Citrus Sinensis ID: 033753


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MATFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVHLTLLLSIWLNLI
ccccccHHHHHccccccccccccHHHHHHccccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccc
cccHHHHHHHHHcccccccccccccccEccccccEEcccccccccccccccEEEEEcccHHHHHHHHHHHHHHHccccccccccHcHHHHcccccHHHHHHHHHHHHHcccc
MATFSAITSvifapslkpslsnnviaerTSNLKMAiggwrknrfpslktnrfcvscsakpeTVQKVCEIVRRQlalpaeteltseskfsalgadsldTVHLTLLLSIWLNLI
matfsaitsvifapslkpslsnNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKfsalgadsldtVHLTLLLSIWLNLI
MATFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVHltlllsiwlnlI
*****AITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETEL****KFSALGADSLDTVHLTLLLSIWLNL*
*******************************************************CSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVHLTLLLSIWLNLI
MATFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVHLTLLLSIWLNLI
*******************************************FPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVHLTLLLSIWLNLI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVHLTLLLSIWLNLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query112 2.2.26 [Sep-21-2011]
P93092136 Acyl carrier protein 1, c N/A no 0.848 0.698 0.457 3e-16
P52413143 Acyl carrier protein 3, c N/A no 0.937 0.734 0.458 2e-15
P52411140 Acyl carrier protein 1, c N/A no 0.580 0.464 0.579 3e-15
P52414139 Acyl carrier protein 4, c N/A no 0.580 0.467 0.573 5e-15
Q9SW21137 Acyl carrier protein 4, c yes no 0.625 0.510 0.577 5e-15
P15543132 Acyl carrier protein 3, c N/A no 0.616 0.522 0.549 4e-14
P52412137 Acyl carrier protein 2, c N/A no 0.589 0.481 0.545 4e-13
P25701136 Acyl carrier protein 2, c no no 0.491 0.404 0.6 6e-13
P25702136 Acyl carrier protein 3, c no no 0.607 0.5 0.514 1e-12
P07088134 Acyl carrier protein SF2, N/A no 0.544 0.455 0.491 4e-12
>sp|P93092|ACP1_CASGL Acyl carrier protein 1, chloroplastic OS=Casuarina glauca GN=ACP1 PE=2 SV=1 Back     alignment and function desciption
 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 65/105 (61%), Gaps = 10/105 (9%)

Query: 3   TFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLK--TNRFCVSCSAKP 60
           T ++I+   F  SL PS        R SNL+      +   F  L+  + RF V C+AKP
Sbjct: 5   TGTSISMASFKASLAPS--------RVSNLRSVSLPIKGKSFAPLRMRSARFVVCCAAKP 56

Query: 61  ETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVHLTLLL 105
           ETV+KVC IV++QLALP ++ +T ESKF+ LGADSLDTV + + L
Sbjct: 57  ETVEKVCAIVKKQLALPDDSAVTGESKFATLGADSLDTVEIVMGL 101




Carrier of the growing fatty acid chain in fatty acid biosynthesis.
Casuarina glauca (taxid: 3522)
>sp|P52413|ACP3_CUPLA Acyl carrier protein 3, chloroplastic OS=Cuphea lanceolata GN=ACL1.3 PE=2 SV=1 Back     alignment and function description
>sp|P52411|ACP1_CUPLA Acyl carrier protein 1, chloroplastic OS=Cuphea lanceolata GN=ACL1.1 PE=2 SV=1 Back     alignment and function description
>sp|P52414|ACP4_CUPLA Acyl carrier protein 4, chloroplastic OS=Cuphea lanceolata GN=ACL1 PE=3 SV=1 Back     alignment and function description
>sp|Q9SW21|ACP4_ARATH Acyl carrier protein 4, chloroplastic OS=Arabidopsis thaliana GN=ACP4 PE=1 SV=1 Back     alignment and function description
>sp|P15543|ACP3_HORVU Acyl carrier protein 3, chloroplastic OS=Hordeum vulgare GN=ACL1.3 PE=1 SV=2 Back     alignment and function description
>sp|P52412|ACP2_CUPLA Acyl carrier protein 2, chloroplastic OS=Cuphea lanceolata GN=ACL1.2 PE=2 SV=1 Back     alignment and function description
>sp|P25701|ACP2_ARATH Acyl carrier protein 2, chloroplastic OS=Arabidopsis thaliana GN=ACP2 PE=1 SV=2 Back     alignment and function description
>sp|P25702|ACP3_ARATH Acyl carrier protein 3, chloroplastic OS=Arabidopsis thaliana GN=ACP3 PE=1 SV=2 Back     alignment and function description
>sp|P07088|ACP_BRACM Acyl carrier protein SF2, chloroplastic OS=Brassica campestris GN=Acl1.1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
225425224139 PREDICTED: acyl carrier protein 4, chlor 0.919 0.741 0.657 4e-28
356527612142 PREDICTED: acyl carrier protein 1, chlor 0.928 0.732 0.566 1e-23
255540085137 acyl carrier protein, putative [Ricinus 0.919 0.751 0.561 1e-21
224119790138 predicted protein [Populus trichocarpa] 0.955 0.775 0.553 4e-21
357520563137 Acyl carrier protein [Medicago truncatul 0.973 0.795 0.522 2e-20
388516599136 unknown [Lotus japonicus] 0.901 0.742 0.547 1e-19
356513457143 PREDICTED: acyl carrier protein 4, chlor 0.928 0.727 0.532 2e-19
255630845131 unknown [Glycine max] 0.928 0.793 0.532 2e-19
357520565139 Acyl carrier protein [Medicago truncatul 0.982 0.791 0.508 3e-19
284808851140 acyl carrier protein 4 [Arachis hypogaea 0.848 0.678 0.530 4e-19
>gi|225425224|ref|XP_002267614.1| PREDICTED: acyl carrier protein 4, chloroplastic [Vitis vinifera] gi|296088168|emb|CBI35660.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 69/105 (65%), Positives = 81/105 (77%), Gaps = 2/105 (1%)

Query: 1   MATFSAITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKTNRFCVSCSAKP 60
           MA  SA TSV F  SLK  L +  I  + S+LKM   GW K+ FPSL+T+RF VSCSAKP
Sbjct: 1   MAAVSA-TSVTFGSSLKL-LKSRQITGKASSLKMVTVGWTKSGFPSLRTSRFRVSCSAKP 58

Query: 61  ETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVHLTLLL 105
           ETVQKVCEIV++QLALPAE+ELT ESKF+ALGADSLDTV + + L
Sbjct: 59  ETVQKVCEIVKKQLALPAESELTPESKFAALGADSLDTVEIVMSL 103




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356527612|ref|XP_003532402.1| PREDICTED: acyl carrier protein 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|255540085|ref|XP_002511107.1| acyl carrier protein, putative [Ricinus communis] gi|223550222|gb|EEF51709.1| acyl carrier protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224119790|ref|XP_002318163.1| predicted protein [Populus trichocarpa] gi|222858836|gb|EEE96383.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357520563|ref|XP_003630570.1| Acyl carrier protein [Medicago truncatula] gi|355524592|gb|AET05046.1| Acyl carrier protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|388516599|gb|AFK46361.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356513457|ref|XP_003525430.1| PREDICTED: acyl carrier protein 4, chloroplastic [Glycine max] Back     alignment and taxonomy information
>gi|255630845|gb|ACU15785.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357520565|ref|XP_003630571.1| Acyl carrier protein [Medicago truncatula] gi|355524593|gb|AET05047.1| Acyl carrier protein [Medicago truncatula] gi|388512039|gb|AFK44081.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|284808851|gb|ADB94673.1| acyl carrier protein 4 [Arachis hypogaea] gi|284808861|gb|ADB94678.1| acyl carrier protein 4 [Arachis hypogaea] gi|288551670|gb|ADC53305.1| acyl carrier protein [Arachis hypogaea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query112
TAIR|locus:2199461136 ACP2 "AT1G54580" [Arabidopsis 0.830 0.683 0.421 7.1e-13
TAIR|locus:2199517136 ACP3 "acyl carrier protein 3" 0.553 0.455 0.546 8.2e-12
TAIR|locus:2181216139 ACP5 "AT5G27200" [Arabidopsis 0.767 0.618 0.418 1.3e-11
TAIR|locus:2114820137 ACP1 "acyl carrier protein 1" 0.482 0.394 0.518 3.2e-10
TAIR|locus:2199461 ACP2 "AT1G54580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 170 (64.9 bits), Expect = 7.1e-13, P = 7.1e-13
 Identities = 40/95 (42%), Positives = 57/95 (60%)

Query:     7 ITSVIFAPSLKPSLSNNVIAERTSNLKMAIGGWRKNRFPSLKT--NRFCVSCSAKPETVQ 64
             + S+  + S+        +A   S +K    G R +   +L+    R  VSC+AKPETV 
Sbjct:     1 MASIAASASISLQARPRQLAIAASQVKSFSNGRRSSLSFNLRQLPTRLTVSCAAKPETVD 60

Query:    65 KVCEIVRRQLALPAETELTSESKFSALGADSLDTV 99
             KVC +VR+QL+L    E+T+ +KF+ALGADSLDTV
Sbjct:    61 KVCAVVRKQLSLKEADEITAATKFAALGADSLDTV 95




GO:0006633 "fatty acid biosynthetic process" evidence=TAS
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0031177 "phosphopantetheine binding" evidence=IEA
GO:0000036 "ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process" evidence=IDA
TAIR|locus:2199517 ACP3 "acyl carrier protein 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2181216 ACP5 "AT5G27200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114820 ACP1 "acyl carrier protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00006175001
RecName- Full=Acyl carrier protein;; Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity) (139 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00007299001
SubName- Full=Chromosome chr2 scaffold_187, whole genome shotgun sequence; (431 aa)
     0.845
GSVIVG00024012001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (392 aa)
    0.783
GSVIVG00016391001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (405 aa)
      0.577
GSVIVG00003432001
SubName- Full=Chromosome undetermined scaffold_143, whole genome shotgun sequence; (463 aa)
      0.569
GSVIVG00025980001
SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (418 aa)
      0.563
GSVIVG00034037001
SubName- Full=Chromosome chr9 scaffold_7, whole genome shotgun sequence; (502 aa)
      0.489
GSVIVG00009555001
SubName- Full=Chromosome chr12 scaffold_238, whole genome shotgun sequence; (211 aa)
      0.488
GSVIVG00034687001
RecName- Full=Acyl-[acyl-carrier protein] desaturase; EC=1.14.19.2;; Converts stearoyl-ACP to o [...] (392 aa)
       0.483
GSVIVG00034684001
SubName- Full=Chromosome chr5 scaffold_72, whole genome shotgun sequence;; Converts stearoyl-AC [...] (387 aa)
       0.483
GSVIVG00034679001
RecName- Full=Acyl-[acyl-carrier protein] desaturase; EC=1.14.19.2;; Converts stearoyl-ACP to o [...] (352 aa)
       0.483

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
TIGR0051777 TIGR00517, acyl_carrier, acyl carrier protein 7e-07
PRK0098278 PRK00982, acpP, acyl carrier protein; Provisional 1e-06
CHL0012482 CHL00124, acpP, acyl carrier protein; Validated 7e-06
>gnl|CDD|213536 TIGR00517, acyl_carrier, acyl carrier protein Back     alignment and domain information
 Score = 43.2 bits (102), Expect = 7e-07
 Identities = 20/46 (43%), Positives = 31/46 (67%), Gaps = 2/46 (4%)

Query: 61  ETVQKVCEIVRRQLALPAETELTSESKFSA-LGADSLDTVHLTLLL 105
           E  +KV  I++ QL +  E ++T++++F   LGADSLDTV L + L
Sbjct: 3   EIFEKVKAIIKEQLNV-DEDQITTDARFVEDLGADSLDTVELVMAL 47


This small protein has phosphopantetheine covalently bound to a Ser residue. It acts as a carrier of the growing fatty acid chain, which is bound to the prosthetic group, during fatty acid biosynthesis. Homologous phosphopantetheine-binding domains are found in longer proteins. Acyl carrier proteins scoring above the noise cutoff but below the trusted cutoff may be specialized versions. These include those involved in mycolic acid biosynthesis in the Mycobacteria, lipid A biosynthesis in Rhizobium, actinorhodin polyketide synthesis in Streptomyces coelicolor, etc. This protein is not found in the Archaea.Gene name acpP.S (Ser) at position 37 in the seed alignment, in the motif DSLD, is the phosphopantetheine attachment site [Fatty acid and phospholipid metabolism, Biosynthesis]. Length = 77

>gnl|CDD|179197 PRK00982, acpP, acyl carrier protein; Provisional Back     alignment and domain information
>gnl|CDD|177047 CHL00124, acpP, acyl carrier protein; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 112
KOG1748131 consensus Acyl carrier protein/NADH-ubiquinone oxi 99.67
PRK0711779 acyl carrier protein; Validated 99.59
PRK0582884 acyl carrier protein; Validated 99.5
PRK0763986 acyl carrier protein; Provisional 99.49
PRK0535082 acyl carrier protein; Provisional 99.47
PRK1244980 acyl carrier protein; Provisional 99.46
PRK0588391 acyl carrier protein; Validated 99.45
PRK0817282 putative acyl carrier protein IacP; Validated 99.43
PRK0650893 acyl carrier protein; Provisional 99.43
CHL0012482 acpP acyl carrier protein; Validated 99.42
PTZ00171148 acyl carrier protein; Provisional 99.36
TIGR0051777 acyl_carrier acyl carrier protein. S (Ser) at posi 99.36
COG023680 AcpP Acyl carrier protein [Lipid metabolism / Seco 99.34
PRK0918489 acyl carrier protein; Provisional 99.3
PRK0098278 acpP acyl carrier protein; Provisional 99.16
PRK0708183 acyl carrier protein; Provisional 99.13
PF0055067 PP-binding: Phosphopantetheine attachment site; In 99.11
PRK0508778 D-alanine--poly(phosphoribitol) ligase subunit 2; 98.99
TIGR0168873 dltC D-alanine--poly(phosphoribitol) ligase, subun 98.62
PF1457396 PP-binding_2: Acyl-carrier; PDB: 3CE7_A. 98.21
smart0082386 PKS_PP Phosphopantetheine attachment site. Phospho 97.99
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 97.96
PRK06060 705 acyl-CoA synthetase; Validated 97.47
PF07377111 DUF1493: Protein of unknown function (DUF1493); In 97.26
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 96.95
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 96.63
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 96.6
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 96.59
PRK12467 3956 peptide synthase; Provisional 96.16
PRK05691 4334 peptide synthase; Validated 95.45
PRK12467 3956 peptide synthase; Provisional 95.17
PRK123165163 peptide synthase; Provisional 95.14
COG343374 Aryl carrier domain [Secondary metabolites biosynt 95.12
PRK056914334 peptide synthase; Validated 94.99
PRK12316 5163 peptide synthase; Provisional 94.47
TIGR02372 386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 91.42
>KOG1748 consensus Acyl carrier protein/NADH-ubiquinone oxidoreductase, NDUFAB1/SDAP subunit [Energy production and conversion; Lipid transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
Probab=99.67  E-value=2.6e-17  Score=119.53  Aligned_cols=56  Identities=36%  Similarity=0.550  Sum_probs=53.4

Q ss_pred             CCChHHHHHHHHHHHHHhcCCCCCCCCCCCCCcc-ccCCchhhHHHHHHHHHHHcCCC
Q 033753           56 CSAKPETVQKVCEIVRRQLALPAETELTSESKFS-ALGADSLDTVHLTLLLSIWLNLI  112 (112)
Q Consensus        56 ~~~~~ei~ekV~eIl~~~l~l~~~~~It~es~f~-DLG~DSLD~vEIv~~LEeeFgI~  112 (112)
                      |.+++++.++|.++|+.+..+++ +.++++++|. |||+||||+|||||+|||||||.
T Consensus        48 ~l~k~~v~~RVl~VVk~~dki~~-~k~~~~s~f~~DLGlDSLD~VEiVMAlEEEFgiE  104 (131)
T KOG1748|consen   48 CLAKKEVVDRVLDVVKKFDKIDP-SKLTTDSDFFKDLGLDSLDTVEIVMALEEEFGIE  104 (131)
T ss_pred             hhhHHHHHHHHHHHHHHhhcCCc-cccchhhHHHHhcCCcccccchhhhhhHHHhCCc
Confidence            99999999999999999999987 6899999997 99999999999999999999984



>PRK07117 acyl carrier protein; Validated Back     alignment and domain information
>PRK05828 acyl carrier protein; Validated Back     alignment and domain information
>PRK07639 acyl carrier protein; Provisional Back     alignment and domain information
>PRK05350 acyl carrier protein; Provisional Back     alignment and domain information
>PRK12449 acyl carrier protein; Provisional Back     alignment and domain information
>PRK05883 acyl carrier protein; Validated Back     alignment and domain information
>PRK08172 putative acyl carrier protein IacP; Validated Back     alignment and domain information
>PRK06508 acyl carrier protein; Provisional Back     alignment and domain information
>CHL00124 acpP acyl carrier protein; Validated Back     alignment and domain information
>PTZ00171 acyl carrier protein; Provisional Back     alignment and domain information
>TIGR00517 acyl_carrier acyl carrier protein Back     alignment and domain information
>COG0236 AcpP Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK09184 acyl carrier protein; Provisional Back     alignment and domain information
>PRK00982 acpP acyl carrier protein; Provisional Back     alignment and domain information
>PRK07081 acyl carrier protein; Provisional Back     alignment and domain information
>PF00550 PP-binding: Phosphopantetheine attachment site; InterPro: IPR006163 Phosphopantetheine (or pantetheine 4' phosphate) is the prosthetic group of acyl carrier proteins (ACP) in some multienzyme complexes where it serves as a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups [] Back     alignment and domain information
>PRK05087 D-alanine--poly(phosphoribitol) ligase subunit 2; Validated Back     alignment and domain information
>TIGR01688 dltC D-alanine--poly(phosphoribitol) ligase, subunit 2 Back     alignment and domain information
>PF14573 PP-binding_2: Acyl-carrier; PDB: 3CE7_A Back     alignment and domain information
>smart00823 PKS_PP Phosphopantetheine attachment site Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF07377 DUF1493: Protein of unknown function (DUF1493); InterPro: IPR010862 This family consists of several bacterial proteins of around 115 residues in length Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
2ava_A82 Solution Structure Of Stearoyl-Acyl Carrier Protein 2e-08
2xz0_D82 The Structure Of The 2:1 (Partially Occupied) Compl 7e-08
>pdb|2AVA|A Chain A, Solution Structure Of Stearoyl-Acyl Carrier Protein Length = 82 Back     alignment and structure

Iteration: 1

Score = 54.3 bits (129), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 25/43 (58%), Positives = 34/43 (79%) Query: 58 AKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVH 100 AK ET+ KV +IV+ +LAL A+ +T++S+FS LGADSLDTV Sbjct: 1 AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVE 43
>pdb|2XZ0|D Chain D, The Structure Of The 2:1 (Partially Occupied) Complex Between Stearoyl Acyl Carrier Protein Desaturase From Ricinus Communis (Castor Bean) And Acyl Carrier Protein. Length = 82 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query112
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 2e-12
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 2e-10
2kw2_A101 Specialized acyl carrier protein; structural genom 5e-07
1x3o_A80 Acyl carrier protein; structural genomics, riken s 6e-07
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 6e-07
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 8e-07
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 9e-07
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 1e-06
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 1e-06
2l4b_A88 Acyl carrier protein; infectious disease, human gr 1e-06
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 1e-06
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 1e-06
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 2e-06
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 2e-06
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 2e-06
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 2e-06
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 3e-06
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 2e-05
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 4e-05
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 4e-04
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 6e-04
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Length = 82 Back     alignment and structure
 Score = 56.5 bits (137), Expect = 2e-12
 Identities = 25/44 (56%), Positives = 35/44 (79%)

Query: 58  AKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVHL 101
           AK ET+ KV +IV+ +LAL A+  +T++S+FS LGADSLDTV +
Sbjct: 1   AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEI 44


>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Length = 100 Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Length = 101 Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Length = 80 Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Length = 97 Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} PDB: 3gzl_A* 2fq0_A* 2fq2_A* Length = 81 Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Length = 84 Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Length = 78 Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Length = 88 Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Length = 82 Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Length = 82 Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Length = 79 Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Length = 101 Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Length = 81 Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Length = 77 Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Length = 115 Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Length = 81 Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Length = 113 Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Length = 89 Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Length = 105 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
2l9f_A102 CALE8, meacp; transferase, acyl carrier protein; N 99.54
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 99.47
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 99.39
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 99.39
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 99.38
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 99.38
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 99.38
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 99.37
2lki_A105 Putative uncharacterized protein; helical bundle, 99.36
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 99.36
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 99.36
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 99.36
1x3o_A80 Acyl carrier protein; structural genomics, riken s 99.34
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 99.34
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 99.34
2l4b_A88 Acyl carrier protein; infectious disease, human gr 99.33
2kw2_A101 Specialized acyl carrier protein; structural genom 99.32
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 99.32
2kjs_A87 Putative acyl carrier protein; alpha, ACP, PNS, st 99.31
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 99.3
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 99.3
2lte_A103 Specialized acyl carrier protein; APO protein, tra 98.94
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 99.28
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 99.27
2amw_A83 Hypothetical protein NE2163; all helical protein, 99.26
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 99.25
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 99.18
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 99.18
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 99.18
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 99.14
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 99.14
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 99.13
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 99.13
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 99.02
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 99.0
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 98.99
2l22_A 212 Mupirocin didomain acyl carrier protein; biosynthe 98.87
2ju1_A95 Erythronolide synthase; carrier protein domain, mo 98.84
1dny_A91 Non-ribosomal peptide synthetase peptidyl carrier 98.71
4i4d_A93 Peptide synthetase NRPS type II-PCP; structural ge 98.7
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 98.63
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 98.08
2cq8_A110 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH 97.85
2jgp_A 520 Tyrocidine synthetase 3; multifunctional enzyme, a 97.59
2fq1_A287 Isochorismatase; ENTB, NRPS, multi-domain, ACP, hy 97.29
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 96.78
4f6l_B 508 AUSA reductase domain protein; thioester reductase 96.43
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 96.19
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 95.78
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 95.74
1dd4_C40 50S ribosomal protein L7/L12; dimer formation, fle 90.03
1zav_U30 50S ribosomal protein L7/L12; ribosome structure a 83.54
>2l9f_A CALE8, meacp; transferase, acyl carrier protein; NMR {Micromonospora echinospora} Back     alignment and structure
Probab=99.54  E-value=8.1e-15  Score=101.68  Aligned_cols=54  Identities=22%  Similarity=0.250  Sum_probs=50.4

Q ss_pred             ChHHHHHHHHHHHHHhcCCCCCCCCCCCCCcc-ccCCchhhHHHHHHHHHHHcCCC
Q 033753           58 AKPETVQKVCEIVRRQLALPAETELTSESKFS-ALGADSLDTVHLTLLLSIWLNLI  112 (112)
Q Consensus        58 ~~~ei~ekV~eIl~~~l~l~~~~~It~es~f~-DLG~DSLD~vEIv~~LEeeFgI~  112 (112)
                      +-.+|+++|++||.+++++++ +.|+|+++|. |||+||||+|||+|.+|++||+.
T Consensus        11 ~~~~I~~~V~~ilaE~lev~~-e~Vtpda~l~dDLglDSLd~VeLVm~lE~~fGi~   65 (102)
T 2l9f_A           11 AATGALELVRHLVAERAELPV-EVLRDDSRFLDDLHMSSITVGQLVNEAARAMGLS   65 (102)
T ss_dssp             SSCCHHHHHHHHHHHHTTSCS-SSCCTTCBTTTTSCCCHHHHHHHHHHHHHHHTCS
T ss_pred             hHHHHHHHHHHHHHHHHCCCH-HHcCCCcchhhhcCCcHHHHHHHHHHHHHHhCCC
Confidence            346899999999999999997 7999999997 99999999999999999999984



>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} SCOP: a.28.1.0 PDB: 3gzl_A* 2fq0_A* 2fq2_A* Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>2ju1_A Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A Back     alignment and structure
>1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A Back     alignment and structure
>4i4d_A Peptide synthetase NRPS type II-PCP; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MLY; 2.10A {Streptomyces verticillus} Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2cq8_A 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jgp_A Tyrocidine synthetase 3; multifunctional enzyme, antibiotic biosynthesis, condensatio domain, peptide bond formation, ligase; 1.85A {Brevibacillus brevis} Back     alignment and structure
>2fq1_A Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrolase; 2.30A {Escherichia coli} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>1dd4_C 50S ribosomal protein L7/L12; dimer formation, flexibility, hinge region, four-helix- bundle, five-helix- bundle, alpha-beta structure; HET: TBR; 2.40A {Thermotoga maritima} SCOP: a.108.1.1 Back     alignment and structure
>1zav_U 50S ribosomal protein L7/L12; ribosome structure and function, L10-L12 complex structure, L10E structure, L7/12 ribosomal stalk; 1.90A {Thermotoga maritima} SCOP: a.108.1.1 PDB: 1zaw_U 1zax_U 1dd3_C Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 112
d1f80d_74 a.28.1.1 (D:) Acyl carrier protein {Bacillus subti 6e-07
d1t8ka_77 a.28.1.1 (A:) Acyl carrier protein {Escherichia co 5e-04
d1or5a_82 a.28.1.1 (A:) Frenolicin polyketide synthase acyl 6e-04
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Length = 74 Back     information, alignment and structure

class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Bacillus subtilis [TaxId: 1423]
 Score = 41.7 bits (98), Expect = 6e-07
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 61  ETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVHLTLLLSIWLNL 111
           +T+++V +I+  +L +         S    LGAD LD V L + L    ++
Sbjct: 3   DTLERVTKIIVDRLGVDEADVKLEASFKEDLGADXLDVVELVMELEDEFDM 53


>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Length = 77 Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Length = 82 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query112
d1f80d_74 Acyl carrier protein {Bacillus subtilis [TaxId: 14 99.47
d1t8ka_77 Acyl carrier protein {Escherichia coli [TaxId: 562 99.45
d1vkua_85 Acyl carrier protein {Thermotoga maritima [TaxId: 99.36
d1klpa_115 Acyl carrier protein {Mycobacterium tuberculosis [ 99.25
d1dv5a_80 apo-D-alanyl carrier protein {Lactobacillus casei 99.18
d2jq4a183 Hypothetical protein Atu2571 {Agrobacterium tumefa 99.13
d1nq4a_95 Oxytetracycline polyketide synthase acyl carrier { 99.07
d1or5a_82 Frenolicin polyketide synthase acyl carrier protei 99.01
d2af8a_86 Actinorhodin polyketide synthase acyl carrier prot 98.98
d2pnga176 Type I fatty acid synthase ACP domain {Rat (Rattus 98.87
d2gdwa176 Peptidyl carrier protein (PCP), thioester domain { 98.73
d2gyc3147 Ribosomal protein L7/12, oligomerisation (N-termin 94.41
d1dd3a157 Ribosomal protein L7/12, oligomerisation (N-termin 87.55
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: All alpha proteins
fold: Acyl carrier protein-like
superfamily: ACP-like
family: Acyl-carrier protein (ACP)
domain: Acyl carrier protein
species: Bacillus subtilis [TaxId: 1423]
Probab=99.47  E-value=3.9e-14  Score=89.64  Aligned_cols=52  Identities=29%  Similarity=0.498  Sum_probs=48.9

Q ss_pred             HHHHHHHHHHHHHhcCCCCCCCCCCCCCcc-ccCCchhhHHHHHHHHHHHcCCC
Q 033753           60 PETVQKVCEIVRRQLALPAETELTSESKFS-ALGADSLDTVHLTLLLSIWLNLI  112 (112)
Q Consensus        60 ~ei~ekV~eIl~~~l~l~~~~~It~es~f~-DLG~DSLD~vEIv~~LEeeFgI~  112 (112)
                      .+++++|++|+++++++++ ++|+++++|. |||+|||+.+||++.||++||+.
T Consensus         2 ~dv~~~v~~iia~~l~~~~-~~i~~~~~~~~DlG~DSl~~vel~~~le~~f~i~   54 (74)
T d1f80d_           2 ADTLERVTKIIVDRLGVDE-ADVKLEASFKEDLGADXLDVVELVMELEDEFDME   54 (74)
T ss_dssp             CHHHHHHHHHHHHHSSCCS-SCCCTTCBHHHHSCCCHHHHHHHHHHHHHHTTCC
T ss_pred             hHHHHHHHHHHHHHHCcCH-HHcCCCccHHHhcCccHhHHHHHHHHHHHHhCCC
Confidence            4799999999999999987 7999999997 89999999999999999999984



>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d2gyc31 a.108.1.1 (3:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dd3a1 a.108.1.1 (A:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure