glycolyti 93.34
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 92.97
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 92.91
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 92.86
cd02069213 methionine_synthase_B12_BD B12 binding domain of m 92.52
KOG3055 263 consensus Phosphoribosylformimino-5-aminoimidazole 92.46
KOG1799471 consensus Dihydropyrimidine dehydrogenase [Nucleot 92.29
PRK05437 352 isopentenyl pyrophosphate isomerase; Provisional 92.23
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 92.18
PRK00042250 tpiA triosephosphate isomerase; Provisional 91.96
PLN02623 581 pyruvate kinase 91.75
PLN02429315 triosephosphate isomerase 91.73
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 91.37
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 91.31
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 91.2
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 91.15
COG1411229 Uncharacterized protein related to proFAR isomeras 91.06
COG1692 266 Calcineurin-like phosphoesterase [General function 90.7
PLN02617538 imidazole glycerol phosphate synthase hisHF 90.59
PRK09250348 fructose-bisphosphate aldolase; Provisional 90.58
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 90.53
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 90.46
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 90.35
PRK09426714 methylmalonyl-CoA mutase; Reviewed 90.14
PRK15492260 triosephosphate isomerase; Provisional 90.12
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 90.08
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 90.06
PTZ00333255 triosephosphate isomerase; Provisional 89.99
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 89.81
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 89.23
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 88.95
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 88.88
cd08207406 RLP_NonPhot Ribulose bisphosphate carboxylase like 88.87
PF04476235 DUF556: Protein of unknown function (DUF556); Inte 88.61
PF13277 253 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. 88.43
PRK08649 368 inosine 5-monophosphate dehydrogenase; Validated 88.26
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 88.17
TIGR00419205 tim triosephosphate isomerase. Triosephosphate iso 88.05
TIGR01417565 PTS_I_fam phosphoenolpyruvate-protein phosphotrans 88.04
PRK06464795 phosphoenolpyruvate synthase; Validated 88.03
cd04824320 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthas 87.89
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 87.87
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 87.69
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 87.59
PRK08508 279 biotin synthase; Provisional 87.43
PRK02227238 hypothetical protein; Provisional 87.39
PRK09196347 fructose-1,6-bisphosphate aldolase; Reviewed 87.25
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 86.84
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 86.3
PLN02428 349 lipoic acid synthase 86.18
PRK00507221 deoxyribose-phosphate aldolase; Provisional 86.18
PRK07565 334 dihydroorotate dehydrogenase 2; Reviewed 86.14
PRK13111 258 trpA tryptophan synthase subunit alpha; Provisiona 86.1
TIGR02370197 pyl_corrinoid methyltransferase cognate corrinoid 86.01
TIGR01304 369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 85.87
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 85.65
TIGR00045375 glycerate kinase. The only characterized member of 85.55
PRK01362214 putative translaldolase; Provisional 85.51
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 85.48
TIGR02127261 pyrF_sub2 orotidine 5'-phosphate decarboxylase, su 85.42
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 85.41
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 85.38
cd03174 265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 85.2
TIGR00676272 fadh2 5,10-methylenetetrahydrofolate reductase, pr 85.17
PF00121244 TIM: Triosephosphate isomerase; InterPro: IPR00065 85.07
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 85.03
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 84.93
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 84.79
COG3749167 Uncharacterized protein conserved in bacteria [Fun 84.7
PRK07084321 fructose-bisphosphate aldolase; Provisional 84.6
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 84.08
TIGR01418782 PEP_synth phosphoenolpyruvate synthase. Also calle 83.93
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 83.8
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 83.65
COG1891235 Uncharacterized protein conserved in archaea [Func 83.46
PRK08444 353 hypothetical protein; Provisional 83.44
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 83.32
TIGR00262 256 trpA tryptophan synthase, alpha subunit. Tryptopha 83.28
KOG3157244 consensus Proline synthetase co-transcribed protei 83.26
PRK08610286 fructose-bisphosphate aldolase; Reviewed 83.1
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 83.07
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 82.74
cd02068127 radical_SAM_B12_BD B12 binding domain_like associa 82.72
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 82.51
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 82.37
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 82.11
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 81.99
PLN02561253 triosephosphate isomerase 81.96
COG3836255 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 81.93
PRK10643222 DNA-binding transcriptional regulator BasR; Provis 81.9
PRK12581 468 oxaloacetate decarboxylase; Provisional 81.79
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 81.57
KOG4201289 consensus Anthranilate synthase component II [Amin 81.54
PRK11613 282 folP dihydropteroate synthase; Provisional 81.52
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 81.49
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 81.42
TIGR03326412 rubisco_III ribulose bisphosphate carboxylase, typ 81.29
PF0802975 HisG_C: HisG, C-terminal domain; InterPro: IPR0131 81.25
cd07939 259 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and 81.13
cd00408 281 DHDPS-like Dihydrodipicolinate synthase family. A 80.9
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 80.78
PRK13399347 fructose-1,6-bisphosphate aldolase; Provisional 80.75
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 80.7
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 80.69
cd07948 262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 80.57
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 80.56
PTZ00413 398 lipoate synthase; Provisional 80.48
PLN02979366 glycolate oxidase 80.37
COG2197211 CitB Response regulator containing a CheY-like rec 80.04
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=4.5e-35  Score=216.66  Aligned_cols=107  Identities=43%  Similarity=0.782  Sum_probs=101.6

Q ss_pred             CceEEEecCCCCHHhHHHhHhCCCCCCEEEEEeeeCCCCCcccchhHHHHHHHHHhhCC---CCcEEEEcCCChhhHHHH
Q 033625            1 MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYP---SLDIEVDGGLGPSTIAEA   77 (115)
Q Consensus         1 ~k~Glal~p~t~~~~~~~~~~~~~~vD~vlvm~v~pG~~gq~~~~~~~~ki~~l~~~~~---~~~i~~dGGI~~~ni~~l   77 (115)
                      +|+|++|||+||++.+++++   +.+|+|++|+|+|||+||+|++++++||+++|++..   ++.|+||||||.+|++++
T Consensus       110 ~kaGv~lnP~Tp~~~i~~~l---~~vD~VllMsVnPGfgGQ~Fi~~~l~Ki~~lr~~~~~~~~~~IeVDGGI~~~t~~~~  186 (220)
T COG0036         110 VKAGLVLNPATPLEALEPVL---DDVDLVLLMSVNPGFGGQKFIPEVLEKIRELRAMIDERLDILIEVDGGINLETIKQL  186 (220)
T ss_pred             CeEEEEECCCCCHHHHHHHH---hhCCEEEEEeECCCCcccccCHHHHHHHHHHHHHhcccCCeEEEEeCCcCHHHHHHH
Confidence            68999999999999999999   999999999999999999999999999999999876   678999999999999999


