Citrus Sinensis ID: 033889

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MVNYFPFFFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREYTMEDILTQLKKEMAAPHNRKLVQPPEGPHHMDVYAYLS
cccEEEEEEccccccccccEEEEEEEEccccccccccEEEEccEEcccEEccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHcc
ccccEEEEEccccccccccEEEEEEEccccccccccEEEEcEccccccEcccccEEcHHHcHHHHcccccccHHHHHHHHHHHHHcccccccccccccccHHHEHEEcc
mvnyfpfffsgpqtvhegrIYQLKLfcdkdypekppsvrfhsrinmtcvnhetgvvepkkfglLVNWQREYTMEDILTQLKKEmaaphnrklvqppegphhmdvyayls
mvnyfpfffsgpqtvhEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVnhetgvvepkkfGLLVNWQREYTMEDILTQLKKEMAAPHNrklvqppegphhMDVYAYLS
MVNYFPFFFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREYTMEDILTQLKKEMAAPHNRKLVQPPEGPHHMDVYAYLS
**NYFPFFFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREYTMEDILTQL*****************************
MVNYFPFFFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREYTMEDILTQLKKEMAAPHNRKLVQPPEGPHHMDVYAYLS
MVNYFPFFFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREYTMEDILTQLKKEMAAPHNRKLVQPPEGPHHMDVYAYLS
*VNYFPFFFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREYTMEDILTQLKKEMAAPHNRKLVQPPEGPHHMDVYAYLS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNYFPFFFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREYTMEDILTQLKKEMAAPHNRKLVQPPEGPHHMDVYAYLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q9SJ44145 Ubiquitin-conjugating enz no no 0.807 0.606 0.887 9e-43
Q9SVD7146 Ubiquitin-conjugating enz no no 0.807 0.602 0.876 4e-42
Q93YP0158 Ubiquitin-conjugating enz no no 0.899 0.620 0.642 4e-33
Q9CAB6159 Ubiquitin-conjugating enz no no 0.807 0.553 0.674 5e-30
Q54D06138 Probable ubiquitin-conjug yes no 0.825 0.652 0.527 6e-25
O74983139 Ubiquitin-conjugating enz yes no 0.807 0.633 0.584 5e-23
Q9CZY3147 Ubiquitin-conjugating enz yes no 0.899 0.666 0.418 1e-19
Q13404147 Ubiquitin-conjugating enz yes no 0.899 0.666 0.418 3e-19
Q3SZ52147 Ubiquitin-conjugating enz yes no 0.899 0.666 0.418 3e-19
P53152137 Ubiquitin-conjugating enz yes no 0.889 0.708 0.469 4e-19
>sp|Q9SJ44|UEV1C_ARATH Ubiquitin-conjugating enzyme E2 variant 1C OS=Arabidopsis thaliana GN=UEV1C PE=1 SV=1 Back     alignment and function desciption
 Score =  171 bits (434), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 79/89 (88%), Positives = 84/89 (94%), Gaps = 1/89 (1%)

Query: 11  GP-QTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQR 69
           GP  TVHEGRIYQLKLFCDKDYPEKPP+VRFHSRINMTCVNH+TGVV+ KKFG+L NWQR
Sbjct: 54  GPHNTVHEGRIYQLKLFCDKDYPEKPPTVRFHSRINMTCVNHDTGVVDSKKFGVLANWQR 113

Query: 70  EYTMEDILTQLKKEMAAPHNRKLVQPPEG 98
           +YTMEDILTQLKKEMAA HNRKLVQPPEG
Sbjct: 114 QYTMEDILTQLKKEMAASHNRKLVQPPEG 142
Has no ubiquitin ligase activity on its own. The heterodimer with UBC catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. May play a role in the control of progress through the cell cycle and differentiation. May play a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SVD7|UEV1D_ARATH Ubiquitin-conjugating enzyme E2 variant 1D OS=Arabidopsis thaliana GN=UEV1D PE=1 SV=1 Back     alignment and function description
>sp|Q93YP0|UEV1A_ARATH Ubiquitin-conjugating enzyme E2 variant 1A OS=Arabidopsis thaliana GN=UEV1A PE=1 SV=1 Back     alignment and function description
>sp|Q9CAB6|UEV1B_ARATH Ubiquitin-conjugating enzyme E2 variant 1B OS=Arabidopsis thaliana GN=UEV1B PE=1 SV=1 Back     alignment and function description
>sp|Q54D06|UBE2V_DICDI Probable ubiquitin-conjugating enzyme E2 variant OS=Dictyostelium discoideum GN=ube2v PE=3 SV=1 Back     alignment and function description
>sp|O74983|MMS2_SCHPO Ubiquitin-conjugating enzyme spm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spm2 PE=1 SV=1 Back     alignment and function description
>sp|Q9CZY3|UB2V1_MOUSE Ubiquitin-conjugating enzyme E2 variant 1 OS=Mus musculus GN=Ube2v1 PE=1 SV=1 Back     alignment and function description
>sp|Q13404|UB2V1_HUMAN Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens GN=UBE2V1 PE=1 SV=2 Back     alignment and function description
>sp|Q3SZ52|UB2V1_BOVIN Ubiquitin-conjugating enzyme E2 variant 1 OS=Bos taurus GN=UBE2V1 PE=2 SV=1 Back     alignment and function description
>sp|P53152|MMS2_YEAST Ubiquitin-conjugating enzyme variant MMS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
257196367146 ubiquitin-conjugating enzyme variant [Ci 0.825 0.616 0.956 2e-44
359481638171 PREDICTED: ubiquitin-conjugating enzyme 0.889 0.567 0.868 3e-44
315937232146 ubiquitin-conjugating family protein [Ja 0.825 0.616 0.945 4e-44
356537146201 PREDICTED: ubiquitin-conjugating enzyme 0.807 0.437 0.955 5e-44
217075773146 unknown [Medicago truncatula] gi|3884967 0.825 0.616 0.934 8e-44
255578603147 ubiquitin-conjugating enzyme, putative [ 0.825 0.612 0.945 9e-44
224140051146 predicted protein [Populus trichocarpa] 0.807 0.602 0.955 2e-43
449437446146 PREDICTED: ubiquitin-conjugating enzyme 0.825 0.616 0.923 3e-43
359481634146 PREDICTED: ubiquitin-conjugating enzyme 0.825 0.616 0.923 4e-43
225440751147 PREDICTED: ubiquitin-conjugating enzyme 0.798 0.591 0.942 4e-43
>gi|257196367|gb|ACV49920.1| ubiquitin-conjugating enzyme variant [Citrus sinensis] Back     alignment and taxonomy information
 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/91 (95%), Positives = 88/91 (96%), Gaps = 1/91 (1%)

Query: 11  GP-QTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQR 69
           GP  TVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQR
Sbjct: 55  GPHNTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQR 114

Query: 70  EYTMEDILTQLKKEMAAPHNRKLVQPPEGPH 100
           EYTMEDILTQLKKEMAAPHNRKLVQPPEG +
Sbjct: 115 EYTMEDILTQLKKEMAAPHNRKLVQPPEGTY 145

Source: Citrus sinensis

Species: Citrus sinensis

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359481638|ref|XP_003632652.1| PREDICTED: ubiquitin-conjugating enzyme E2 variant 1D-like isoform 4 [Vitis vinifera] Back     alignment and taxonomy information
>gi|315937232|gb|ADU56174.1| ubiquitin-conjugating family protein [Jatropha curcas] gi|317159571|gb|ADV04060.1| protein binding/ubiquitin-protein ligase 1 [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|356537146|ref|XP_003537091.1| PREDICTED: ubiquitin-conjugating enzyme E2 variant 1D-like [Glycine max] Back     alignment and taxonomy information
>gi|217075773|gb|ACJ86246.1| unknown [Medicago truncatula] gi|388496758|gb|AFK36445.1| unknown [Medicago truncatula] gi|388520687|gb|AFK48405.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|255578603|ref|XP_002530163.1| ubiquitin-conjugating enzyme, putative [Ricinus communis] gi|223530324|gb|EEF32218.1| ubiquitin-conjugating enzyme, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224140051|ref|XP_002323400.1| predicted protein [Populus trichocarpa] gi|118483820|gb|ABK93802.1| unknown [Populus trichocarpa] gi|222868030|gb|EEF05161.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449437446|ref|XP_004136503.1| PREDICTED: ubiquitin-conjugating enzyme E2 variant 1C-like [Cucumis sativus] gi|449526672|ref|XP_004170337.1| PREDICTED: ubiquitin-conjugating enzyme E2 variant 1C-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359481634|ref|XP_003632650.1| PREDICTED: ubiquitin-conjugating enzyme E2 variant 1D-like isoform 2 [Vitis vinifera] gi|297740182|emb|CBI30364.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225440751|ref|XP_002281147.1| PREDICTED: ubiquitin-conjugating enzyme E2 variant 1D-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
TAIR|locus:2028085158 MMZ1 "AT1G23260" [Arabidopsis 0.798 0.550 0.712 7.7e-32
TAIR|locus:2033561159 MMZ2 "AT1G70660" [Arabidopsis 0.807 0.553 0.674 3.4e-29
DICTYBASE|DDB_G0292596138 ube2v "putative ubiquitin-conj 0.807 0.637 0.539 6.8e-24
POMBASE|SPCC338.05c139 mms2 "ubiquitin conjugating en 0.807 0.633 0.584 6.1e-23
ASPGD|ASPL0000013615141 AN3644 [Emericella nidulans (t 0.899 0.695 0.448 4.3e-22
SGD|S000003055137 MMS2 "Ubiquitin-conjugating en 0.788 0.627 0.517 2.5e-19
UNIPROTKB|Q3SZ52147 UBE2V1 "Ubiquitin-conjugating 0.798 0.591 0.471 3.1e-19
UNIPROTKB|E2R2I5147 UBE2V1 "Uncharacterized protei 0.798 0.591 0.471 3.1e-19
UNIPROTKB|J9P1M6159 UBE2V1 "Uncharacterized protei 0.798 0.547 0.471 3.1e-19
UNIPROTKB|Q13404147 UBE2V1 "Ubiquitin-conjugating 0.798 0.591 0.471 3.1e-19
TAIR|locus:2028085 MMZ1 "AT1G23260" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 349 (127.9 bits), Expect = 7.7e-32, P = 7.7e-32
 Identities = 62/87 (71%), Positives = 71/87 (81%)

Query:    12 PQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREY 71
             P T +EG+I+QLKLFC K+YPE PP+VRF +RINM CVN ETGVVEP  F +L NW+REY
Sbjct:    55 PNTAYEGKIFQLKLFCGKEYPESPPTVRFQTRINMACVNPETGVVEPSLFPMLTNWRREY 114

Query:    72 TMEDILTQLKKEMAAPHNRKLVQPPEG 98
             TMEDIL +LKKEM   HNRKL QPPEG
Sbjct:   115 TMEDILVKLKKEMMTSHNRKLAQPPEG 141
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0016881 "acid-amino acid ligase activity" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0006301 "postreplication repair" evidence=IGI;RCA
GO:0031372 "UBC13-MMS2 complex" evidence=IPI
GO:0006623 "protein targeting to vacuole" evidence=RCA
TAIR|locus:2033561 MMZ2 "AT1G70660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292596 ube2v "putative ubiquitin-conjugating enzyme E2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
POMBASE|SPCC338.05c mms2 "ubiquitin conjugating enzyme Mms2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000013615 AN3644 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000003055 MMS2 "Ubiquitin-conjugating enzyme variant" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ52 UBE2V1 "Ubiquitin-conjugating enzyme E2 variant 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2I5 UBE2V1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P1M6 UBE2V1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q13404 UBE2V1 "Ubiquitin-conjugating enzyme E2 variant 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O74983MMS2_SCHPONo assigned EC number0.58420.80730.6330yesno
Q54D06UBE2V_DICDINo assigned EC number0.52740.82560.6521yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
COG5078153 COG5078, COG5078, Ubiquitin-protein ligase [Posttr 7e-14
smart00212145 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, 3e-09
PTZ00390152 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; 3e-05
cd00195141 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, ca 1e-04
pfam00179139 pfam00179, UQ_con, Ubiquitin-conjugating enzyme 4e-04
>gnl|CDD|227410 COG5078, COG5078, Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 63.1 bits (154), Expect = 7e-14
 Identities = 31/91 (34%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 9   FSGPQ-TVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNW 67
            +GP  T +EG I++L L   +DYP KPP VRF ++I    V+  +G V          W
Sbjct: 42  ITGPPDTPYEGGIFKLTLEFPEDYPFKPPKVRFTTKIFHPNVD-PSGNVCLDILKD--RW 98

Query: 68  QREYTMEDILTQLKKEMAAPHNRKLVQPPEG 98
              YT+E IL  L+  + +P N       E 
Sbjct: 99  SPVYTLETILLSLQSLLLSP-NPDSPLNTEA 128

Length = 153
>gnl|CDD|214562 smart00212, UBCc, Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>gnl|CDD|240397 PTZ00390, PTZ00390, ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>gnl|CDD|238117 cd00195, UBCc, Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>gnl|CDD|215772 pfam00179, UQ_con, Ubiquitin-conjugating enzyme Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
KOG0417148 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
COG5078153 Ubiquitin-protein ligase [Posttranslational modifi 100.0
KOG0419152 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
PTZ00390152 ubiquitin-conjugating enzyme; Provisional 100.0
PLN00172147 ubiquitin conjugating enzyme; Provisional 100.0
KOG0418200 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0425171 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0424158 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
KOG0421175 consensus Ubiquitin-protein ligase [Posttranslatio 100.0
PF00179140 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IP 100.0
cd00195141 UBCc Ubiquitin-conjugating enzyme E2, catalytic (U 100.0
smart00212145 UBCc Ubiquitin-conjugating enzyme E2, catalytic do 99.98
KOG0416189 consensus Ubiquitin-protein ligase [Posttranslatio 99.97
KOG0426165 consensus Ubiquitin-protein ligase [Posttranslatio 99.97
KOG0422153 consensus Ubiquitin-protein ligase [Posttranslatio 99.96
KOG0420184 consensus Ubiquitin-protein ligase [Posttranslatio 99.96
KOG0423223 consensus Ubiquitin-protein ligase [Posttranslatio 99.95
KOG0427161 consensus Ubiquitin conjugating enzyme [Posttransl 99.93
KOG0894 244 consensus Ubiquitin-protein ligase [Posttranslatio 99.9
KOG0896138 consensus Ubiquitin-conjugating enzyme E2 [Posttra 99.87
KOG0428 314 consensus Non-canonical ubiquitin conjugating enzy 99.77
KOG0429258 consensus Ubiquitin-conjugating enzyme-related pro 99.69
KOG0895 1101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.66
KOG0895 1101 consensus Ubiquitin-conjugating enzyme [Posttransl 99.44
PF14461133 Prok-E2_B: Prokaryotic E2 family B 98.64
KOG0897122 consensus Predicted ubiquitin-conjugating enzyme [ 98.53
PF05743121 UEV: UEV domain; InterPro: IPR008883 The N-termina 98.28
KOG2391 365 consensus Vacuolar sorting protein/ubiquitin recep 97.26
PF05773113 RWD: RWD domain; InterPro: IPR006575 The RWD eukar 95.37
PF14462122 Prok-E2_E: Prokaryotic E2 family E 94.94
PF14457162 Prok-E2_A: Prokaryotic E2 family A 93.85
smart00591107 RWD domain in RING finger and WD repeat containing 93.7
PF08694161 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1 93.2
PF06113 333 BRE: Brain and reproductive organ-expressed protei 83.23
>KOG0417 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-43  Score=237.67  Aligned_cols=101  Identities=20%  Similarity=0.388  Sum_probs=97.7

Q ss_pred             CeeEEEEEEcCCCCCCCCcEEEEEEEeCCCCCCCCCeeEEeeeeecCCccCCCceEecccCCCCCCCCCCCCHHHHHHHH
Q 033889            1 MVNYFPFFFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREYTMEDILTQL   80 (109)
Q Consensus         1 l~~W~~~i~Gp~~tpy~gg~f~~~i~f~~~YP~~pP~v~f~t~i~HpnV~~~~G~ic~~~l~~~~~W~p~~~i~~il~~i   80 (109)
                      |++|+++|.||.|||||||+|+++|.||++||++||+|+|.|+||||||+ +.|+||+++|+  ++|+|+++|++||++|
T Consensus        30 l~~w~a~I~GP~~SpYEgG~F~l~I~~p~~YP~~PPkV~F~TkIyHPNI~-~~G~IclDILk--~~WsPAl~i~~VllsI  106 (148)
T KOG0417|consen   30 LFHWQATILGPPGSPYEGGVFFLEIHFPEDYPFKPPKVRFLTKIYHPNID-SNGRICLDILK--DQWSPALTISKVLLSI  106 (148)
T ss_pred             eeeEEEEEECCCCCCcCCCEEEEEEECCCCCCCCCCceEeecccccCCcC-ccccchHHhhh--ccCChhhHHHHHHHHH
Confidence            57899999999999999999999999999999999999999999999999 89999999999  8999999999999999


Q ss_pred             HHHhhCCCCCCCCCCCCCCchhhh
Q 033889           81 KKEMAAPHNRKLVQPPEGPHHMDV  104 (109)
Q Consensus        81 ~~ll~~p~~~~~~~~~~~~~~~~~  104 (109)
                      ++||.+||++++..++++..|+.+
T Consensus       107 ~sLL~~PnpddPL~~~ia~~~k~d  130 (148)
T KOG0417|consen  107 CSLLSDPNPDDPLVPDIAELYKTD  130 (148)
T ss_pred             HHHhcCCCCCccccHHHHHHHHhh
Confidence            999999999999999999998843

>COG5078 Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0419 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00390 ubiquitin-conjugating enzyme; Provisional Back     alignment and domain information
>PLN00172 ubiquitin conjugating enzyme; Provisional Back     alignment and domain information
>KOG0418 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0425 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0424 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0421 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00179 UQ_con: Ubiquitin-conjugating enzyme; InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ] Back     alignment and domain information
>cd00195 UBCc Ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain Back     alignment and domain information
>smart00212 UBCc Ubiquitin-conjugating enzyme E2, catalytic domain homologues Back     alignment and domain information
>KOG0416 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0426 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0422 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0420 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0423 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0427 consensus Ubiquitin conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0894 consensus Ubiquitin-protein ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0896 consensus Ubiquitin-conjugating enzyme E2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0428 consensus Non-canonical ubiquitin conjugating enzyme 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0429 consensus Ubiquitin-conjugating enzyme-related protein Ft1, involved in programmed cell death [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0895 consensus Ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14461 Prok-E2_B: Prokaryotic E2 family B Back     alignment and domain information
>KOG0897 consensus Predicted ubiquitin-conjugating enzyme [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05743 UEV: UEV domain; InterPro: IPR008883 The N-terminal ubiquitin E2 variant (UEV) domain is ~145 amino acid residues in length and shows significant sequence similarity to E2 ubiquitin ligases but is unable to catalyze ubiquitin transfer as it lacks the active site cysteine that forms the transient thioester bond with the C terminus of ubiquitin (Ub) Back     alignment and domain information
>KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05773 RWD: RWD domain; InterPro: IPR006575 The RWD eukaryotic domain is found in RING finger (IPR001841 from INTERPRO) and WD repeat (IPR001680 from INTERPRO) containing proteins and DEXDc-like helicase (IPR001410 from INTERPRO) subfamily related to the ubiquitin-conjugating enzymes domain (IPR000608 from INTERPRO) Back     alignment and domain information
>PF14462 Prok-E2_E: Prokaryotic E2 family E Back     alignment and domain information
>PF14457 Prok-E2_A: Prokaryotic E2 family A Back     alignment and domain information
>smart00591 RWD domain in RING finger and WD repeat containing proteins and DEXDc-like helicases subfamily related to the UBCc domain Back     alignment and domain information
>PF08694 UFC1: Ubiquitin-fold modifier-conjugating enzyme 1; InterPro: IPR014806 Ubiquitin-like (UBL) post-translational modifiers are covalently linked to most, if not all, target protein(s) through an enzymatic cascade analogous to ubiquitylation, consisting of E1 (activating), E2 (conjugating), and E3 (ligating) enzymes Back     alignment and domain information
>PF06113 BRE: Brain and reproductive organ-expressed protein (BRE); InterPro: IPR010358 This family consists of several eukaryotic brain and reproductive organ-expressed (BRE) proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
3e95_C158 Crystal Structure Of The Plasmodium Falciparum Ubiq 1e-20
2q0v_A156 Crystal Structure Of Ubiquitin Conjugating Enzyme E 1e-20
2c2v_C142 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 2e-20
2a4d_A160 Structure Of The Human Ubiquitin-Conjugating Enzyme 2e-20
2hlw_A170 Solution Structure Of The Human Ubiquitin-Conjugati 3e-20
2gmi_B137 Mms2UBC13~UBIQUITIN Length = 137 3e-20
1jat_B138 Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Leng 4e-20
1j74_A145 Crystal Structure Of Mms2 Length = 145 3e-19
4epo_A149 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 3e-19
3von_B138 Crystalstructure Of The Ubiquitin Protease Length = 4e-19
1zgu_A139 Solution Structure Of The Human Mms2-Ubiquitin Comp 4e-19
4fh1_A153 S. Cerevisiae Ubc13-N79a Length = 153 6e-04
>pdb|3E95|C Chain C, Crystal Structure Of The Plasmodium Falciparum Ubiquitin Conjugating Enzyme Complex, Pfubc13-Pfuev1a Length = 158 Back     alignment and structure 
Iteration: 1

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
Query: 1   MVNYFPFFFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKK 60
           + N+    F  P TV E RIY L +FCD +YP+ PP+V+F ++I M+CV++  G V    
Sbjct: 58  LSNWSCTIFGQPGTVFENRIYSLTIFCDDNYPDSPPTVKFDTKIEMSCVDN-CGRVIKNN 116
Query: 61  FGLLVNWQREYTMEDILTQLKKEMAAPHNRKLVQPPEG 98
             +L NW R YT+E IL  L++EM +  N++L QP EG
Sbjct: 117 LHILKNWNRNYTIETILISLRQEMLSSANKRLPQPNEG 154
>pdb|2Q0V|A Chain A, Crystal Structure Of Ubiquitin Conjugating Enzyme E2, Putative, From Plasmodium Falciparum Length = 156 Back     alignment and structure
>pdb|2C2V|C Chain C, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 142 Back     alignment and structure
>pdb|2A4D|A Chain A, Structure Of The Human Ubiquitin-Conjugating Enzyme E2 Variant 1 (Uev- 1) Length = 160 Back     alignment and structure
>pdb|2HLW|A Chain A, Solution Structure Of The Human Ubiquitin-Conjugating Enzyme Variant Uev1a Length = 170 Back     alignment and structure
>pdb|2GMI|B Chain B, Mms2UBC13~UBIQUITIN Length = 137 Back     alignment and structure
>pdb|1JAT|B Chain B, Mms2UBC13 UBIQUITIN CONJUGATING ENZYME COMPLEX Length = 138 Back     alignment and structure
>pdb|1J74|A Chain A, Crystal Structure Of Mms2 Length = 145 Back     alignment and structure
>pdb|4EPO|A Chain A, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 Back     alignment and structure
>pdb|3VON|B Chain B, Crystalstructure Of The Ubiquitin Protease Length = 138 Back     alignment and structure
>pdb|1ZGU|A Chain A, Solution Structure Of The Human Mms2-Ubiquitin Complex Length = 139 Back     alignment and structure
>pdb|4FH1|A Chain A, S. Cerevisiae Ubc13-N79a Length = 153 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 7e-33
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 9e-33
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 3e-30
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 8e-30
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 5e-07
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 6e-07
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 9e-07
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 9e-07
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 2e-06
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 2e-06
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 2e-06
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 3e-06
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 3e-06
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 3e-06
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 3e-06
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 4e-06
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 4e-06
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 4e-06
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 5e-06
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 5e-06
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 6e-06
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 6e-06
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 7e-06
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 7e-06
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 7e-06
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 8e-06
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 9e-06
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 1e-05
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 1e-05
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 2e-05
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 2e-05
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 2e-05
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 2e-05
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 2e-05
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 3e-05
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 4e-05
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 4e-05
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 6e-05
3ceg_A 323 Baculoviral IAP repeat-containing protein 6; apopt 6e-05
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 6e-05
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 8e-05
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 1e-04
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 1e-04
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 1e-04
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 3e-04
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 5e-04
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 5e-04
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 5e-04
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 6e-04
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Length = 170 Back     alignment and structure
 Score =  111 bits (280), Expect = 7e-33
 Identities = 41/87 (47%), Positives = 58/87 (66%)

Query: 12  PQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREY 71
           P+T++E RIY LK+ C   YPE PP VRF ++INM  VN   GVV+P+   +L  WQ  Y
Sbjct: 79  PRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSY 138

Query: 72  TMEDILTQLKKEMAAPHNRKLVQPPEG 98
           +++ +L +L++ M +  N KL QPPEG
Sbjct: 139 SIKVVLQELRRLMMSKENMKLPQPPEG 165
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Length = 160 Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Length = 138 Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Length = 156 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Length = 201 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Length = 253 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Length = 159 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Length = 152 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Length = 179 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Length = 171 Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Length = 158 Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Length = 179 Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Length = 194 Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Length = 156 Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Length = 216 Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Length = 154 Back     alignment and structure
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Length = 149 Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Length = 136 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 193 Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 187 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Length = 166 Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Length = 155 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Length = 150 Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Length = 215 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Length = 125 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Length = 165 Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Length = 136 Back     alignment and structure
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Length = 149 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Length = 157 Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Length = 152 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Length = 161 Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 169 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} Length = 163 Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Length = 399 Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Length = 183 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} PDB: 3fsh_A 2cyx_A 2kly_A Length = 164 Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Length = 323 Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Length = 165 Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Length = 172 Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Length = 154 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Length = 172 Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Length = 155 Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Length = 190 Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Length = 160 Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Length = 167 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Length = 167 Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Length = 180 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
2r0j_A149 Ubiquitin carrier protein; ubiquitin conjugating, 100.0
1fxt_A149 Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NM 100.0
1jat_A155 Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, lig 100.0
2c2v_B154 Ubiquitin-conjugating enzyme E2 N; chaperone, heat 100.0
2ayv_A166 Ubiquitin-conjugating enzyme E2; structural genomi 100.0
2bep_A159 Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 100.0
4gpr_A151 Ubiquitin-conjugating enzyme family protein; ubiqu 100.0
1ayz_A169 UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin 100.0
1z2u_A150 Ubiquitin-conjugating enzyme E2 2; PSI, secsg, pro 100.0
2q0v_A156 Ubiquitin-conjugating enzyme E2, putative; malaria 100.0
2ucz_A165 UBC7, ubiquitin conjugating enzyme; ubiquitin conj 100.0
3rcz_B163 SUMO-conjugating enzyme UBC9; SUMO-like domain, pr 100.0
2c4o_A165 Ubiquitin-conjugating enzyme E2 D2; thioesterifica 100.0
1jat_B138 Ubiquitin-conjugating enzyme variant MMS2; UEV, li 100.0
2awf_A172 Ubiquitin-conjugating enzyme E2 G1; ligase, UBL co 100.0
2aak_A152 UBC1, ubiquitin conjugating enzyme; ubiquitin conj 100.0
2e2c_A156 Ubiquitin conjugating enzyme; ubiquitin conjugatio 100.0
3h8k_A164 Ubiquitin-conjugating enzyme E2 G2; alpha beta, al 100.0
2gjd_A157 Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT 100.0
1zdn_A158 Ubiquitin-conjugating enzyme E2S; structural genom 100.0
2f4z_A193 Tgtwinscan_2721 - E2 domain; ubiquitin conjugating 100.0
1yh2_A169 HSPC150 protein similar to ubiquitin-conjugating e 100.0
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 100.0
1i7k_A179 Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A 100.0
2grr_A161 Ubiquitin-conjugating enzyme E2 I; ubiquitin, conj 100.0
1yrv_A169 Ubiquitin-conjugating ligase MGC351130; structural 100.0
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 100.0
1y8x_A160 Ubiquitin-conjugating enzyme E2 M; ubiquitin-conju 100.0
2onu_A152 Ubiquitin-conjugating enzyme, putative; UBC, plasm 100.0
3bzh_A194 Ubiquitin-conjugating enzyme E2 E1; structural gen 100.0
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 100.0
2y9m_A172 Ubiquitin-conjugating enzyme E2-21 kDa; ligase-tra 100.0
3rz3_A183 Ubiquitin-conjugating enzyme E2 R1; ubiquitin conj 100.0
2nvu_C180 NEDD8-conjugating enzyme UBC12; multifunction macr 100.0
2fo3_A125 Ubiquitin-conjugating enzyme; SGC, UBC, structural 100.0
1yf9_A171 Ubiquitin carrier protein 4; SGPP, structural geno 100.0
2z5d_A179 Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, lig 100.0
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 100.0
2a4d_A160 Ubiquitin-conjugating enzyme E2 variant 1; alterna 100.0
1wzv_A155 Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A 100.0
1c4z_D154 UBCH7, ubiquitin conjugating enzyme E2; bilobal st 100.0
2hlw_A170 Ubiquitin-conjugating enzyme E2 variant 1; ubiquit 100.0
3fn1_B167 NEDD8-conjugating enzyme UBE2F; ligase, ATP-bindin 100.0
2h2y_A136 Ubiquitin-conjugating enzyme; structural genomics, 100.0
3o2u_A190 NEDD8-conjugating enzyme UBC12; E2 conjugase, liga 100.0
4ddg_A 399 Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI 100.0
2a7l_A136 Hypothetical ubiquitin-conjugating enzyme LOC55284 100.0
4ds2_A167 Ubiquitin-conjugating enzyme E2, putative; structu 100.0
3ceg_A323 Baculoviral IAP repeat-containing protein 6; apopt 99.97
2f4w_A187 Ubiquitin-conjugating enzyme E2, J2; endoplasmic r 99.97
1zuo_A186 Hypothetical protein LOC92912; ligase, ubiquitin-c 99.97
2z6o_A172 UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, p 99.89
3r3q_A162 Suppressor protein STP22 of temperature-sensitive 99.82
3kpa_A168 Probable ubiquitin fold modifier conjugating ENZY; 99.61
3obq_A146 Tumor susceptibility gene 101 protein; protein tra 99.58
2ebm_A128 RWD domain-containing protein 1; alpha+beta sandwi 94.77
2day_A128 Ring finger protein 25; ligase, metal-binding, UB1 93.53
2yz0_A138 Serine/threonine-protein kinase GCN2; A-B-B-B-B-A- 93.48
3zqs_A186 E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A 92.28
1ukx_A137 GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple 92.06
2dax_A152 Protein C21ORF6; RWD domain, alpha+beta sandwich f 90.47
2ebk_A128 RWD domain-containing protein 3; alpha+beta sandwi 90.32
2daw_A154 RWD domain containing protein 2; alpha+beta sandwi 89.65
>2r0j_A Ubiquitin carrier protein; ubiquitin conjugating, malaria, ligas conjugation pathway, structural genomics, structural genomi consortium; 1.85A {Plasmodium falciparum} PDB: 3e95_A Back     alignment and structure
Probab=100.00  E-value=1.1e-39  Score=221.57  Aligned_cols=102  Identities=20%  Similarity=0.374  Sum_probs=97.5

Q ss_pred             CeeEEEEEEcCCCCCCCCcEEEEEEEeCCCCCCCCCeeEEeeeeecCCccCCCceEecccCCCCCCCCCCCCHHHHHHHH
Q 033889            1 MVNYFPFFFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREYTMEDILTQL   80 (109)
Q Consensus         1 l~~W~~~i~Gp~~tpy~gg~f~~~i~f~~~YP~~pP~v~f~t~i~HpnV~~~~G~ic~~~l~~~~~W~p~~~i~~il~~i   80 (109)
                      +++|+++|.||++|||+||.|+++|.||++||++||+|+|.|+||||||+ .+|.||+++|+  ++|+|+++|++||.+|
T Consensus        30 l~~w~~~i~Gp~~tpyegg~f~~~i~fp~~YP~~PP~v~f~t~i~HPnv~-~~G~iCl~iL~--~~W~p~~~i~~vl~~i  106 (149)
T 2r0j_A           30 YRHFNILINGPDGTPYEGGTYKLELFLPEQYPMEPPKVRFLTKIYHPNID-KLGRICLDILK--DKWSPALQIRTVLLSI  106 (149)
T ss_dssp             EEEEEEEEECCTTSTTTTCEEEEEEECCTTTTTSCCEEEECSCCCBTTBC-TTCBBCCGGGT--TTCCTTSCHHHHHHHH
T ss_pred             ccEEEEEEECCCCCCcCCCEEEEEEeCCcccCCCCCeeEeccCCccCCCC-CCCEEechhcC--CCCCCCCcHHHHHHHH
Confidence            47899999999999999999999999999999999999999999999999 68999999998  8999999999999999


Q ss_pred             HHHhhCCCCCCCCCCCCCCchhhhh
Q 033889           81 KKEMAAPHNRKLVQPPEGPHHMDVY  105 (109)
Q Consensus        81 ~~ll~~p~~~~~~~~~~~~~~~~~~  105 (109)
                      +++|.+|+++++.|++++.+|.++.
T Consensus       107 ~~ll~~p~~~~p~n~~aa~~~~~~~  131 (149)
T 2r0j_A          107 QALLSSPEPDDPLDSKVAEHFKQDK  131 (149)
T ss_dssp             HHHHHSCCTTSCSSCHHHHHHHHCH
T ss_pred             HHHHhCCCCCCchhHHHHHHHHHCH
Confidence            9999999999999999999888553
>1fxt_A Ubiquitin-conjugating enzyme E2-24 kDa; ligase; NMR {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1fzy_A Back     alignment and structure
>1jat_A Ubiquitin-conjugating enzyme E2-17.5 kDa; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 1jbb_A 2gmi_A 3hct_B 3hcu_B 4dhi_D 1j7d_B 4dhj_C 4dhz_F Back     alignment and structure
>2c2v_B Ubiquitin-conjugating enzyme E2 N; chaperone, heat-shock protein complex, E3 ligase, ubiquitiny TPR, heat-shock protein; 2.9A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2ayv_A Ubiquitin-conjugating enzyme E2; structural genomics, structural genomics consortium, ubiquit ubiquitin-conjugating enzyme, SGC, ligase; 2.00A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>2bep_A Ubiquitin-conjugating enzyme E2-25 kDa; ligase, E2 conjugating enzyme, protein degradatio structural proteomics in europe, spine; 1.8A {Bos taurus} SCOP: d.20.1.1 PDB: 2bf8_A Back     alignment and structure
>4gpr_A Ubiquitin-conjugating enzyme family protein; ubiquitin conjugation, EHU ehring1, thiol esterification, ligase; 1.60A {Entamoeba histolytica} Back     alignment and structure
>1ayz_A UBC2, ubiquitin-conjugating enzyme RAD6; ubiquitin conjugation; 2.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>1z2u_A Ubiquitin-conjugating enzyme E2 2; PSI, secsg, proteosome pathway, structural genomics, protein structure initiative; 1.10A {Caenorhabditis elegans} SCOP: d.20.1.1 PDB: 3tgd_A 2esk_A 1ur6_A 1w4u_A 4a49_B* 4a4b_C* 4a4c_C* 3eb6_B 3l1y_A 2esp_A 2eso_A 2esq_A 3l1z_A 2oxq_A 3a33_A 4ddg_D 4ddi_D 1x23_A 3rpg_A 2fuh_A ... Back     alignment and structure
>2q0v_A Ubiquitin-conjugating enzyme E2, putative; malaria, structural G structural genomics consortium, SGC, ligase; 2.40A {Plasmodium falciparum} PDB: 3e95_C Back     alignment and structure
>2ucz_A UBC7, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase, yeast; 2.93A {Saccharomyces cerevisiae} SCOP: d.20.1.1 Back     alignment and structure
>3rcz_B SUMO-conjugating enzyme UBC9; SUMO-like domain, protein:protein interaction, protein ligase complex; HET: DNA; 1.90A {Schizosaccharomyces pombe} SCOP: d.20.1.1 Back     alignment and structure
>2c4o_A Ubiquitin-conjugating enzyme E2 D2; thioesterification, ligase, UBL conjugation pathway; HET: CME; 1.94A {Homo sapiens} SCOP: d.20.1.1 PDB: 2clw_A* 2c4p_A Back     alignment and structure
>1jat_B Ubiquitin-conjugating enzyme variant MMS2; UEV, ligase; 1.60A {Saccharomyces cerevisiae} SCOP: d.20.1.1 PDB: 2gmi_B Back     alignment and structure
>2awf_A Ubiquitin-conjugating enzyme E2 G1; ligase, UBL conjugation pathway, structural genomics, structural genomics consortium SGC; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1pzv_A Back     alignment and structure
>2aak_A UBC1, ubiquitin conjugating enzyme; ubiquitin conjugation, ligase; 2.40A {Arabidopsis thaliana} SCOP: d.20.1.1 PDB: 1jas_A 2y4w_A 2yb6_A 2ybf_A 1q34_A 1z3d_A Back     alignment and structure
>2e2c_A Ubiquitin conjugating enzyme; ubiquitin conjugation, ubiquitin carrier protein, thioester ligase; 2.00A {Spisula solidissima} SCOP: d.20.1.1 Back     alignment and structure
>3h8k_A Ubiquitin-conjugating enzyme E2 G2; alpha beta, all alpha, ligase, UBL conjugation pathway, endo reticulum, membrane, metal-binding; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 3fsh_A 2cyx_A 2kly_A Back     alignment and structure
>2gjd_A Ubiquitin-conjugating enzyme E2-18 kDa; UBC9P, SMT3, crystallography, ligase; 1.75A {Saccharomyces cerevisiae} PDB: 2eke_A 3ong_B Back     alignment and structure
>1zdn_A Ubiquitin-conjugating enzyme E2S; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC; 1.93A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2f4z_A Tgtwinscan_2721 - E2 domain; ubiquitin conjugating tgtwinscan_2721, structural genomics, structural genomics consortium, SGC; 2.11A {Toxoplasma gondii} SCOP: d.20.1.1 Back     alignment and structure
>1yh2_A HSPC150 protein similar to ubiquitin-conjugating enzyme; structural genomics consortium, HSCP150, ligase, SGC; 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>1i7k_A Ubiquitin-conjugating enzyme E2 H10; ligase; 1.95A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2grr_A Ubiquitin-conjugating enzyme E2 I; ubiquitin, conjugation, small ubiquitin like modifer, SMT3, ligase; 1.30A {Homo sapiens} PDB: 2grq_A 2grn_A 2pe6_A 2gro_A 2grp_A 1u9a_A 1u9b_A 2vrr_A 2px9_B 1z5s_A 2xwu_A 3uin_A 3uio_A 3uip_A* 1kps_A 2o25_C 1a3s_A 3a4s_A 2uyz_A Back     alignment and structure
>1yrv_A Ubiquitin-conjugating ligase MGC351130; structural genomics consortium, SGC, ubiquitin- conjugating enzyme; 2.18A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>1y8x_A Ubiquitin-conjugating enzyme E2 M; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2onu_A Ubiquitin-conjugating enzyme, putative; UBC, plasmodium FAL structural genomics consortium, SGC, ligase; HET: PG4; 2.38A {Plasmodium falciparum} Back     alignment and structure
>3bzh_A Ubiquitin-conjugating enzyme E2 E1; structural genomics consortium, ubiquitin-conjuga enzyme, ligase, SGC, UBL conjugation pathway; 1.60A {Homo sapiens} PDB: 1y6l_A Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2y9m_A Ubiquitin-conjugating enzyme E2-21 kDa; ligase-transport protein complex, ubiquitin conjugating ENZY complex, peroxisomal protein; 2.60A {Saccharomyces cerevisiae} PDB: 2y9p_A 2y9o_A Back     alignment and structure
>3rz3_A Ubiquitin-conjugating enzyme E2 R1; ubiquitin conjugating enzyme domain, E2 domain, ligase-ligas inhibitor complex; HET: U94; 2.30A {Homo sapiens} PDB: 2ob4_A Back     alignment and structure
>2nvu_C NEDD8-conjugating enzyme UBC12; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>2fo3_A Ubiquitin-conjugating enzyme; SGC, UBC, structural genomics, structural genomics consortium, unknown function; 1.86A {Plasmodium vivax} SCOP: d.20.1.1 Back     alignment and structure
>1yf9_A Ubiquitin carrier protein 4; SGPP, structural genomics, PSI, protein structure initiative ubiquitin conjugating enzyme; 2.00A {Leishmania major} SCOP: d.20.1.1 Back     alignment and structure
>2z5d_A Ubiquitin-conjugating enzyme E2 H; UBE2H, SGC, ligase, structural genomics, structural genomics consortium; 2.10A {Homo sapiens} Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>2a4d_A Ubiquitin-conjugating enzyme E2 variant 1; alternative splicing, nuclear protein, UBL conjugation pathway,ubiquitin, ligase, structural genomics; 1.69A {Homo sapiens} SCOP: d.20.1.1 PDB: 2c2v_C 1j7d_A 1j74_A 1zgu_A Back     alignment and structure
>1wzv_A Ubiquitin-conjugating enzyme E2 L6; ligase; 2.10A {Homo sapiens} SCOP: d.20.1.1 PDB: 1wzw_A 2kjh_A Back     alignment and structure
>1c4z_D UBCH7, ubiquitin conjugating enzyme E2; bilobal structure, elongated shape, E3 ubiquitin ligase, E2 ubiquitin conjugating enzyme; 2.60A {Homo sapiens} SCOP: d.20.1.1 PDB: 1fbv_C* 3sy2_C 3sqv_C Back     alignment and structure
>2hlw_A Ubiquitin-conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme variant, UBC13, HUBC13, polyubiquitination, ligase, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3fn1_B NEDD8-conjugating enzyme UBE2F; ligase, ATP-binding, cell cycle, nucleotide-binding, UBL CON pathway; 2.50A {Homo sapiens} PDB: 2edi_A Back     alignment and structure
>2h2y_A Ubiquitin-conjugating enzyme; structural genomics, unknown function, structural genomics consortium, SGC; 2.80A {Plasmodium falciparum 3D7} Back     alignment and structure
>3o2u_A NEDD8-conjugating enzyme UBC12; E2 conjugase, ligase; 2.00A {Saccharomyces cerevisiae} PDB: 3tdi_C Back     alignment and structure
>4ddg_A Ubiquitin-conjugating enzyme E2 D2, ubiquitin THI OTUB1; inhibition, hydrolase-ligase complex; 3.30A {Homo sapiens} PDB: 4ddi_A Back     alignment and structure
>2a7l_A Hypothetical ubiquitin-conjugating enzyme LOC55284; structural genomics consortium, (SGC), ligase; 1.82A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>4ds2_A Ubiquitin-conjugating enzyme E2, putative; structural genomics, PSI, protein structure initiative; 2.63A {Trypanosoma cruzi} Back     alignment and structure
>3ceg_A Baculoviral IAP repeat-containing protein 6; apoptosis, ligase, protease inhibitor, thiol protease inhibitor, UBL conjugation pathway; HET: MSE; 2.01A {Homo sapiens} Back     alignment and structure
>2f4w_A Ubiquitin-conjugating enzyme E2, J2; endoplasmic reticulum, ligase, UBL conjugation pathway, structural genomics consortium (SGC); 2.00A {Homo sapiens} SCOP: d.20.1.1 Back     alignment and structure
>1zuo_A Hypothetical protein LOC92912; ligase, ubiquitin-conjugating enzyme, structural genomics consortium ,SGC; 1.80A {Homo sapiens} SCOP: d.20.1.1 PDB: 2qgx_A Back     alignment and structure
>2z6o_A UFM1-conjugating enzyme 1; UFC1, ubiquitin, UBL, polymorphism, UBL conjugation pathway, ligase; 1.60A {Homo sapiens} PDB: 2z6p_A 1ywz_A 2in1_A 2k07_A 3e2g_A 3evx_A Back     alignment and structure
>3r3q_A Suppressor protein STP22 of temperature-sensitive factor receptor and arginine permease...; endosomal sorting, ESCRT-I; 1.45A {Saccharomyces cerevisiae} SCOP: d.20.1.2 PDB: 3r42_A 1uzx_A* Back     alignment and structure
>3kpa_A Probable ubiquitin fold modifier conjugating ENZY; UBL conjugation pathway, ligase, structural genomics, PSI; 2.20A {Leishmania major} SCOP: d.20.1.4 Back     alignment and structure
>3obq_A Tumor susceptibility gene 101 protein; protein transprot, ubiquitin binding, protein transport; 1.40A {Homo sapiens} SCOP: d.20.1.2 PDB: 3obs_A 3obu_A 3obx_A 3p9g_A* 3p9h_A* 2f0r_A 1kpp_A 1kpq_A 1m4p_A 1m4q_A 1s1q_A Back     alignment and structure
>2ebm_A RWD domain-containing protein 1; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2day_A Ring finger protein 25; ligase, metal-binding, UB1 conjugation, UB1 conjugation pathway, RWD domain, alpha+beta sandwich fold, structural genomics; NMR {Homo sapiens} SCOP: d.20.1.3 PDB: 2dmf_A Back     alignment and structure
>2yz0_A Serine/threonine-protein kinase GCN2; A-B-B-B-B-A-A, amino acid starvation signal response, EIF2alpha kinase, transferase; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3zqs_A E3 ubiquitin-protein ligase fancl; HET: P6G; 2.00A {Homo sapiens} Back     alignment and structure
>1ukx_A GCN2, GCN2 EIF2alpha kinase; UBC-like fold, triple beta-turns, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.20.1.3 Back     alignment and structure
>2dax_A Protein C21ORF6; RWD domain, alpha+beta sandwich fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure
>2ebk_A RWD domain-containing protein 3; alpha+beta sandwich fold, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2daw_A RWD domain containing protein 2; alpha+beta sandwich fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.20.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d2a4da1139 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, 3e-24
d1jatb_136 d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {B 4e-21
d2awfa1125 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, U 9e-10
d2fo3a1109 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating 1e-05
d1pzva_161 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {N 1e-05
d1z2ua1147 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, U 3e-05
d2uyza1156 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, U 7e-05
d2f4za1161 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinsca 1e-04
d1ayza_153 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 2e-04
d2a7la1117 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 2e-04
d2e2ca_156 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {C 3e-04
d1jata_152 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {B 0.001
d2f4wa1157 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, 0.003
d1y6la_148 d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {H 0.004
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Length = 139 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Human (Homo sapiens), E2 variant 1 [TaxId: 9606]

 Score = 87.7 bits (217), Expect = 3e-24
 Identities = 41/91 (45%), Positives = 58/91 (63%)

Query: 8   FFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNW 67
               P+T++E RIY LK+ C   YPE PP VRF ++INM  VN   GVV+P+   +L  W
Sbjct: 45  IIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKW 104

Query: 68  QREYTMEDILTQLKKEMAAPHNRKLVQPPEG 98
           Q  Y+++ +L +L++ M +  N KL QPPEG
Sbjct: 105 QNSYSIKVVLQELRRLMMSKENMKLPQPPEG 135
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Length = 136 Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Length = 109 Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Length = 161 Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Length = 147 Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Length = 161 Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Length = 153 Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Length = 156 Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Length = 152 Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Length = 157 Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Length = 148 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1jatb_136 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d2a4da1139 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2f4za1161 Hypothetical protein Tgtwinscan_2721, E2 domain {T 100.0
d1yrva1148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2bepa1154 Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain 100.0
d1jata_152 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1i7ka_146 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2e2ca_156 Ubiquitin conjugating enzyme, UBC {Clam (Spisula s 100.0
d1z3da1149 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d1j7db_149 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1z2ua1147 Ubiquitin conjugating enzyme, UBC {Caenorhabditis 100.0
d2uyza1156 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1y6la_148 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1fzya_149 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1yh2a1154 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1zdna1151 Ubiquitin conjugating enzyme, UBC {Human(Homo sapi 100.0
d2ucza_164 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d1c4zd_144 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1pzva_161 Ubiquitin conjugating enzyme, UBC {Nematode (Caeno 100.0
d1ayza_153 Ubiquitin conjugating enzyme, UBC {Baker's yeast ( 100.0
d2a7la1117 Ubiquitin-protein ligase W (E2 W) {Human (Homo sap 100.0
d2awfa1125 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1y8xa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1wzva1150 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d1yf9a1158 Ubiquitin conjugating enzyme, UBC {Leishmania majo 100.0
d2z5da1152 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 100.0
d2fo3a1109 Putative ubiquitin-conjugating enzyme, E2 domain { 100.0
d1zuoa1162 Ubiquitin-conjugating enzyme E2 Q2, C-terminal dom 99.97
d2f4wa1157 Ubiquitin conjugating enzyme, UBC {Human (Homo sap 99.96
d1s1qa_141 Tumor susceptibility gene 101 (TSG101) {Human (Hom 99.81
d1uzxa_152 Vacuolar protein sorting-associated {Baker's yeast 99.75
d2daya1115 E3 ubiquitin-protein ligase RNF25 {Human (Homo sap 92.5
d2in1a1162 Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapie 91.91
d2daxa1140 Uncharacterized protein C21orf6 {Human (Homo sapie 89.78
d2dawa1141 RWD domain-containing protein 2 {Human (Homo sapie 89.12
d1ukxa_137 EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mu 88.42
>d1jatb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: UBC-like
superfamily: UBC-like
family: UBC-related
domain: Ubiquitin conjugating enzyme, UBC
species: Baker's yeast (Saccharomyces cerevisiae), mms2 [TaxId: 4932]

Probab=100.00  E-value=3.6e-39  Score=214.67  Aligned_cols=100  Identities=45%  Similarity=0.816  Sum_probs=95.0

Q ss_pred             CeeEEEEEEcCCCCCCCCcEEEEEEEeCCCCCCCCCeeEEeeeeecCCccCCCceEecccCCCCCCCCCCCCHHHHHHHH
Q 033889            1 MVNYFPFFFSGPQTVHEGRIYQLKLFCDKDYPEKPPSVRFHSRINMTCVNHETGVVEPKKFGLLVNWQREYTMEDILTQL   80 (109)
Q Consensus         1 l~~W~~~i~Gp~~tpy~gg~f~~~i~f~~~YP~~pP~v~f~t~i~HpnV~~~~G~ic~~~l~~~~~W~p~~~i~~il~~i   80 (109)
                      |++|+++|.||++|||+||+|+++|.||++||++||+|+|.|+++||||+..+|.||++++. .++|+|++||++||++|
T Consensus        37 l~~W~~~i~Gp~~tpy~gg~f~~~i~fp~~YP~~PP~v~f~t~i~HpnV~~~~G~icl~~l~-~~~Wsp~~ti~~IL~~i  115 (136)
T d1jatb_          37 MTKWNGTILGPPHSNHENRIYSLSIDCGPNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHT-LRDWKRAYTMETLLLDL  115 (136)
T ss_dssp             CCEEEEEEECCSSSTTTTCEEEEEEECCTTTTTSCCEEEESBCCCCTTBCTTTCBBCTTSHH-HHTCCTTCCHHHHHHHH
T ss_pred             eeEEEEEEECCCCChhhcCEEEEEEEecCCCCCCCCEEEEeccccccccccCCCeEECCCCc-ccCcCccCcHHHHHHHH
Confidence            57899999999999999999999999999999999999999999999999778999999763 26899999999999999


Q ss_pred             HHHhhCCCCCCCCCCCCCCch
Q 033889           81 KKEMAAPHNRKLVQPPEGPHH  101 (109)
Q Consensus        81 ~~ll~~p~~~~~~~~~~~~~~  101 (109)
                      +++|.+|++.+++||+||++|
T Consensus       116 ~~lL~~P~n~~~~q~~~g~~y  136 (136)
T d1jatb_         116 RKEMATPANKKLRQPKEGETF  136 (136)
T ss_dssp             HHHHTSHHHHTSCCCCTTCBC
T ss_pred             HHHHcCCCCCCCCCCCCCCcC
Confidence            999999999999999999987
>d2a4da1 d.20.1.1 (A:82-220) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 variant 1 [TaxId: 9606]} Back     information, alignment and structure
>d2f4za1 d.20.1.1 (A:32-192) Hypothetical protein Tgtwinscan_2721, E2 domain {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1yrva1 d.20.1.1 (A:1-148) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 U [TaxId: 9606]} Back     information, alignment and structure
>d2bepa1 d.20.1.1 (A:1-154) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jata_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]} Back     information, alignment and structure
>d1i7ka_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch10 [TaxId: 9606]} Back     information, alignment and structure
>d2e2ca_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Clam (Spisula solidissima), E-2C [TaxId: 6584]} Back     information, alignment and structure
>d1z3da1 d.20.1.1 (A:2-150) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-21.5 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1j7db_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]} Back     information, alignment and structure
>d1z2ua1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Caenorhabditis elegans, E2 2 [TaxId: 6239]} Back     information, alignment and structure
>d2uyza1 d.20.1.1 (A:3-158) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc9 [TaxId: 9606]} Back     information, alignment and structure
>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} Back     information, alignment and structure
>d1fzya_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId: 4932]} Back     information, alignment and structure
>d1yh2a1 d.20.1.1 (A:1-154) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 T [TaxId: 9606]} Back     information, alignment and structure
>d1zdna1 d.20.1.1 (A:6-156) Ubiquitin conjugating enzyme, UBC {Human(Homo sapiens), E2 S [TaxId: 9606]} Back     information, alignment and structure
>d2ucza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc7 [TaxId: 4932]} Back     information, alignment and structure
>d1c4zd_ d.20.1.1 (D:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch7 [TaxId: 9606]} Back     information, alignment and structure
>d1pzva_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Nematode (Caenorhabditis elegans), E2-19 kDa [TaxId: 6239]} Back     information, alignment and structure
>d1ayza_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]} Back     information, alignment and structure
>d2a7la1 d.20.1.1 (A:1-117) Ubiquitin-protein ligase W (E2 W) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awfa1 d.20.1.1 (A:7-131) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 G1 [TaxId: 9606]} Back     information, alignment and structure
>d1y8xa1 d.20.1.1 (A:27-183) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 M [TaxId: 9606]} Back     information, alignment and structure
>d1wzva1 d.20.1.1 (A:2-151) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 L6 [TaxId: 9606]} Back     information, alignment and structure
>d1yf9a1 d.20.1.1 (A:13-170) Ubiquitin conjugating enzyme, UBC {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2fo3a1 d.20.1.1 (A:9-117) Putative ubiquitin-conjugating enzyme, E2 domain {Plasmodium chabaudi [TaxId: 5825]} Back     information, alignment and structure
>d1zuoa1 d.20.1.1 (A:201-362) Ubiquitin-conjugating enzyme E2 Q2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f4wa1 d.20.1.1 (A:12-168) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), E2 J2 [TaxId: 9606]} Back     information, alignment and structure
>d1s1qa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzxa_ d.20.1.2 (A:) Vacuolar protein sorting-associated {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2daya1 d.20.1.3 (A:8-122) E3 ubiquitin-protein ligase RNF25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2in1a1 d.20.1.4 (A:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2daxa1 d.20.1.3 (A:8-147) Uncharacterized protein C21orf6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dawa1 d.20.1.3 (A:8-148) RWD domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukxa_ d.20.1.3 (A:) EIF2-alpha kinase 4 (GCN2-like protein) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure