Citrus Sinensis ID: 033807

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE
ccccHHHHHHHHHHHcccccHHHHHHHHHcccEEEEEEEcccHHHHHHHHHccccccccccccccccccccccccEEEccccHHHHHHHHHHccccccccccccccccccc
ccccHHHHHHHcHHHcccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHcccccHHHHHccccccccEEEcccHHHHHHHHHHHccHHHccccccccccccc
mtvdrpfaekhyedlsskpffgSLIEYITSGPVVAMIWEGEGVVKTGRtiigatnpaqsapgtirgdlaivtgrniihgsdsVESAQKEIALwfpdgpinwqsslhpwiye
mtvdrpfaekhyedlsskpffGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGatnpaqsapgtiRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE
MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE
*****************KPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIY*
**VDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE
MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE
MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPW*Y*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
P39207149 Nucleoside diphosphate ki no no 1.0 0.744 0.783 5e-48
P47920148 Nucleoside diphosphate ki N/A no 1.0 0.75 0.774 4e-47
O81372148 Nucleoside diphosphate ki N/A no 1.0 0.75 0.774 5e-47
Q39839149 Nucleoside diphosphate ki yes no 1.0 0.744 0.783 9e-47
P47919148 Nucleoside diphosphate ki N/A no 1.0 0.75 0.774 1e-46
Q02254148 Nucleoside diphosphate ki N/A no 1.0 0.75 0.756 2e-46
Q56E62148 Nucleoside diphosphate ki N/A no 1.0 0.75 0.765 3e-46
Q9M7P6148 Nucleoside diphosphate ki N/A no 1.0 0.75 0.756 6e-46
Q96559148 Nucleoside diphosphate ki N/A no 1.0 0.75 0.756 7e-46
P47922149 Nucleoside diphosphate ki N/A no 1.0 0.744 0.756 1e-45
>sp|P39207|NDK1_ARATH Nucleoside diphosphate kinase 1 OS=Arabidopsis thaliana GN=NDPK1 PE=1 SV=1 Back     alignment and function desciption
 Score =  189 bits (479), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 98/111 (88%)

Query: 1   MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSA 60
           ++V+R FAEKHYEDLSSK FF  L++YI SGPVVAMIWEG+ VV TGR IIGATNPA S 
Sbjct: 38  ISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASE 97

Query: 61  PGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 111
           PGTIRGD AI  GRN+IHGSDSVESA+KEIALWFPDGP+NWQSS+HPW+YE
Sbjct: 98  PGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYE 148
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 6
>sp|P47920|NDKB_FLABI Nucleoside diphosphate kinase B OS=Flaveria bidentis PE=2 SV=1 Back     alignment and function description
>sp|O81372|NDK1_MESCR Nucleoside diphosphate kinase 1 OS=Mesembryanthemum crystallinum GN=NDKP1 PE=2 SV=1 Back     alignment and function description
>sp|Q39839|NDK1_SOYBN Nucleoside diphosphate kinase 1 OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|P47919|NDKA_FLABI Nucleoside diphosphate kinase A OS=Flaveria bidentis PE=2 SV=1 Back     alignment and function description
>sp|Q02254|NDK1_SPIOL Nucleoside diphosphate kinase 1 OS=Spinacia oleracea GN=NDPK1 PE=2 SV=1 Back     alignment and function description
>sp|Q56E62|NDK1_TOBAC Nucleoside diphosphate kinase 1 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|Q9M7P6|NDK_CAPAN Nucleoside diphosphate kinase OS=Capsicum annuum PE=2 SV=1 Back     alignment and function description
>sp|Q96559|NDK_HELAN Nucleoside diphosphate kinase OS=Helianthus annuus PE=2 SV=1 Back     alignment and function description
>sp|P47922|NDK1_PEA Nucleoside diphosphate kinase 1 OS=Pisum sativum GN=NDPK1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
19570344148 nucleoside diphosphate kinase 1 [Brassic 1.0 0.75 0.810 2e-47
297809115148 nucleoside diphosphate kinase 1 [Arabido 1.0 0.75 0.792 5e-47
18413214169 nucleoside diphosphate kinase 1 [Arabido 1.0 0.656 0.783 9e-47
16398148 nucleoside diphosphate kinase [Arabidops 1.0 0.75 0.783 1e-46
47026989159 nucleoside diphosphate kinase [Hyacinthu 1.0 0.698 0.801 1e-46
255627809149 unknown [Glycine max] 1.0 0.744 0.801 1e-46
302773528151 hypothetical protein SELMODRAFT_171292 [ 1.0 0.735 0.756 1e-46
302793166148 hypothetical protein SELMODRAFT_109077 [ 1.0 0.75 0.756 2e-46
730129149 RecName: Full=Nucleoside diphosphate kin 1.0 0.744 0.783 2e-46
16396147 nucleoside diphosphate kinase [Arabidops 1.0 0.755 0.783 3e-46
>gi|19570344|dbj|BAB86292.1| nucleoside diphosphate kinase 1 [Brassica rapa] gi|19744165|dbj|BAB86841.1| NDPK I [Brassica rapa] Back     alignment and taxonomy information
 Score =  192 bits (488), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 98/111 (88%)

Query: 1   MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSA 60
           +TVDRPFAEKHY+DLS+KPFF SL++YI SGPVVAMIWEG+ VV TGR IIGATNPA S 
Sbjct: 38  ITVDRPFAEKHYQDLSAKPFFSSLVDYIISGPVVAMIWEGKNVVLTGRKIIGATNPAASE 97

Query: 61  PGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 111
           PGTIRGD AI  GRN+IHGSDSVESA KE ALWFPDGP+NWQSSLH WIYE
Sbjct: 98  PGTIRGDYAIDIGRNVIHGSDSVESANKEAALWFPDGPVNWQSSLHSWIYE 148

Source: Brassica rapa

Species: Brassica rapa

Genus: Brassica

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297809115|ref|XP_002872441.1| nucleoside diphosphate kinase 1 [Arabidopsis lyrata subsp. lyrata] gi|297318278|gb|EFH48700.1| nucleoside diphosphate kinase 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18413214|ref|NP_567346.1| nucleoside diphosphate kinase 1 [Arabidopsis thaliana] gi|332657342|gb|AEE82742.1| nucleoside diphosphate kinase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|16398|emb|CAA49173.1| nucleoside diphosphate kinase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|47026989|gb|AAT08712.1| nucleoside diphosphate kinase [Hyacinthus orientalis] Back     alignment and taxonomy information
>gi|255627809|gb|ACU14249.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|302773528|ref|XP_002970181.1| hypothetical protein SELMODRAFT_171292 [Selaginella moellendorffii] gi|300161697|gb|EFJ28311.1| hypothetical protein SELMODRAFT_171292 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|302793166|ref|XP_002978348.1| hypothetical protein SELMODRAFT_109077 [Selaginella moellendorffii] gi|300153697|gb|EFJ20334.1| hypothetical protein SELMODRAFT_109077 [Selaginella moellendorffii] Back     alignment and taxonomy information
>gi|730129|sp|P39207.1|NDK1_ARATH RecName: Full=Nucleoside diphosphate kinase 1; AltName: Full=Nucleoside diphosphate kinase I; Short=NDK I; Short=NDP kinase I; Short=NDPK I gi|56966225|pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 gi|56966226|pdb|1U8W|B Chain B, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 gi|56966227|pdb|1U8W|C Chain C, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 gi|56966228|pdb|1U8W|D Chain D, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 gi|56966229|pdb|1U8W|E Chain E, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 gi|56966230|pdb|1U8W|F Chain F, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 gi|3169310|gb|AAC17844.1| nucleoside diphosphate kinase type 1 [Arabidopsis thaliana] gi|5881777|emb|CAB55695.1| nucleoside-diphosphate kinase [Arabidopsis thaliana] gi|7267574|emb|CAB78055.1| nucleoside-diphosphate kinase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|16396|emb|CAA49170.1| nucleoside diphosphate kinase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
ASPGD|ASPL0000017184153 swoH [Emericella nidulans (tax 0.963 0.699 0.638 7.4e-34
UNIPROTKB|P52174152 NME1-1 "Nucleoside diphosphate 1.0 0.730 0.607 1.5e-33
UNIPROTKB|P52175152 NME1-2 "Nucleoside diphosphate 1.0 0.730 0.607 1.5e-33
FB|FBgn0000150153 awd "abnormal wing discs" [Dro 0.927 0.673 0.644 2e-33
UNIPROTKB|Q6XI71150 awd "Nucleoside diphosphate ki 0.927 0.686 0.644 2e-33
RGD|619877152 Nme2 "NME/NM23 nucleoside diph 0.927 0.677 0.634 2.5e-33
MGI|MGI:97356152 Nme2 "NME/NM23 nucleoside diph 0.927 0.677 0.634 4.1e-33
TAIR|locus:2138101237 AT4G23900 [Arabidopsis thalian 0.990 0.464 0.576 4.1e-33
UNIPROTKB|O57535153 O57535 "Nucleoside diphosphate 0.927 0.673 0.634 5.2e-33
UNIPROTKB|G1K1A3110 NME1 "Nucleoside diphosphate k 0.927 0.936 0.634 5.2e-33
ASPGD|ASPL0000017184 swoH [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
 Score = 368 (134.6 bits), Expect = 7.4e-34, P = 7.4e-34
 Identities = 69/108 (63%), Positives = 82/108 (75%)

Query:     5 RPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTI 64
             R   E+HY DL  KPFF  L+ Y+ SGP+VAM+WEG+ VVKTGRTI+GATNP  SAPGTI
Sbjct:    44 RSLLEQHYSDLKEKPFFPGLVTYMLSGPIVAMVWEGKDVVKTGRTILGATNPLASAPGTI 103

Query:    65 RGDLAIVTGRNIIHGSDSVESAQKEIALWF-PDGPINWQSSLHPWIYE 111
             RGD AI  GRN+ HGSDSVESA+KEI LWF P+   N++ +   WIYE
Sbjct:   104 RGDFAIDVGRNVCHGSDSVESAKKEIGLWFTPEEIQNYKLNAFGWIYE 151
GO:0009142 "nucleoside triphosphate biosynthetic process" evidence=IDA
GO:0051211 "anisotropic cell growth" evidence=IMP
GO:0006644 "phospholipid metabolic process" evidence=RCA
GO:0004550 "nucleoside diphosphate kinase activity" evidence=IEA;RCA
GO:0006228 "UTP biosynthetic process" evidence=IEA
GO:0000747 "conjugation with cellular fusion" evidence=IEA
GO:0006165 "nucleoside diphosphate phosphorylation" evidence=IEA
GO:0006241 "CTP biosynthetic process" evidence=IEA
GO:0006974 "response to DNA damage stimulus" evidence=IEA
GO:0006183 "GTP biosynthetic process" evidence=IEA
GO:0005576 "extracellular region" evidence=IDA
GO:0005634 "nucleus" evidence=IEA
GO:0005829 "cytosol" evidence=IEA
GO:0005758 "mitochondrial intermembrane space" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|P52174 NME1-1 "Nucleoside diphosphate kinase A 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P52175 NME1-2 "Nucleoside diphosphate kinase A 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0000150 awd "abnormal wing discs" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q6XI71 awd "Nucleoside diphosphate kinase" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
RGD|619877 Nme2 "NME/NM23 nucleoside diphosphate kinase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97356 Nme2 "NME/NM23 nucleoside diphosphate kinase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2138101 AT4G23900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O57535 O57535 "Nucleoside diphosphate kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G1K1A3 NME1 "Nucleoside diphosphate kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3M7K5NDK_ANAVT2, ., 7, ., 4, ., 60.58031.00.7449yesno
P47919NDKA_FLABI2, ., 7, ., 4, ., 60.77471.00.75N/Ano
Q96559NDK_HELAN2, ., 7, ., 4, ., 60.75671.00.75N/Ano
P93554NDK1_SACOF2, ., 7, ., 4, ., 60.72971.00.7449N/Ano
Q39839NDK1_SOYBN2, ., 7, ., 4, ., 60.78371.00.7449yesno
Q50KA9NDKA_CANFA2, ., 7, ., 4, ., 60.61320.94590.6907yesno
B1WQB7NDK_CYAA52, ., 7, ., 4, ., 60.53571.00.7449yesno
Q116S1NDK_TRIEI2, ., 7, ., 4, ., 60.58921.00.7449yesno
Q8TFN0NDK_EMENI2, ., 7, ., 4, ., 60.63880.96390.6993yesno
Q5RFH3NDKB_PONAB2, ., 7, ., 1, 3, ., 30.61530.92790.6776yesno
Q01768NDKB_MOUSE2, ., 7, ., 1, 3, ., 30.63460.92790.6776yesno
O81372NDK1_MESCR2, ., 7, ., 4, ., 60.77471.00.75N/Ano
Q7Z8P9NDK_ASPFU2, ., 7, ., 4, ., 60.66340.92790.6732yesno
Q02254NDK1_SPIOL2, ., 7, ., 4, ., 60.75671.00.75N/Ano
P47920NDKB_FLABI2, ., 7, ., 4, ., 60.77471.00.75N/Ano
P47921NDK_SOLLC2, ., 7, ., 4, ., 60.75671.00.7708N/Ano
P47922NDK1_PEA2, ., 7, ., 4, ., 60.75671.00.7449N/Ano
B0C4I0NDK_ACAM12, ., 7, ., 4, ., 60.60711.00.7449yesno
Q56E62NDK1_TOBAC2, ., 7, ., 4, ., 60.76571.00.75N/Ano
Q8YRP2NDK_NOSS12, ., 7, ., 4, ., 60.58031.00.7449yesno
P52175NDKA2_BOVIN2, ., 7, ., 4, ., 60.60711.00.7302yesno
P52174NDKA1_BOVIN2, ., 7, ., 4, ., 60.60711.00.7302yesno
Q9M7P6NDK_CAPAN2, ., 7, ., 4, ., 60.75671.00.75N/Ano
B2IX22NDK_NOSP72, ., 7, ., 4, ., 60.59821.00.7449yesno
P19804NDKB_RAT2, ., 7, ., 1, 3, ., 30.63460.92790.6776yesno
O57535NDK_CHICK2, ., 7, ., 4, ., 60.63460.92790.6732yesno
B8HUM7NDK_CYAP42, ., 7, ., 4, ., 60.60711.00.7449yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.40.963
4th Layer2.7.4.60.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.6__2926__AT4G09320.1
annotation not avaliable (148 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
fgenesh2_kg.4__2676__AT2G44860.1
annotation not avaliable (161 aa)
•  •  • 0.885
scaffold_601857.1
annotation not avaliable (444 aa)
•     • 0.771
Al_scaffold_0004_1220
annotation not avaliable (460 aa)
•     • 0.766
fgenesh2_kg.3__3571__AT2G20420.1
annotation not avaliable (421 aa)
•  •  • 0.750
fgenesh1_pm.C_scaffold_8002307
annotation not avaliable (192 aa)
     •• 0.749
scaffold_302416.1
annotation not avaliable (397 aa)
      • 0.734
scaffold_802574.1
annotation not avaliable (263 aa)
   • •• 0.727
scaffold_501626.1
annotation not avaliable (178 aa)
   • •• 0.694
fgenesh2_kg.5__2151__AT3G57150.1
annotation not avaliable (561 aa)
      • 0.674
fgenesh2_kg.8__763__AT5G48840.1
annotation not avaliable (310 aa)
     •• 0.660

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
cd04413130 cd04413, NDPk_I, Nucleoside diphosphate kinase Gro 1e-61
pfam00334135 pfam00334, NDK, Nucleoside diphosphate kinase 1e-58
PRK00668134 PRK00668, ndk, mulitfunctional nucleoside diphosph 2e-58
smart00562135 smart00562, NDK, Enzymes that catalyze nonsubstrat 1e-56
PTZ00093149 PTZ00093, PTZ00093, nucleoside diphosphate kinase, 7e-56
COG0105135 COG0105, Ndk, Nucleoside diphosphate kinase [Nucle 3e-53
PLN02619238 PLN02619, PLN02619, nucleoside-diphosphate kinase 7e-49
cd00595133 cd00595, NDPk, Nucleoside diphosphate kinases (NDP 2e-39
PRK14540134 PRK14540, PRK14540, nucleoside diphosphate kinase; 1e-35
PRK14545139 PRK14545, PRK14545, nucleoside diphosphate kinase; 3e-27
PRK14541140 PRK14541, PRK14541, nucleoside diphosphate kinase; 1e-25
cd04414135 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (N 9e-23
PLN02931177 PLN02931, PLN02931, nucleoside diphosphate kinase 1e-22
PRK14544183 PRK14544, PRK14544, nucleoside diphosphate kinase; 7e-22
PRK14542137 PRK14542, PRK14542, nucleoside diphosphate kinase; 8e-20
PRK14543169 PRK14543, PRK14543, nucleoside diphosphate kinase; 4e-19
cd04415131 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d 2e-18
cd04418132 cd04418, NDPk5, Nucleoside diphosphate kinase homo 1e-17
cd04416132 cd04416, NDPk_TX, NDP kinase domain of thioredoxin 9e-16
cd04412134 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d 1e-11
>gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information 
 Score =  183 bits (468), Expect = 1e-61
 Identities = 59/94 (62%), Positives = 74/94 (78%)

Query: 1   MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSA 60
           + +    AE+HY +   KPFF  L+E++TSGPVVAM+ EGE  VKT R ++GATNPA +A
Sbjct: 37  LQLTEELAEEHYAEHKGKPFFPELVEFMTSGPVVAMVLEGENAVKTVRKLMGATNPADAA 96

Query: 61  PGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWF 94
           PGTIRGD A+  GRNI+HGSDSVESA++EIALWF
Sbjct: 97  PGTIRGDFALSIGRNIVHGSDSVESAEREIALWF 130

The mammalian nm23/NDP kinase gene family can be divided into two distinct groups. The group I genes encode proteins that generally have highly homologous counterparts in other organisms and possess the classic enzymatic activity of a kinase. This group includes vertebrate NDP kinases A-D (Nm23- H1 to -H4), and its counterparts in bacteria, archea and other eukaryotes. NDP kinases exist in two different quaternary structures; all known eukaryotic enzymes are hexamers, while some bacterial enzymes are tetramers, as in Myxococcus. They possess the NDP kinase active site motif (NXXH[G/A]SD) and the nine residues that are most essential for catalysis. Length = 130
>gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase Back     alignment and domain information
>gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase Back     alignment and domain information
>gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|239877 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein Back     alignment and domain information
>gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|237749 PRK14543, PRK14543, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
PTZ00093149 nucleoside diphosphate kinase, cytosolic; Provisio 100.0
PLN02619238 nucleoside-diphosphate kinase 100.0
COG0105135 Ndk Nucleoside diphosphate kinase [Nucleotide tran 100.0
PRK14543169 nucleoside diphosphate kinase; Provisional 100.0
PRK14542137 nucleoside diphosphate kinase; Provisional 100.0
PRK14541140 nucleoside diphosphate kinase; Provisional 100.0
PRK14545139 nucleoside diphosphate kinase; Provisional 100.0
cd04415131 NDPk7A Nucleoside diphosphate kinase 7 domain A (N 100.0
PRK14540134 nucleoside diphosphate kinase; Provisional 100.0
KOG0888156 consensus Nucleoside diphosphate kinase [Nucleotid 100.0
PRK00668134 ndk mulitfunctional nucleoside diphosphate kinase/ 100.0
cd04414135 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 100.0
cd04418132 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP 100.0
PLN02931177 nucleoside diphosphate kinase family protein 100.0
cd04413130 NDPk_I Nucleoside diphosphate kinase Group I (NDPk 100.0
cd04416132 NDPk_TX NDP kinase domain of thioredoxin domain-co 100.0
cd04412134 NDPk7B Nucleoside diphosphate kinase 7 domain B (N 100.0
cd00595133 NDPk Nucleoside diphosphate kinases (NDP kinases, 100.0
PF00334135 NDK: Nucleoside diphosphate kinase; InterPro: IPR0 100.0
smart00562135 NDK These are enzymes that catalyze nonsubstrate s 100.0
PRK14544183 nucleoside diphosphate kinase; Provisional 100.0
>PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.1e-42  Score=245.69  Aligned_cols=110  Identities=57%  Similarity=1.073  Sum_probs=106.1

Q ss_pred             CccCHHHHHHHHHHhcCCCchHHHHHHhhcCcEEEEEEecCchHHHHHHHhCCCCCCCCCCCChhhhcccccCCceEEeC
Q 033807            1 MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGS   80 (111)
Q Consensus         1 ~~ls~~~a~~~Y~~~~~~~~f~~lv~~m~sgpvv~l~l~g~nav~~~r~l~Gp~~~~~a~p~slR~~fg~~~~~N~vH~S   80 (111)
                      ++||+++|++||.+|++++||++|++||+|||+++|+|+|+|||++||.+|||++|.+|.|+|||++||++.++|+||||
T Consensus        39 ~~lt~~~a~~fY~~~~gk~ff~~Lv~~m~sGp~val~l~g~nav~~~R~l~Gpt~p~~a~p~siR~~fg~~~~~NavH~S  118 (149)
T PTZ00093         39 LQPTPEIAEEHYKEHKGKPFFPGLVKYISSGPVVCMVWEGKNVVKQGRKLLGATNPLESAPGTIRGDFCVDVGRNVIHGS  118 (149)
T ss_pred             ecCCHHHHHHHHHHhcCCchHHHHHHHHhcCCEEEEEEeCCCHHHHHHHHhCCCCccccCCCcchhhhccccccceeecC
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHhhCCC-CccccccCCCCccc
Q 033807           81 DSVESAQKEIALWFPD-GPINWQSSLHPWIY  110 (111)
Q Consensus        81 ds~~~A~~Ei~~fF~~-~~~~~~~~~~~~~~  110 (111)
                      ||+++|.+||+|||+. ++.+|+.+..+++|
T Consensus       119 ds~e~A~~Ei~~fF~~~~~~~~~~~~~~~~~  149 (149)
T PTZ00093        119 DSVESAKREIALWFKPEELVSWTSHSSKWIY  149 (149)
T ss_pred             CCHHHHHHHHHHhCChhhccCccccchhhhC
Confidence            9999999999999966 88899988888876

>PLN02619 nucleoside-diphosphate kinase Back     alignment and domain information
>COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14543 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14542 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14541 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14545 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>PRK14540 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>KOG0888 consensus Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>PLN02931 nucleoside diphosphate kinase family protein Back     alignment and domain information
>cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 Back     alignment and domain information
>smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>PRK14544 nucleoside diphosphate kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
1u8w_A149 Crystal Structure Of Arabidopsis Thaliana Nucleosid 4e-49
1pku_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 5e-42
1be4_A151 Nucleoside Diphosphate Kinase Isoform B From Bovine 2e-36
1bhn_A152 Nucleoside Diphosphate Kinase Isoform A From Bovine 2e-36
1nsk_R152 The Crystal Structure Of A Human Nucleoside Diphosp 2e-35
1nue_A151 X-ray Structure Of Nm23 Human Nucleoside Diphosphat 3e-35
1ndl_A153 The Awd Nucleotide Diphosphate Kinase From Drosophi 3e-35
1jxv_A152 Crystal Structure Of Human Nucleoside Diphosphate K 4e-35
3l7u_A172 Crystal Structure Of Human Nm23-H1 Length = 172 5e-35
2hve_A152 S120g Mutant Of Human Nucleoside Diphosphate Kinase 1e-34
1s57_A153 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-34
3bbc_A151 Crystal Structure Of R88a Mutant Of The Nm23-H2 Tra 2e-34
1w7w_A182 Structure And Mutational Analysis Of A Plant Mitoch 2e-34
1nsq_A153 Mechanism Of Phosphate Transfer By Nucleoside Dipho 3e-34
3prv_A157 Nucleoside Diphosphate Kinase B From Trypanosoma Cr 5e-34
3ngr_A151 Crystal Structure Of Leishmania Nucleoside Diphosph 1e-33
1zs6_A169 Structure Of Human Nucleoside-diphosphate Kinase 3 4e-33
1ucn_A152 X-Ray Structure Of Human Nucleoside Diphosphate Kin 5e-33
4fkx_A161 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-32
4f36_A157 Crystal Structure Of Nucleoside Diphosphate Kinase 3e-32
1ndp_A155 Adenosine 5'-Diphosphate Binding And The Active Sit 2e-31
1hhq_A155 Role Of Active Site Resiude Lys16 In Nucleoside Dip 2e-31
1npk_A154 Refined X-Ray Structure Of Dictyostelium Nucleoside 2e-31
3b54_A161 Saccharomyces Cerevisiae Nucleoside Diphosphate Kin 3e-31
1lwx_A155 Azt Diphosphate Binding To Nucleoside Diphosphate K 2e-30
1leo_A150 P100s Nucleoside Diphosphate Kinase Length = 150 2e-30
1ndk_A155 X-Ray Structure Of Nucleoside Diphosphate Kinase Le 2e-30
1hlw_A155 Structure Of The H122a Mutant Of The Nucleoside Dip 2e-30
1nsp_A155 Mechanism Of Phosphate Transfer By Nucleoside Dipho 2e-30
1ncl_A150 Thermal Stability Of Hexameric And Tetrameric Nucle 3e-30
1b4s_A155 Structure Of Nucleoside Diphosphate Kinase H122g Mu 3e-30
2vu5_A148 Crystal Structure Of Pndk From Bacillus Anthracis L 5e-30
3r9l_A155 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-29
3q83_A157 Crystal Structure Of Staphylococcus Aureus Nucleosi 2e-29
1pae_X155 Nucleoside Diphosphate Kinase Length = 155 4e-29
1mn7_A155 Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit 2e-28
1xiq_A157 Plasmodium Falciparum Nucleoside Diphosphate Kinase 7e-28
2zua_A174 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-27
1ehw_A162 Human Nucleoside Diphosphate Kinase 4 Length = 162 1e-27
1k44_A136 Mycobacterium Tuberculosis Nucleoside Diphosphate K 9e-27
3js9_A156 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-25
1wkj_A137 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-25
2az3_A164 Structure Of A Halophilic Nucleoside Diphosphate Ki 5e-25
3mpd_A151 Crystal Structure Of Nucleoside Diphosphate Kinase 5e-25
2az1_A181 Structure Of A Halophilic Nucleoside Diphosphate Ki 7e-25
2cwk_A160 Crystal Structure Of Nucleotide Diphosphate Kinase 5e-24
2nck_R144 Crystal Structure Of Myxococcus Xanthus Nucleoside 9e-22
3ddi_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R1 1e-21
3em1_A146 Crystal Structure Of The Mimivirus Ndk +kpn-N62l Do 7e-21
3emt_A146 Crystal Structure Of The Mimivirus Ndk +kpn-R107g D 9e-21
1nb2_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-20
2hur_A142 Escherichia Coli Nucleoside Diphosphate Kinase Leng 3e-20
3vgu_A141 E134a Mutant Nucleoside Diphosphate Kinase Derived 3e-20
3vgs_A141 Wild-Type Nucleoside Diphosphate Kinase Derived Fro 3e-20
3ejm_A146 Crystal Structure Of The Mimivirus Ndk +kpn Mutant 6e-20
3pj9_A140 Crystal Structure Of A Nucleoside Diphosphate Kinas 3e-19
4dut_A145 The Structure Of Nucleoside Diphosphate Kinase (Ndk 9e-19
3fbe_A142 Crystal Structure Of The Mimivirus Ndk N62l-R107g D 9e-17
3fbf_A142 Crystal Structure Of The Mimivirus Ndk N62l Mutant 5e-16
3evw_A142 Crystal Structure Of The Mimivirus Ndk R107g Mutant 7e-16
3ztq_A142 Hexagonal Crystal Form P61 Of The Aquifex Aeolicus 3e-15
2b8p_A157 Crystal Structure Of Acanthamoeba Polyphaga Mimivir 4e-15
2b8q_A142 X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus 4e-15
4di6_A190 Crystal Structure Of Nucleoside-Diphosphate Kinase 1e-12
1xqi_A195 Crystal Structure Analysis Of An Ndp Kinase From Py 2e-11
>pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 Back     alignment and structure 
Iteration: 1

 Score =  189 bits (479), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 87/111 (78%), Positives = 98/111 (88%)
Query: 1   MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSA 60
           ++V+R FAEKHYEDLSSK FF  L++YI SGPVVAMIWEG+ VV TGR IIGATNPA S 
Sbjct: 38  ISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASE 97
Query: 61  PGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 111
           PGTIRGD AI  GRN+IHGSDSVESA+KEIALWFPDGP+NWQSS+HPW+YE
Sbjct: 98  PGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYE 148
>pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 Back     alignment and structure
>pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 Back     alignment and structure
>pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 Back     alignment and structure
>pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 Back     alignment and structure
>pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 Back     alignment and structure
>pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 Back     alignment and structure
>pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 Back     alignment and structure
>pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A Complexed With Adp Length = 152 Back     alignment and structure
>pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis Length = 153 Back     alignment and structure
>pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription Factor Length = 151 Back     alignment and structure
>pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 Back     alignment and structure
>pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 153 Back     alignment and structure
>pdb|3PRV|A Chain A, Nucleoside Diphosphate Kinase B From Trypanosoma Cruzi Length = 157 Back     alignment and structure
>pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 Back     alignment and structure
>pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-diphosphate Kinase 3 Length = 169 Back     alignment and structure
>pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A Complexed With Adp At 2 A Resolution Length = 152 Back     alignment and structure
>pdb|4FKX|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei Bound To Cdp Length = 161 Back     alignment and structure
>pdb|4F36|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei, Apo Form Length = 157 Back     alignment and structure
>pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 Back     alignment and structure
>pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 Back     alignment and structure
>pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 Back     alignment and structure
>pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 Back     alignment and structure
>pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 Back     alignment and structure
>pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 Back     alignment and structure
>pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 Back     alignment and structure
>pdb|3Q83|A Chain A, Crystal Structure Of Staphylococcus Aureus Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 Back     alignment and structure
>pdb|1XIQ|A Chain A, Plasmodium Falciparum Nucleoside Diphosphate Kinase B Length = 157 Back     alignment and structure
>pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 Back     alignment and structure
>pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4 Length = 162 Back     alignment and structure
>pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 Back     alignment and structure
>pdb|3JS9|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase Family Protein From Babesia Bovis Length = 156 Back     alignment and structure
>pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 Back     alignment and structure
>pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 Back     alignment and structure
>pdb|3MPD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Encephalitozoon Cuniculi, Cubic Form, Apo Length = 151 Back     alignment and structure
>pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 Back     alignment and structure
>pdb|2CWK|A Chain A, Crystal Structure Of Nucleotide Diphosphate Kinase From Pyrococcus Horikoshii Length = 160 Back     alignment and structure
>pdb|2NCK|R Chain R, Crystal Structure Of Myxococcus Xanthus Nucleoside Diphosphate Kinase And Its Interaction With A Nucleotide Substrate At 2.0 Angstroms Resolution Length = 144 Back     alignment and structure
>pdb|3DDI|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R107g Triple Mutant Complexed With Tdp Length = 146 Back     alignment and structure
>pdb|3EM1|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l Double Mutant Complexed With Dtdp Length = 146 Back     alignment and structure
>pdb|3EMT|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-R107g Double Mutant Complexed With Dgdp Length = 146 Back     alignment and structure
>pdb|1NB2|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Bacillus Halodenitrificans Length = 150 Back     alignment and structure
>pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3EJM|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn Mutant Complexed With Gdp Length = 146 Back     alignment and structure
>pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 Back     alignment and structure
>pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 Back     alignment and structure
>pdb|3FBE|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l-R107g Double Mutant Complexed With Gdp Length = 142 Back     alignment and structure
>pdb|3FBF|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|3EVW|A Chain A, Crystal Structure Of The Mimivirus Ndk R107g Mutant Complexed With Dtdp Length = 142 Back     alignment and structure
>pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|2B8P|A Chain A, Crystal Structure Of Acanthamoeba Polyphaga Mimivirus Ndk, The First Viral Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|2B8Q|A Chain A, X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus Nucleoside Diphosphate Kinase Complexed With Tdp Length = 142 Back     alignment and structure
>pdb|4DI6|A Chain A, Crystal Structure Of Nucleoside-Diphosphate Kinase From Borrelia Burgdorferi Length = 190 Back     alignment and structure
>pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From Pyrobaculum Aerophilum Length = 195 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 4e-73
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 1e-72
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 1e-71
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 3e-71
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 7e-71
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 1e-70
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 1e-70
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 2e-70
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 2e-70
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 2e-70
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 4e-70
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 4e-70
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 5e-70
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 7e-70
3js9_A156 Nucleoside diphosphate kinase family protein; niai 9e-70
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 1e-69
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 2e-69
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 2e-68
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 3e-65
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 7e-65
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 1e-64
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 1e-64
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 3e-64
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 6e-64
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 2e-63
4ek2_A145 Nucleoside diphosphate kinase; seattle structural 9e-63
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 6e-62
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 2e-60
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 2e-49
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 Back     alignment and structure
 Score =  212 bits (543), Expect = 4e-73
 Identities = 87/111 (78%), Positives = 98/111 (88%)

Query: 1   MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSA 60
           ++V+R FAEKHYEDLSSK FF  L++YI SGPVVAMIWEG+ VV TGR IIGATNPA S 
Sbjct: 38  ISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASE 97

Query: 61  PGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPINWQSSLHPWIYE 111
           PGTIRGD AI  GRN+IHGSDSVESA+KEIALWFPDGP+NWQSS+HPW+YE
Sbjct: 98  PGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYE 148
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 Back     alignment and structure
>4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 100.0
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 100.0
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 100.0
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 100.0
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 100.0
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 100.0
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 100.0
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 100.0
3js9_A156 Nucleoside diphosphate kinase family protein; niai 100.0
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 100.0
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 100.0
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 100.0
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 100.0
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 100.0
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 100.0
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 100.0
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 100.0
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 100.0
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 100.0
4hr2_A145 Nucleoside diphosphate kinase; ssgcid, seattle str 100.0
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 100.0
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 100.0
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 100.0
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 100.0
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 100.0
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 100.0
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 100.0
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 100.0
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 100.0
3bh7_B352 Protein XRP2; protein-protein complex, GTPase acti 99.9
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Back     alignment and structure
Probab=100.00  E-value=1e-47  Score=273.20  Aligned_cols=111  Identities=56%  Similarity=0.999  Sum_probs=108.3

Q ss_pred             CccCHHHHHHHHHHhcCCCchHHHHHHhhcCcEEEEEEecCchHHHHHHHhCCCCCCCCCCCChhhhcccccCCceEEeC
Q 033807            1 MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGS   80 (111)
Q Consensus         1 ~~ls~~~a~~~Y~~~~~~~~f~~lv~~m~sgpvv~l~l~g~nav~~~r~l~Gp~~~~~a~p~slR~~fg~~~~~N~vH~S   80 (111)
                      ++||+++|++||.+|+++|||++|++||+||||+||+|+|+|||++||+|||||||.+|.|+|||++||++..+|+||||
T Consensus        48 ~~ls~e~a~~fY~~h~~kpff~~Lv~~mtSGPvvamvleg~naV~~~R~l~GpTdp~~A~PgTIR~~fg~~~~~N~vHgS  127 (161)
T 4fkx_A           48 LQPTEEQAKQHYIDLASKPFYSGLVSYFSSGPIVGMVWEGLGVVKGGRVLLGATNPADSLPGTIRGDFAVDVGRNVCHGS  127 (161)
T ss_dssp             ECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEESTTHHHHHHHHHCCSSGGGCCTTSHHHHHCCBTTBCCEEEC
T ss_pred             ecCCHHHHHHHHHHHcCCccHHHHHHHHhCCCcEEEEEeccChHHHHHHHhcCCChhhcCCCChhHhhCCCccceeEEeC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHhhCCC-CccccccCCCCcccC
Q 033807           81 DSVESAQKEIALWFPD-GPINWQSSLHPWIYE  111 (111)
Q Consensus        81 ds~~~A~~Ei~~fF~~-~~~~~~~~~~~~~~~  111 (111)
                      ||+++|++||++||++ ++++|+.+.++|+|+
T Consensus       128 Ds~esA~rEI~~fF~~~e~~~~~~~~~~~~ye  159 (161)
T 4fkx_A          128 DSVESAKREIAFWFKAEELVSWTSHSVKQIYE  159 (161)
T ss_dssp             SSHHHHHHHHHHHCCGGGSCCCCCTTHHHHCS
T ss_pred             CCHHHHHHHHHHcCChhhcccccccchhheec
Confidence            9999999999999955 899999999999996
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Back     alignment and structure
>4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Back     alignment and structure
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Back     alignment and structure
>3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 111
d1zs6a1152 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, 3e-38
d1u8wa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 5e-38
d3bbba1150 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, 8e-38
d1s57a_153 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 7e-37
d1hlwa_150 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 7e-35
d1xiqa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-34
d2az3a1152 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, 2e-34
d1w7wa_151 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 9e-34
d1nhkl_143 d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { 2e-33
d1xqia1182 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, 4e-33
d1wkja1137 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, 1e-32
d1ehwa_143 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 3e-32
d1nb2a_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-32
d2dyaa1153 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, 3e-30
d1k44a_135 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 3e-30
d2b8qa1128 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, 6e-27
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human(Homo sapiens), NDK3 [TaxId: 9606]

 Score =  123 bits (311), Expect = 3e-38
 Identities = 59/112 (52%), Positives = 79/112 (70%), Gaps = 1/112 (0%)

Query: 1   MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSA 60
           +        +HY +L  +PF+G L++Y+ SGPVVAM+W+G  VV+T R +IGATNPA + 
Sbjct: 41  VQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAP 100

Query: 61  PGTIRGDLAIVTGRNIIHGSDSVESAQKEIALWFPDGPI-NWQSSLHPWIYE 111
           PGTIRGD  I  G+N+IHGSDSVESA++EIALWF    +  W+ S   W+YE
Sbjct: 101 PGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE 152
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d1u8wa_149 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1s57a_153 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1zs6a1152 Nucleoside diphosphate kinase, NDK {Human(Homo sap 100.0
d3bbba1150 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1nb2a_149 Nucleoside diphosphate kinase, NDK {Bacillus halod 100.0
d1w7wa_151 Nucleoside diphosphate kinase, NDK {Pea (Pisum sat 100.0
d1xiqa_149 Nucleoside diphosphate kinase, NDK {Plasmodium fal 100.0
d2az3a1152 Nucleoside diphosphate kinase, NDK {Archaeon Halob 100.0
d1ehwa_143 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1hlwa_150 Nucleoside diphosphate kinase, NDK {Dictyostelium 100.0
d2dyaa1153 Nucleoside diphosphate kinase, NDK {Archaeon Pyroc 100.0
d1nhkl_143 Nucleoside diphosphate kinase, NDK {Myxococcus xan 100.0
d1wkja1137 Nucleoside diphosphate kinase, NDK {Thermus thermo 100.0
d1k44a_135 Nucleoside diphosphate kinase, NDK {Mycobacterium 100.0
d1xqia1182 Nucleoside diphosphate kinase, NDK {Archaeon Pyrob 100.0
d2b8qa1128 Nucleoside diphosphate kinase, NDK {Mimivirus [Tax 100.0
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=7.6e-47  Score=264.35  Aligned_cols=111  Identities=78%  Similarity=1.354  Sum_probs=108.9

Q ss_pred             CccCHHHHHHHHHHhcCCCchHHHHHHhhcCcEEEEEEecCchHHHHHHHhCCCCCCCCCCCChhhhcccccCCceEEeC
Q 033807            1 MTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGRNIIHGS   80 (111)
Q Consensus         1 ~~ls~~~a~~~Y~~~~~~~~f~~lv~~m~sgpvv~l~l~g~nav~~~r~l~Gp~~~~~a~p~slR~~fg~~~~~N~vH~S   80 (111)
                      ++||+++|++||.+|++++||+.|++||+||||+||+|+|+|||++||+++|||||.+|.|+|||++||++.++|+||||
T Consensus        38 ~~ls~e~a~~~Y~~~~gk~ff~~lv~~m~sGPv~a~~l~g~~aV~~~R~l~Gptdp~~A~p~tIR~~fg~~~~~N~vH~S  117 (149)
T d1u8wa_          38 ISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGS  117 (149)
T ss_dssp             ECCCHHHHHHHTCTTSSSTTHHHHHHHHTSSCEEEEEEESTTHHHHHHHHHCCSSTTTCCTTSHHHHHCCSTTSCSEEEC
T ss_pred             eeCCHHHHHHHHHHHccchhhhhhhhhccCCCeeeeecccchHHHHHHHHhccCCcccCCCCchhccccccccccceECC
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHhhCCCCccccccCCCCcccC
Q 033807           81 DSVESAQKEIALWFPDGPINWQSSLHPWIYE  111 (111)
Q Consensus        81 ds~~~A~~Ei~~fF~~~~~~~~~~~~~~~~~  111 (111)
                      ||+++|++||.+|||++.++|++..++|+|+
T Consensus       118 ds~e~A~rEi~~fFp~~~i~~~~~~~~~~y~  148 (149)
T d1u8wa_         118 DSVESARKEIALWFPDGPVNWQSSVHPWVYE  148 (149)
T ss_dssp             SSHHHHHHHHHHHCTTCCCCCCCTTGGGTSC
T ss_pred             CCHHHHHHHHHHcCCccccCccccccccccc
Confidence            9999999999999999888999999999996
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Back     information, alignment and structure