Q ss_pred             HHcCCCEEEEcccccCCCCHHHHHHHHHHHHHH
Q 033625           78 ASAGANCIVAGSSVFGAPEPAHVISLMRKSVED  110 (115)
Q Consensus        78 ~~~Gad~iv~Gsaif~~~d~~~~~~~l~~~~~~  110 (115)
                      .++|||++|+||++|+++|+++.+++++..+..
T Consensus       187 ~~AGad~~VaGSalF~~~d~~~~i~~~~~~~~~  219 (220)
T COG0036         187 AAAGADVFVAGSALFGADDYKATIRELRGELLK  219 (220)
T ss_pred             HHcCCCEEEEEEEEeCCccHHHHHHHHHHHhhc
Confidence            999999999999999999999999999987653



>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK13305 sgbH 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK08662 nicotinate phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PF00697 PRAI: N-(5'phosphoribosyl)anthranilate (PRA) isomerase; InterPro: IPR001240 Indole-3-glycerol phosphate synthase (IGPS) (see IPR001468 from INTERPRO) catalyzes the fourth step in the biosynthesis of tryptophan, the ring closure of 1-(2-carboxy-phenylamino)-1-deoxyribulose into indol-3-glycerol-phosphate Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PF00215 OMPdecase: Orotidine 5'-phosphate decarboxylase / HUMPS family; InterPro: IPR001754 Orotidine 5'-phosphate decarboxylase (OMPdecase) [, ] catalyses the last step in the de novo biosynthesis of pyrimidines, the decarboxylation of OMP into UMP Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PF06073 DUF934: Bacterial protein of unknown function (DUF934); InterPro: IPR008318 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional Back     alignment and domain information
>PRK07188 nicotinate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>PLN02363 phosphoribosylanthranilate isomerase Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>PRK14565 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>COG0325 Predicted enzyme with a TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>COG0149 TpiA Triosephosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK14567 triosephosphate isomerase; Provisional Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd06822 PLPDE_III_YBL036c_euk Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Eukaryotic YBL036c-like proteins Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>KOG0538 consensus Glycolate oxidase [Energy production and conversion] Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK14905 triosephosphate isomerase/PTS system glucose/sucrose-specific transporter subunit IIB; Provisional Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00311 TIM Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>KOG3055 consensus Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1799 consensus Dihydropyrimidine dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK00042 tpiA triosephosphate isomerase; Provisional Back     alignment and domain information
>PLN02623 pyruvate kinase Back     alignment and domain information
>PLN02429 triosephosphate isomerase Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>COG1411 Uncharacterized protein related to proFAR isomerase (HisA) [General function prediction only] Back     alignment and domain information
>COG1692 Calcineurin-like phosphoesterase [General function prediction only] Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>PRK09426 methylmalonyl-CoA mutase; Reviewed Back     alignment and domain information
>PRK15492 triosephosphate isomerase; Provisional Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00333 triosephosphate isomerase; Provisional Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>cd08207 RLP_NonPhot Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria Back     alignment and domain information
>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised Back     alignment and domain information
>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>TIGR00419 tim triosephosphate isomerase Back     alignment and domain information
>TIGR01417 PTS_I_fam phosphoenolpyruvate-protein phosphotransferase Back     alignment and domain information
>PRK06464 phosphoenolpyruvate synthase; Validated Back     alignment and domain information
>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PRK02227 hypothetical protein; Provisional Back     alignment and domain information
>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02428 lipoic acid synthase Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>TIGR00045 glycerate kinase Back     alignment and domain information
>PRK01362 putative translaldolase; Provisional Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>TIGR02127 pyrF_sub2 orotidine 5'-phosphate decarboxylase, subfamily 2 Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase, prokaryotic form Back     alignment and domain information
>PF00121 TIM: Triosephosphate isomerase; InterPro: IPR000652 Triosephosphate isomerase (5 Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG3749 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>TIGR01418 PEP_synth phosphoenolpyruvate synthase Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG1891 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK08444 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>KOG3157 consensus Proline synthetase co-transcribed protein [General function prediction only] Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02561 triosephosphate isomerase Back     alignment and domain information
>COG3836 HpcH 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11613 folP dihydropteroate synthase; Provisional Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>PF08029 HisG_C: HisG, C-terminal domain; InterPro: IPR013115 ATP phosphoribosyltransferase (2 Back     alignment and domain information
>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PTZ00413 lipoate synthase; Provisional Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
1h1y_A228 The Structure Of The Cytosolic D-Ribulose-5-Phospha 3e-49
3ovp_A228 Crystal Structure Of Hrpe Length = 228 3e-31
1tqx_A227 Crystal Structure Of Pfal009167 A Putative D-Ribulo 1e-27
3qc3_A225 Crystal Structure Of A D-Ribulose-5-Phosphate-3-Epi 2e-26
1tqj_A230 Crystal Structure Of D-Ribulose 5-Phosphate 3-Epime 9e-18
3inp_A246 2.05 Angstrom Resolution Crystal Structure Of D-Rib 1e-17
2fli_A220 The Crystal Structure Of D-Ribulose 5-Phosphate 3-E 2e-17
1rpx_A230 D-Ribulose-5-Phosphate 3-Epimerase From Solanum Tub 8e-17
3ct7_A231 Crystal Structure Of D-Allulose 6-Phosphate 3-Epime 2e-11
>pdb|1H1Y|A Chain A, The Structure Of The Cytosolic D-Ribulose-5-Phosphate 3- Epimerase From Rice Complexed With Sulfate Length = 228 Back     alignment and structure

Iteration: 1

Score = 189 bits (480), Expect = 3e-49, Method: Compositional matrix adjust. Identities = 92/115 (80%), Positives = 102/115 (88%) Query: 1 MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60 MRPGV+L+PGT VEEV+PLVE NPVE+VLVMTVEPGFGGQKFMPEMM+KVR+LR +YPS Sbjct: 114 MRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPS 173 Query: 61 LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS 115 LDIEVDGGLGPSTI AASAGANCIVAGSS+FGA EP VIS +RKSVE +Q S Sbjct: 174 LDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGSQNKS 228
>pdb|3OVP|A Chain A, Crystal Structure Of Hrpe Length = 228 Back     alignment and structure
>pdb|1TQX|A Chain A, Crystal Structure Of Pfal009167 A Putative D-Ribulose 5-Phosphate 3- Epimerase From P.Falciparum Length = 227 Back     alignment and structure
>pdb|3QC3|A Chain A, Crystal Structure Of A D-Ribulose-5-Phosphate-3-Epimerase (Np_954699) From Homo Sapiens At 2.20 A Resolution Length = 225 Back     alignment and structure
>pdb|1TQJ|A Chain A, Crystal Structure Of D-Ribulose 5-Phosphate 3-Epimerase From Synechocystis To 1.6 Angstrom Resolution Length = 230 Back     alignment and structure
>pdb|3INP|A Chain A, 2.05 Angstrom Resolution Crystal Structure Of D-Ribulose-Phosphate 3- Epimerase From Francisella Tularensis Length = 246 Back     alignment and structure
>pdb|2FLI|A Chain A, The Crystal Structure Of D-Ribulose 5-Phosphate 3-Epimerase From Streptococus Pyogenes Complexed With D-Xylitol 5- Phosphate Length = 220 Back     alignment and structure
>pdb|1RPX|A Chain A, D-Ribulose-5-Phosphate 3-Epimerase From Solanum Tuberosum Chloroplasts Length = 230 Back     alignment and structure
>pdb|3CT7|A Chain A, Crystal Structure Of D-Allulose 6-Phosphate 3-Epimerase From Escherichia Coli K-12 Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 8e-63
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 6e-59
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 2e-57
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 2e-42
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 7e-42
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 9e-42
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 4e-41
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 4e-39
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 4e-36
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 8e-20
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 4e-18
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 4e-18
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 2e-16
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 1e-15
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Length = 228 Back     alignment and structure
 Score =  189 bits (483), Expect = 8e-63
 Identities = 92/115 (80%), Positives = 102/115 (88%)

Query: 1   MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60
           MRPGV+L+PGT VEEV+PLVE  NPVE+VLVMTVEPGFGGQKFMPEMM+KVR+LR +YPS
Sbjct: 114 MRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPS 173

Query: 61  LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKNS 115
           LDIEVDGGLGPSTI  AASAGANCIVAGSS+FGA EP  VIS +RKSVE +Q  S
Sbjct: 174 LDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGSQNKS 228


>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Length = 227 Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} PDB: 3ovq_A* 3ovr_A* 3qc3_A Length = 228 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Length = 220 Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Length = 230 Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Length = 246 Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Length = 230 Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Length = 231 Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Length = 237 Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} PDB: 3exs_A* 3ext_A Length = 221 Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} PDB: 3ieb_A* Length = 218 Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Length = 216 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} Length = 211 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Length = 207 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 100.0
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 99.97
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 99.97
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 99.97
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 99.96
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 99.95
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 99.95
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 99.89
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 99.89
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 99.79
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 99.77
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 99.76
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 99.71
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 99.68
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 99.67
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 99.66
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 99.66
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 99.64
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 99.64
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 99.64
1dbt_A239 Orotidine 5'-phosphate decarboxylase; UMP, TIM bar 99.63
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 99.63
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 99.63
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 99.55
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 99.52
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 99.5
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 99.44
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.37
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 99.33
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.31
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 99.25
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 99.25
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 99.22
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 99.21
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 99.17
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 99.14
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 99.12
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 99.07
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 99.05
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 99.04
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 98.99
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.95
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 98.94
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 98.93
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 98.93
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 98.9
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 98.84
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 98.81
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 98.8
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 98.8
3ve9_A215 Orotidine-5'-phosphate decarboxylase; TIM barrel f 98.8
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 98.75
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 98.73
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 98.72
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 98.71
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 98.71
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 98.69
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 98.69
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 98.68
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.68
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 98.66
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 98.61
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 98.61
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 98.6
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 98.59
1ujp_A271 Tryptophan synthase alpha chain; riken structural 98.58
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 98.57
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 98.55
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 98.54
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 98.52
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 98.51
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 98.49
1vqt_A213 Orotidine 5'-phosphate decarboxylase; TM0332, stru 98.48
4dbe_A222 Orotidine 5'-phosphate decarboxylase; TIM barrel, 98.48
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 98.45
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 98.45
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 98.39
3tha_A252 Tryptophan synthase alpha chain; structural genomi 98.37
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 98.35
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 98.33
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 98.32
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 98.31
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 98.31
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 98.29
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 98.28
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 98.28
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 98.26
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 98.21
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 98.17
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 98.15
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 98.13
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 98.12
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 98.07
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 98.07
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 98.06
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 97.99
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 97.97
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 97.95
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 97.94
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 97.93
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 97.88
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 97.86
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 97.78
4gj1_A 243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.77
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 97.76
3tdn_A 247 FLR symmetric alpha-beta TIM barrel; symmetric sup 97.74
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 97.73
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 97.62
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 97.61
1ka9_F 252 Imidazole glycerol phosphtate synthase; riken stru 97.58
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 97.56
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 97.55
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 97.54
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 97.53
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 97.5
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 97.49
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.47
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 97.47
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 97.46
1thf_D 253 HISF protein; thermophIle, TIM-barrel, histidine b 97.46
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 97.45
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 97.44
3eww_A260 Ompdecase, orotidine-5'-phosphate decarboxylase; T 97.43
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 97.43
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 97.42
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 97.42
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 97.41
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 97.38
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 97.37
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 97.36
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 97.35
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 97.34
3qw3_A255 Orotidine-5-phosphate decarboxylase/orotate phosph 97.33
2agk_A 260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.33
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 97.31
1viz_A240 PCRB protein homolog; structural genomics, unknown 97.31
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 97.3
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 97.29
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 97.28
2i1o_A398 Nicotinate phosphoribosyltransferase; ZIN ION, zin 97.27
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 97.24
2fds_A352 Orotidine-monophosphate-decarboxylase; TIM barrel, 97.24
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.23
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.21
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 97.17
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 97.16
2y88_A 244 Phosphoribosyl isomerase A; aromatic amino acid bi 97.14
1v5x_A203 PRA isomerase, phosphoribosylanthranilate isomeras 97.13
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.13
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 97.12
1vzw_A 244 Phosphoribosyl isomerase A; histidine biosynthesis 97.08
2w6r_A 266 Imidazole glycerol phosphate synthase subunit HISF 97.05
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 97.02
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 96.97
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 96.97
1h5y_A 253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 96.96
1nsj_A205 PRAI, phosphoribosyl anthranilate isomerase; therm 96.89
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 96.86
3qw4_B 453 UMP synthase; N-terminal orotidine monophosphate d 96.85
2ffc_A353 Orotidine 5-monophosphate decarboxylase; PV-PF10_0 96.83
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 96.83
1qo2_A 241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 96.79
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 96.79
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 96.76
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 96.73
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 96.72
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 96.72
3g3d_A312 UMP synthase, uridine 5'-monophosphate synthase; C 96.71
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 96.7
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 96.7
4aaj_A228 N-(5'-phosphoribosyl)anthranilate isomerase; alpha 96.69
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 96.68
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 96.63
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 96.59
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 96.56
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 96.55
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 96.55
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 96.5
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 96.41
3gdm_A267 Orotidine 5'-phosphate decarboxylase; orotidine 5' 96.25
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 96.21
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 96.19
2i14_A395 Nicotinate-nucleotide pyrophosphorylase; ligand bi 96.17
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 96.08
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 95.98
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 95.97
2fli_A 220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 95.92
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 95.81
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 95.75
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 95.71
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 95.61
3n3m_A342 Orotidine 5'-phosphate decarboxylase; P. falciparu 95.6
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 95.53
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 95.51
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 95.5
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 95.46
1eep_A 404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 95.25
3kts_A192 Glycerol uptake operon antiterminator regulatory; 95.19
1pii_A452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 95.11
1geq_A 248 Tryptophan synthase alpha-subunit; hyperthermophIl 95.07
3ffs_A 400 Inosine-5-monophosphate dehydrogenase; beta-alpha 94.96
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 94.95
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 94.85
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 94.82
2c6q_A 351 GMP reductase 2; TIM barrel, metal-binding, NADP, 94.61
2jgq_A233 Triosephosphate isomerase; glycolysis, pentose shu 94.49
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 94.48
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 94.48
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 94.36
1yya_A250 Triosephosphate isomerase; riken structural genomi 94.31
3sy1_A245 UPF0001 protein YGGS; engineered protein, structur 94.17
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 94.17
2j27_A250 Triosephosphate isomerase glycosomal; TIM, 2PG, LO 94.15
3qja_A 272 IGPS, indole-3-glycerol phosphate synthase; struct 94.1
2yc6_A257 Triosephosphate isomerase; glycolysis; HET: PGA; 1 93.92
2btm_A252 TIM, protein (triosephosphate isomerase); thermoph 93.9
1o5x_A248 TIM, triosephosphate isomerase; 2- phosphoglycerat 93.89
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 93.85
3lte_A132 Response regulator; structural genomics, PSI, prot 93.85
1aw2_A256 Triosephosphate isomerase; psychrophilic, vibrio m 93.69
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 93.58
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 93.55
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 93.5
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 93.49
3snk_A135 Response regulator CHEY-like protein; P-loop conta 93.38
2qr6_A 393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 93.29
1rpx_A 230 Protein (ribulose-phosphate 3-epimerase); chloropl 93.08
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 92.99
2qxy_A142 Response regulator; regulation of transcription, N 92.92
1tre_A255 Triosephosphate isomerase; intramolecular oxidored 92.9
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 92.86
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 92.72
3nhm_A133 Response regulator; protein structure initiative I 92.7
2f7f_A 494 Nicotinate phosphoribosyltransferase, putative; st 92.57
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 92.4
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 92.37
3gt7_A154 Sensor protein; structural genomics, signal receiv 92.26
1me8_A 503 Inosine-5'-monophosphate dehydrogenase; alpha beta 92.05
3kto_A136 Response regulator receiver protein; PSI-II,struct 91.86
3rqi_A184 Response regulator protein; structural genomics, s 91.8
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 91.77
2xij_A762 Methylmalonyl-COA mutase, mitochondrial; isomerase 91.6
3sr7_A 365 Isopentenyl-diphosphate delta-isomerase; isopenten 91.6
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 91.59
3oa3_A288 Aldolase; structural genomics, seattle structural 91.48
2pln_A137 HP1043, response regulator; signaling protein; 1.8 91.36
2zay_A147 Response regulator receiver protein; structural ge 91.36
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 91.3
3eul_A152 Possible nitrate/nitrite response transcriptional 91.23
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 91.2
4adt_A 297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 91.07
1y80_A210 Predicted cobalamin binding protein; corrinoid, fa 91.02
3cfy_A137 Putative LUXO repressor protein; structural genomi 90.99
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 90.94
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 90.9
4dad_A146 Putative pilus assembly-related protein; response 90.85
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 90.84
3i42_A127 Response regulator receiver domain protein (CHEY- 90.78
3crn_A132 Response regulator receiver domain protein, CHEY-; 90.66
1p0k_A 349 Isopentenyl-diphosphate delta-isomerase; terpene b 90.66
2i2x_B258 MTAC, methyltransferase 1; TIM barrel and helix bu 90.65
3hdg_A137 Uncharacterized protein; two-component sensor acti 90.61
3cwo_X 237 Beta/alpha-barrel protein based on 1THF and 1TMY; 90.58
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 90.56
3ezx_A215 MMCP 1, monomethylamine corrinoid protein 1; N ter 90.51
3jte_A143 Response regulator receiver protein; structural ge 90.37
1b9b_A255 TIM, protein (triosephosphate isomerase); thermoph 90.33
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 90.22
2vp8_A 318 Dihydropteroate synthase 2; RV1207 transferase, fo 90.03
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 90.02
2ekc_A 262 AQ_1548, tryptophan synthase alpha chain; structur 89.89
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 89.75
1ct5_A256 Protein (yeast hypothetical protein, selenoMet); T 89.64
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 89.6
1mo0_A275 TIM, triosephosphate isomerase; structural genomic 89.54
3r79_A244 Uncharacterized protein; PSI-biology, structural g 89.51
1ypf_A 336 GMP reductase; GUAC, purines, pyrimidines, nucleos 89.49
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 89.42
3m9y_A254 Triosephosphate isomerase; TIM barrel, glycolysis, 89.28
1req_A727 Methylmalonyl-COA mutase; isomerase, intramolecula 89.28
3lua_A140 Response regulator receiver protein; two-component 89.2
1tx2_A 297 DHPS, dihydropteroate synthase; folate biosynthesi 89.04
1srr_A124 SPO0F, sporulation response regulatory protein; as 89.0
2qv0_A143 Protein MRKE; structural genomics, transcription, 88.96
2ayx_A254 Sensor kinase protein RCSC; two independent struct 88.86
2i9e_A259 Triosephosphate isomerase; 2.00A {Tenebrio molitor 88.75
3f6c_A134 Positive transcription regulator EVGA; structural 88.67
3hdv_A136 Response regulator; PSI-II, structural genomics, P 88.63
2gkg_A127 Response regulator homolog; social motility, recei 88.59
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 88.53
1h7n_A342 5-aminolaevulinic acid dehydratase; lyase, aldolas 88.48
2vxn_A251 Triosephosphate isomerase; fatty acid biosynthesis 88.47
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 88.41
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 88.29
3grc_A140 Sensor protein, kinase; protein structure initiati 88.23
3r0j_A 250 Possible two component system response transcript 88.17
3h5i_A140 Response regulator/sensory box protein/ggdef domai 88.11
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 87.95
1pv8_A330 Delta-aminolevulinic acid dehydratase; porphobilin 87.79
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 87.64
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 87.55
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 87.5
3cg4_A142 Response regulator receiver domain protein (CHEY-; 87.18
3heb_A152 Response regulator receiver domain protein (CHEY); 87.18
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 87.18
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 87.14
1vhc_A 224 Putative KHG/KDPG aldolase; structural genomics, u 86.99
1yio_A208 Response regulatory protein; transcription regulat 86.9
2rjn_A154 Response regulator receiver:metal-dependent phosph 86.88
3vkj_A 368 Isopentenyl-diphosphate delta-isomerase; type 2 is 86.85
1qop_A 268 Tryptophan synthase alpha chain; lyase, carbon-oxy 86.73
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 86.62
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 86.54
1xhf_A123 DYE resistance, aerobic respiration control protei 86.34
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 86.25
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 86.08
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 86.0
3eqz_A135 Response regulator; structural genomics, unknown f 85.93
3vnd_A 267 TSA, tryptophan synthase alpha chain; psychrophili 85.93
3n53_A140 Response regulator receiver modulated diguanylate; 85.85
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 85.84
4gbu_A400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 85.53
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 85.49
3cnb_A143 DNA-binding response regulator, MERR family; signa 85.42
2nv1_A 305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 85.25
1r2r_A248 TIM, triosephosphate isomerase; closed loop confor 85.21
3krs_A271 Triosephosphate isomerase; ssgcid, SBRI, emerald b 85.18
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 85.17
3jr2_A 218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 85.15
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 85.0
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 84.73
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 84.72
3nav_A 271 Tryptophan synthase alpha chain; alpha subunit, st 84.71
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 84.7
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 84.7
1ney_A247 TIM, triosephosphate isomerase; yeast, DHAP, dihyd 84.62
2csu_A457 457AA long hypothetical protein; structural genomi 84.46
2dqw_A 294 Dihydropteroate synthase; dimer, structural genomi 84.41
1kbi_A 511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 84.38
1viz_A 240 PCRB protein homolog; structural genomics, unknown 84.28
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 84.08
3cz5_A153 Two-component response regulator, LUXR family; str 84.0
1mvo_A136 PHOP response regulator; phosphate regulon, transc 83.85
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 83.72
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 83.63
1m6j_A261 TIM, TPI, triosephosphate isomerase; asymmetry, mo 83.56
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 83.31
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 83.22
1zgz_A122 Torcad operon transcriptional regulatory protein; 83.13
2f6u_A 234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 82.85
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 82.84
1ujp_A 271 Tryptophan synthase alpha chain; riken structural 82.76
3cg0_A140 Response regulator receiver modulated diguanylate 82.74
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 82.69
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 82.58
3qst_A255 Triosephosphate isomerase, putative; TIM barrel; 1 81.62
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 81.46
1ys7_A 233 Transcriptional regulatory protein PRRA; response 81.41
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 81.35
3na8_A 315 Putative dihydrodipicolinate synthetase; lyase; HE 81.3
3q9s_A249 DNA-binding response regulator; DNA binding protei 81.28
3s6d_A310 Putative triosephosphate isomerase; seattle struct 81.14
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 81.13
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 81.08
1tqj_A 230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 80.98
1dxe_A256 2-dehydro-3-deoxy-galactarate aldolase; class II a 80.83
3a10_A116 Response regulator; phosphoacceptor, signaling pro 80.48
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 80.46
3l21_A 304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 80.45
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 80.2
3qz6_A261 HPCH/HPAI aldolase; structural genomics, PSI-biolo 80.19
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 80.05
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
Probab=100.00  E-value=1e-32  Score=204.81  Aligned_cols=111  Identities=50%  Similarity=0.804  Sum_probs=104.1

Q ss_pred             CceEEEecCCCCHHhHHHhHhCCC--CCCEEEEEeeeCCCCCcccchhHHHHHHHHHhhCCCCcEEEEcCCChhhHHHHH
Q 033625            1 MRPGVALKPGTSVEEVYPLVEGAN--PVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPSLDIEVDGGLGPSTIAEAA   78 (115)
Q Consensus         1 ~k~Glal~p~t~~~~~~~~~~~~~--~vD~vlvm~v~pG~~gq~~~~~~~~ki~~l~~~~~~~~i~~dGGI~~~ni~~l~   78 (115)
                      +|+|+++||+||++.+++++   +  .+|+|++|+|+|||+||+|.+..++|++++|++.++++|+||||||.+|++++.
T Consensus       115 ~k~gvalnp~tp~~~~~~~l---~~g~~D~VlvmsV~pGf~gq~f~~~~l~ki~~lr~~~~~~~I~VdGGI~~~ti~~~~  191 (227)
T 1tqx_A          115 LWCGISIKPKTDVQKLVPIL---DTNLINTVLVMTVEPGFGGQSFMHDMMGKVSFLRKKYKNLNIQVDGGLNIETTEISA  191 (227)
T ss_dssp             CEEEEEECTTSCGGGGHHHH---TTTCCSEEEEESSCTTCSSCCCCGGGHHHHHHHHHHCTTCEEEEESSCCHHHHHHHH
T ss_pred             CeEEEEeCCCCcHHHHHHHh---hcCCcCEEEEeeeccCCCCcccchHHHHHHHHHHHhccCCeEEEECCCCHHHHHHHH
Confidence            58999999999999999999   8  899999999999999999999999999999998778999999999999999999


Q ss_pred             HcCCCEEEEcccccCCCCHHHHHHHHHHHHHHHhhc
Q 033625           79 SAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQKN  114 (115)
Q Consensus        79 ~~Gad~iv~Gsaif~~~d~~~~~~~l~~~~~~~~~~  114 (115)
                      ++|||++|+||+||+++||++++++|++.+++.++|
T Consensus       192 ~aGAd~~V~GsaIf~~~d~~~~i~~l~~~~~~~~~~  227 (227)
T 1tqx_A          192 SHGANIIVAGTSIFNAEDPKYVIDTMRVSVQKYLNN  227 (227)
T ss_dssp             HHTCCEEEESHHHHTCSSHHHHHHHHHHHHHHC---
T ss_pred             HcCCCEEEEeHHHhCCCCHHHHHHHHHHHHHHHhcC
Confidence            999999999999999999999999999988877654



>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 Back     alignment and structure
>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3eww_A Ompdecase, orotidine-5'-phosphate decarboxylase; TIM barrel, unusual catalysis, disease mutati glycosyltransferase, lyase, multifunctional enzyme; HET: U1P; 1.10A {Homo sapiens} PDB: 2qcl_A* 2qcm_A* 3ewu_A* 2qcf_A* 3ex6_A* 3ex4_A* 2qcd_A* 2qcc_A 2qcg_A* 2qch_A* 2qcn_A* 2qce_A* 3ewz_A* 3ex1_A* 3ex2_A* 3ex3_A* 3ex0_A* 3ex5_A* 3l0k_A* 3l0n_A* ... Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>3qw3_A Orotidine-5-phosphate decarboxylase/orotate phosphoribosyltransferase, putative (OMPDCASE-OPRTASE,...; orotidine monophosphate decarboxylase; 1.70A {Leishmania infantum} Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger M structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>2fds_A Orotidine-monophosphate-decarboxylase; TIM barrel, structural genomics, structural genomics consortium, SGC, unknown function; 1.72A {Plasmodium berghei} SCOP: c.1.2.3 PDB: 2aqw_A Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>2ffc_A Orotidine 5-monophosphate decarboxylase; PV-PF10_0225, SGC, structural genomics, struc genomics consortium, lyase; HET: U5P; 1.70A {Plasmodium vivax} SCOP: c.1.2.3 PDB: 2guu_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>3g3d_A UMP synthase, uridine 5'-monophosphate synthase; C-terminal domain, orotidine 5'-monophosphate decarboxylase, human, 5-fluoro-6-azido-UMP; HET: 5FU; 1.70A {Homo sapiens} PDB: 3bvj_A* 3mw7_A* 4hib_A* 4hkp_A* 2p1f_A 2eaw_A 3bgg_A* 3bgj_A* Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3gdm_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, K93R mutant, lyase, phosphoprotein; 1.60A {Saccharomyces cerevisiae} SCOP: c.1.2.3 PDB: 3gdl_A* 3gdk_A* 3gdt_A* 3gdr_A* 1dqw_A 1dqx_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2i14_A Nicotinate-nucleotide pyrophosphorylase; ligand binding, phosphoribosylpyrophosphate, Zn metal ION, structural genomics, PSI; HET: PCP; 2.90A {Pyrococcus furiosus} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>3n3m_A Orotidine 5'-phosphate decarboxylase; P. falciparum, 5'-monophosphate decarboxylase, 6- UMP, lyase; HET: PGE NUP; 1.47A {Plasmodium falciparum} SCOP: c.1.2.3 PDB: 2qaf_A* 3bar_A* 2q8z_A* 3mwa_A* 3n2m_A* 3bpw_A* 3n34_A* 3s9y_A* 2f84_A 2q8l_A 2za1_A* 2za2_A 2za3_A* 2zcg_A 3vi2_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>2jgq_A Triosephosphate isomerase; glycolysis, pentose shunt, gluconeogenesis, lipid synthesis, fatty acid biosynthesis; HET: QGA; 2.3A {Helicobacter pylori} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1yya_A Triosephosphate isomerase; riken structural genomics/proteom initiative, RSGI, structural genomics; 1.60A {Thermus thermophilus} Back     alignment and structure
>3sy1_A UPF0001 protein YGGS; engineered protein, structural genomics, PSI-biology, protei structure initiative; HET: MES; 1.47A {Escherichia coli} PDB: 1w8g_A* Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>2j27_A Triosephosphate isomerase glycosomal; TIM, 2PG, LOOP7, glycosome, TIM-barrel, gluconeogenesis, lipid synthesis, atomic resolution; 1.15A {Trypanosoma brucei brucei} PDB: 2j24_A 1kv5_A 1tpe_A 1tsi_A* 3tim_A 2v2c_A 2v0t_A 1tri_A 1tti_A 1mss_A 1ttj_A* 2wsq_A 2y70_A 2y6z_A* 1ml1_A 2wsr_A 3q37_A 2v2h_A 2v2d_A 1dkw_A ... Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>2yc6_A Triosephosphate isomerase; glycolysis; HET: PGA; 1.45A {Giardia intestinalis} PDB: 2dp3_A 2yc7_A* 3pf3_A 2yc8_A Back     alignment and structure
>2btm_A TIM, protein (triosephosphate isomerase); thermophilic triose-phosphate, glycolysis; 2.40A {Geobacillus stearothermophilus} SCOP: c.1.1.1 PDB: 1btm_A Back     alignment and structure
>1o5x_A TIM, triosephosphate isomerase; 2- phosphoglycerate, META-phosphate, catalytic LOOP6; HET: 2PG; 1.10A {Plasmodium falciparum} SCOP: c.1.1.1 PDB: 1lzo_A 1m7o_A* 1m7p_A* 1lyx_A* 1ydv_A 2vfi_A* 3psw_A 3psv_A 3pwa_A 2vfh_A* 2vff_A 2vfg_A* 1vga_A 1woa_A* 1wob_A 3pvf_A 3py2_A 2vfd_A 2vfe_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>1aw2_A Triosephosphate isomerase; psychrophilic, vibrio marinus; 2.65A {Moritella marina} SCOP: c.1.1.1 PDB: 1aw1_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>1tre_A Triosephosphate isomerase; intramolecular oxidoreductase; 2.60A {Escherichia coli} SCOP: c.1.1.1 PDB: 1tmh_A Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>2f7f_A Nicotinate phosphoribosyltransferase, putative; structural genomics, PSI; 2.00A {Enterococcus faecalis} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>2xij_A Methylmalonyl-COA mutase, mitochondrial; isomerase, organic aciduria, vitamin B12; HET: B12 5AD BTB; 1.95A {Homo sapiens} PDB: 2xiq_A* 3bic_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1b9b_A TIM, protein (triosephosphate isomerase); thermophilic; 2.85A {Thermotoga maritima} SCOP: c.1.1.1 Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>1ct5_A Protein (yeast hypothetical protein, selenoMet); TIM barrel, pyridoxal-5'-phosphate, selenomethionine, structural genomics, PSI; HET: PLP; 2.00A {Saccharomyces cerevisiae} SCOP: c.1.6.2 PDB: 1b54_A* Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>1mo0_A TIM, triosephosphate isomerase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; 1.70A {Caenorhabditis elegans} SCOP: c.1.1.1 Back     alignment and structure
>3r79_A Uncharacterized protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium, TIM barrel; HET: PLP; 1.90A {Agrobacterium tumefaciens} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>3m9y_A Triosephosphate isomerase; TIM barrel, glycolysis, gluconeogenesis, pentose; HET: CIT; 1.90A {Staphylococcus aureus} SCOP: c.1.1.1 PDB: 3uwv_A* 3uwu_A* 3uww_A* 3uwy_A 3uwz_A* Back     alignment and structure
>1req_A Methylmalonyl-COA mutase; isomerase, intramolecular transferase; HET: B12 DCA; 2.00A {Propionibacterium freudenreichii subspshermanii} SCOP: c.1.19.1 c.23.6.1 PDB: 2req_A* 3req_A* 4req_A* 6req_A* 7req_A* 5req_A* 1e1c_A* Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>2i9e_A Triosephosphate isomerase; 2.00A {Tenebrio molitor} Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>1h7n_A 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae} SCOP: c.1.10.3 PDB: 1h7p_A* 1h7r_A* 1ohl_A* 1qml_A 1qnv_A 1w31_A* 1h7o_A* 1eb3_A* 1gjp_A* 1ylv_A* 1aw5_A Back     alignment and structure
>2vxn_A Triosephosphate isomerase; fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, TIM, glycosome; HET: PGH PGA; 0.82A {Leishmania mexicana} PDB: 1if2_A* 1qds_A 1n55_A* 2y61_A 2y62_A 2y63_A 1amk_A 1tpf_A 1iig_A 1ag1_O* 1iih_A 1tpd_A 1trd_A* 2v5l_A 4tim_A* 5tim_A 6tim_A* Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1r2r_A TIM, triosephosphate isomerase; closed loop conformation in the ligand-free state, conformational heterogeneity, TIM-barrel; 1.50A {Oryctolagus cuniculus} SCOP: c.1.1.1 PDB: 1r2s_A 1r2t_A 2jk2_A 1wyi_A 1hti_A 2vom_A 1tph_1* 8tim_A 1sw3_A 1spq_A 1tpb_1* 1tpw_A* 1sw7_A 1tpu_A* 1tpc_1* 1ssd_A 1ssg_A 1sw0_A 1sq7_A 1tpv_A* ... Back     alignment and structure
>3krs_A Triosephosphate isomerase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, I structural genomics; 1.55A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>1ney_A TIM, triosephosphate isomerase; yeast, DHAP, dihydroxyacetone phosphate, michaelis complex; HET: FTR 13P; 1.20A {Saccharomyces cerevisiae} SCOP: c.1.1.1 PDB: 1nf0_A* 1i45_A* 1ypi_A 2ypi_A 7tim_A* 3ypi_A* Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1m6j_A TIM, TPI, triosephosphate isomerase; asymmetry, monomer stability; 1.50A {Entamoeba histolytica} SCOP: c.1.1.1 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3qst_A Triosephosphate isomerase, putative; TIM barrel; 1.75A {Trichomonas vaginalis} PDB: 3qsr_A Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3s6d_A Putative triosephosphate isomerase; seattle structural genomics center for infectious disease, S pathogenic fungus, eukaryote; 2.20A {Coccidioides immitis RS} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3qz6_A HPCH/HPAI aldolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.00A {Desulfitobacterium hafniense} SCOP: c.1.12.0 Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 115
d1h1ya_220 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {R 1e-29
d1rpxa_230 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {P 7e-29
d1tqja_221 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {S 5e-27
d1tqxa_221 c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {P 2e-24
d2flia1217 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimera 4e-23
d1q6oa_213 c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarbo 4e-22
d2czda1206 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decar 4e-07
d1km4a_212 c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxyl 1e-04
d1dbta_237 c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxyl 2e-04
d1o4ua1170 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosy 4e-04
d1eixa_231 c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxyl 0.002
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Length = 220 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: D-ribulose-5-phosphate 3-epimerase
domain: D-ribulose-5-phosphate 3-epimerase
species: Rice (Oryza sativa) [TaxId: 4530]
 Score =  104 bits (259), Expect = 1e-29
 Identities = 91/112 (81%), Positives = 101/112 (90%)

Query: 1   MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPS 60
           MRPGV+L+PGT VEEV+PLVE  NPVE+VLVMTVEPGFGGQKFMPEMM+KVR+LR +YPS
Sbjct: 109 MRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPS 168

Query: 61  LDIEVDGGLGPSTIAEAASAGANCIVAGSSVFGAPEPAHVISLMRKSVEDAQ 112
           LDIEVDGGLGPSTI  AASAGANCIVAGSS+FGA EP  VIS +RKSVE +Q
Sbjct: 169 LDIEVDGGLGPSTIDVAASAGANCIVAGSSIFGAAEPGEVISALRKSVEGSQ 220


>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 230 Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Length = 221 Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Length = 221 Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Length = 217 Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Length = 213 Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Length = 206 Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 212 Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Length = 237 Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 170 Back     information, alignment and structure
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 100.0
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 100.0
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 99.98
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 99.97
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 99.97
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 99.69
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 99.68
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 99.58
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.88
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 98.88
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 98.83
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 98.8
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 98.74
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 98.74
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 98.53
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 98.47
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 98.45
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 98.42
d1dbta_237 Orotidine 5'-monophosphate decarboxylase (OMP deca 98.26
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 98.24
d1eixa_231 Orotidine 5'-monophosphate decarboxylase (OMP deca 98.19
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 98.15
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 98.15
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 98.13
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 98.1
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 98.08
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 98.02
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 97.89
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 97.66
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 97.66
d1h5ya_ 252 Cyclase subunit (or domain) of imidazoleglycerolph 97.56
d1thfd_ 253 Cyclase subunit (or domain) of imidazoleglycerolph 97.52
d1ka9f_ 251 Cyclase subunit (or domain) of imidazoleglycerolph 97.5
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 97.47
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 97.47
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 97.43
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 97.34
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 97.33
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 97.27
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 97.22
d1jvna1 323 Cyclase subunit (or domain) of imidazoleglycerolph 97.21
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 97.19
d1qo2a_ 241 Phosphoribosylformimino-5-aminoimidazole carboxami 97.13
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 97.01
d1dqwa_267 Orotidine 5'-monophosphate decarboxylase (OMP deca 97.0
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 96.92
d1vqta1198 Orotidine 5'-monophosphate decarboxylase (OMP deca 96.87
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 96.85
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 96.82
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 96.81
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 96.77
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 96.68
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 96.67
d1vzwa1 239 Phosphoribosylformimino-5-aminoimidazole carboxami 96.66
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 96.65
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 96.63
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 96.51
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 96.46
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 96.32
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 96.27
d1eepa_ 388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 96.26
d2ffca1332 Orotidine 5'-monophosphate decarboxylase (OMP deca 96.16
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 96.03
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 95.89
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 95.82
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 95.75
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 95.71
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 95.58
d2q8za1323 Protozoan orotidine monophosphate decarboxylase {P 95.51
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 95.41
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 95.37
d1nsja_205 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 95.33
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 95.25
d1jr1a1 378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 95.22
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 95.22
d1v5xa_200 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 95.16
d1vrda1 330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 95.1
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 95.04
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 95.02
d2fdsa1324 Protozoan orotidine monophosphate decarboxylase {P 94.99
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 94.89
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 94.76
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 94.65
d1zfja1 365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 94.58
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 94.45
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 94.42
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 94.3
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 94.12
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 93.94
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 93.72
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 93.72
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 93.71
d7reqb2163 Methylmalonyl-CoA mutase beta subunit, C-terminal 93.71
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 93.57
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 93.47
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 93.37
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 93.31
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 93.3
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 93.12
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 93.06
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 92.52
d2i14a1279 Nicotinate-nucleotide pyrophosphorylase PF1904 {Py 92.5
d3bula2156 Methionine synthase, C-terminal domain {Escherichi 92.5
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 92.45
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 92.42
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 92.39
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 92.34
d1qkka_140 Transcriptional regulatory protein DctD, receiver 91.65
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 91.51
d1ytda1270 Nicotinate phosphoribosyltransferase Ta1145 {Therm 91.32
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 91.19
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 91.08
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 91.07
d1h7na_340 5-aminolaevulinate dehydratase, ALAD (porphobilino 90.9
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 90.56
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 89.89
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 89.13
d1k68a_140 Response regulator for cyanobacterial phytochrome 88.33
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 88.19
d2z06a1 252 Hypothetical protein TTHA0625 {Thermus thermophilu 88.12
d1pv8a_320 5-aminolaevulinate dehydratase, ALAD (porphobilino 88.03
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 88.02
d1ofda2809 Alpha subunit of glutamate synthase, central and F 87.93
d5ruba1320 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 87.76
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 87.58
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 86.91
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 86.9
d1t70a_ 255 Putative phosphatase DR1281 {Deinococcus radiodura 86.77
d1k66a_149 Response regulator for cyanobacterial phytochrome 86.73
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 86.41
d1l6sa_323 5-aminolaevulinate dehydratase, ALAD (porphobilino 86.28
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 85.96
d2f7fa1 345 Putative nicotinate phosphoribosyltransferase EF26 85.91
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 85.82
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 85.46
d1pvna1 362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 85.32
d1p0ka_ 329 Isopentenyl-diphosphate delta-isomerase {Bacillus 85.13
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 84.8
d1s8na_190 Probable two-component system transcriptional regu 84.62
d1xrsb1160 D-lysine 5,6-aminomutase beta subunit KamE, C-term 83.88
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 83.44
d1i3ca_144 Response regulator for cyanobacterial phytochrome 83.39
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 83.14
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 82.66
d2d69a1291 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 82.43
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 81.84
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 81.61
d1t71a_ 281 Hypothetical protein MPN349 {Mycoplasma pneumoniae 81.53
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 81.17
d1trea_255 Triosephosphate isomerase {Escherichia coli [TaxId 81.16
d1eo1a_124 Hypothetical protein MTH1175 {Archaeon Methanobact 81.12
d1yioa2128 Response regulatory protein StyR, N-terminal domai 80.32
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Ribulose-phoshate binding barrel
family: D-ribulose-5-phosphate 3-epimerase
domain: D-ribulose-5-phosphate 3-epimerase
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=100.00  E-value=4.8e-34  Score=209.25  Aligned_cols=112  Identities=81%  Similarity=1.285  Sum_probs=106.2

Q ss_pred             CceEEEecCCCCHHhHHHhHhCCCCCCEEEEEeeeCCCCCcccchhHHHHHHHHHhhCCCCcEEEEcCCChhhHHHHHHc
Q 033625            1 MRPGVALKPGTSVEEVYPLVEGANPVEMVLVMTVEPGFGGQKFMPEMMDKVRSLRNRYPSLDIEVDGGLGPSTIAEAASA   80 (115)
Q Consensus         1 ~k~Glal~p~t~~~~~~~~~~~~~~vD~vlvm~v~pG~~gq~~~~~~~~ki~~l~~~~~~~~i~~dGGI~~~ni~~l~~~   80 (115)
                      +++|||+||+||++.+++++...+.+|+|++|+|+|||+||+|.+.+++|++++|+.+++++|+||||||.+|++.+.++
T Consensus       109 ~~~Glal~p~t~~~~~~~~l~~~~~~d~vlim~v~PG~~GQ~f~~~~l~kI~~l~~~~~~~~I~VDGGIn~~~i~~l~~a  188 (220)
T d1h1ya_         109 MRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPGFGGQKFMPEMMEKVRALRKKYPSLDIEVDGGLGPSTIDVAASA  188 (220)
T ss_dssp             CEEEEEECTTSCGGGGHHHHHSSSCCSEEEEESSCTTCSSCCCCGGGHHHHHHHHHHCTTSEEEEESSCSTTTHHHHHHH
T ss_pred             CCcceeeccccchhHHHHHHhcccccceEEEEecCCCCcccccchhhhHHHHHHHhcCCCceEEEEecCCHHHHHHHHHC
Confidence            58999999999999999998655678999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCEEEEcccccCCCCHHHHHHHHHHHHHHHh
Q 033625           81 GANCIVAGSSVFGAPEPAHVISLMRKSVEDAQ  112 (115)
Q Consensus        81 Gad~iv~Gsaif~~~d~~~~~~~l~~~~~~~~  112 (115)
                      |||.+|+||+||+++|+.+++++||+.+++++
T Consensus       189 Gad~~V~GS~if~~~d~~~~i~~lr~~~~~a~  220 (220)
T d1h1ya_         189 GANCIVAGSSIFGAAEPGEVISALRKSVEGSQ  220 (220)
T ss_dssp             TCCEEEESHHHHTSSCHHHHHHHHHHHHHHC-
T ss_pred             CCCEEEECHHHHCCCCHHHHHHHHHHHHHhcC
Confidence            99999999999999999999999999998764



>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dqwa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vqta1 c.1.2.3 (A:1-198) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d2ffca1 c.1.2.3 (A:20-351) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d2q8za1 c.1.2.3 (A:1-323) Protozoan orotidine monophosphate decarboxylase {Plasmodium falciparum (isolate 3D7) (Plasmodium falciparum 3D7) [TaxId: 36329]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2fdsa1 c.1.2.3 (A:1-324) Protozoan orotidine monophosphate decarboxylase {Plasmodium berghei [TaxId: 5821]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2i14a1 c.1.17.1 (A:111-389) Nicotinate-nucleotide pyrophosphorylase PF1904 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ytda1 c.1.17.1 (A:120-389) Nicotinate phosphoribosyltransferase Ta1145 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z06a1 d.159.1.10 (A:1-252) Hypothetical protein TTHA0625 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d5ruba1 c.1.14.1 (A:138-457) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t70a_ d.159.1.9 (A:) Putative phosphatase DR1281 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2f7fa1 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1t71a_ d.159.1.9 (A:) Hypothetical protein MPN349 {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1trea_ c.1.1.1 (A:) Triosephosphate isomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eo1a_ c.55.5.1 (A:) Hypothetical protein MTH1175 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure