Citrus Sinensis ID: 033949
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| 255545392 | 112 | conserved hypothetical protein [Ricinus | 1.0 | 0.955 | 0.687 | 2e-38 | |
| 224063078 | 113 | predicted protein [Populus trichocarpa] | 1.0 | 0.946 | 0.663 | 2e-37 | |
| 297846816 | 101 | hypothetical protein ARALYDRAFT_891393 [ | 0.943 | 1.0 | 0.654 | 2e-34 | |
| 15219391 | 101 | uncharacterized protein [Arabidopsis tha | 0.943 | 1.0 | 0.654 | 2e-34 | |
| 225459571 | 102 | PREDICTED: uncharacterized protein LOC10 | 0.953 | 1.0 | 0.654 | 6e-30 | |
| 226531153 | 106 | uncharacterized protein LOC100275135 [Ze | 0.990 | 1.0 | 0.598 | 1e-29 | |
| 242090657 | 110 | hypothetical protein SORBIDRAFT_09g02146 | 1.0 | 0.972 | 0.581 | 6e-29 | |
| 357133537 | 106 | PREDICTED: uncharacterized protein LOC10 | 0.990 | 1.0 | 0.598 | 1e-28 | |
| 356552679 | 114 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.938 | 0.552 | 3e-28 | |
| 326487958 | 104 | predicted protein [Hordeum vulgare subsp | 0.971 | 1.0 | 0.579 | 1e-27 |
| >gi|255545392|ref|XP_002513756.1| conserved hypothetical protein [Ricinus communis] gi|223546842|gb|EEF48339.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 162 bits (410), Expect = 2e-38, Method: Compositional matrix adjust.
Identities = 77/112 (68%), Positives = 89/112 (79%), Gaps = 5/112 (4%)
Query: 1 MFFFFVGGVNQQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCN 60
MFFFF GGV QQVSRVLKSG GRC+NCGS ADLVEYEKVLK FF+PV+KWP KEPA++CN
Sbjct: 1 MFFFFAGGVEQQVSRVLKSGVGRCVNCGSMADLVEYEKVLKLFFIPVYKWPGKEPAMYCN 60
Query: 61 NCNLLFPSSLPPPPP-----PPPLVSDVSKCRFCDRLVEPDFSFCPYCGSAL 107
NCNL+FP S PPP P VSD +C FCDR+ EP+F FCP+CG++L
Sbjct: 61 NCNLMFPRSFSFPPPRTDSVSPSAVSDGLRCHFCDRVAEPEFRFCPFCGNSL 112
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224063078|ref|XP_002300985.1| predicted protein [Populus trichocarpa] gi|222842711|gb|EEE80258.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297846816|ref|XP_002891289.1| hypothetical protein ARALYDRAFT_891393 [Arabidopsis lyrata subsp. lyrata] gi|297337131|gb|EFH67548.1| hypothetical protein ARALYDRAFT_891393 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15219391|ref|NP_175087.1| uncharacterized protein [Arabidopsis thaliana] gi|13876513|gb|AAK43489.1|AC084807_14 hypothetical protein [Arabidopsis thaliana] gi|44917499|gb|AAS49074.1| At1g44414 [Arabidopsis thaliana] gi|332193912|gb|AEE32033.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225459571|ref|XP_002285858.1| PREDICTED: uncharacterized protein LOC100262547 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|226531153|ref|NP_001142776.1| uncharacterized protein LOC100275135 [Zea mays] gi|195609474|gb|ACG26567.1| hypothetical protein [Zea mays] gi|195641802|gb|ACG40369.1| hypothetical protein [Zea mays] gi|413949185|gb|AFW81834.1| hypothetical protein ZEAMMB73_807317 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|242090657|ref|XP_002441161.1| hypothetical protein SORBIDRAFT_09g021460 [Sorghum bicolor] gi|241946446|gb|EES19591.1| hypothetical protein SORBIDRAFT_09g021460 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|357133537|ref|XP_003568381.1| PREDICTED: uncharacterized protein LOC100838692 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|356552679|ref|XP_003544690.1| PREDICTED: uncharacterized protein LOC100820054 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|326487958|dbj|BAJ89818.1| predicted protein [Hordeum vulgare subsp. vulgare] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| TAIR|locus:2823681 | 101 | AT1G44414 "AT1G44414" [Arabido | 0.850 | 0.900 | 0.597 | 3.9e-28 |
| TAIR|locus:2823681 AT1G44414 "AT1G44414" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 314 (115.6 bits), Expect = 3.9e-28, P = 3.9e-28
Identities = 58/97 (59%), Positives = 71/97 (73%)
Query: 11 QQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCNNCNLLFXXXX 70
QQV +VLKSGAG CI CGS ADLVEY+KV+K FFVPVW+WP K+P L C +C+L F
Sbjct: 11 QQVRQVLKSGAGTCIRCGSQADLVEYDKVIKLFFVPVWRWPGKDPLLHCRDCDLFFPQSL 70
Query: 71 XXXXXXXXXVSDVSKCRFCDRLVEPDFSFCPYCGSAL 107
VS ++ CRFCDR+VEP+F FCP+CGS+L
Sbjct: 71 SPPP-----VS-LATCRFCDRVVEPEFRFCPFCGSSL 101
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.327 0.140 0.481 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 107 86 0.00091 102 3 11 22 0.39 29
29 0.47 30
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 554 (59 KB)
Total size of DFA: 121 KB (2078 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 8.24u 0.14s 8.38t Elapsed: 00:00:01
Total cpu time: 8.24u 0.14s 8.38t Elapsed: 00:00:01
Start: Fri May 10 09:17:33 2013 End: Fri May 10 09:17:34 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0003070401 | hypothetical protein (113 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| PF12773 | 50 | DZR: Double zinc ribbon | 99.23 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 99.11 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 99.08 | |
| PRK14559 | 645 | putative protein serine/threonine phosphatase; Pro | 98.95 | |
| PRK14714 | 1337 | DNA polymerase II large subunit; Provisional | 98.61 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 98.47 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 98.26 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 97.85 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 97.82 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 97.77 | |
| PRK04023 | 1121 | DNA polymerase II large subunit; Validated | 97.57 | |
| PF03833 | 900 | PolC_DP2: DNA polymerase II large subunit DP2; Int | 97.5 | |
| PRK14559 | 645 | putative protein serine/threonine phosphatase; Pro | 97.4 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 97.37 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 97.33 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 97.3 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 97.14 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 97.13 | |
| smart00659 | 44 | RPOLCX RNA polymerase subunit CX. present in RNA p | 97.06 | |
| PF03604 | 32 | DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa | 96.88 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 96.76 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 96.75 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 96.7 | |
| PRK14714 | 1337 | DNA polymerase II large subunit; Provisional | 96.57 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 96.56 | |
| PRK04023 | 1121 | DNA polymerase II large subunit; Validated | 96.52 | |
| PF09889 | 59 | DUF2116: Uncharacterized protein containing a Zn-r | 96.51 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 96.41 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 96.4 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 96.39 | |
| COG1996 | 49 | RPC10 DNA-directed RNA polymerase, subunit RPC10 ( | 96.34 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 96.32 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 96.32 | |
| PF13719 | 37 | zinc_ribbon_5: zinc-ribbon domain | 96.18 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 96.13 | |
| PRK00420 | 112 | hypothetical protein; Validated | 95.99 | |
| COG2093 | 64 | DNA-directed RNA polymerase, subunit E'' [Transcri | 95.98 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 95.96 | |
| PRK12496 | 164 | hypothetical protein; Provisional | 95.96 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 95.95 | |
| smart00834 | 41 | CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C | 95.92 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 95.9 | |
| PF15616 | 131 | TerY-C: TerY-C metal binding domain | 95.84 | |
| smart00834 | 41 | CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C | 95.82 | |
| PF07282 | 69 | OrfB_Zn_ribbon: Putative transposase DNA-binding d | 95.79 | |
| TIGR01384 | 104 | TFS_arch transcription factor S, archaeal. There h | 95.74 | |
| PRK13130 | 56 | H/ACA RNA-protein complex component Nop10p; Review | 95.74 | |
| PF13719 | 37 | zinc_ribbon_5: zinc-ribbon domain | 95.73 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 95.71 | |
| PF11023 | 114 | DUF2614: Protein of unknown function (DUF2614); In | 95.69 | |
| smart00659 | 44 | RPOLCX RNA polymerase subunit CX. present in RNA p | 95.53 | |
| PRK14892 | 99 | putative transcription elongation factor Elf1; Pro | 95.45 | |
| COG1439 | 177 | Predicted nucleic acid-binding protein, consists o | 95.44 | |
| PF09862 | 113 | DUF2089: Protein of unknown function (DUF2089); In | 95.4 | |
| PF07754 | 24 | DUF1610: Domain of unknown function (DUF1610); Int | 95.37 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 95.32 | |
| PRK03681 | 114 | hypA hydrogenase nickel incorporation protein; Val | 95.3 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 95.24 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 95.23 | |
| PRK12380 | 113 | hydrogenase nickel incorporation protein HybF; Pro | 95.22 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 95.22 | |
| cd00729 | 34 | rubredoxin_SM Rubredoxin, Small Modular nonheme ir | 95.11 | |
| PRK02935 | 110 | hypothetical protein; Provisional | 95.02 | |
| PF03604 | 32 | DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa | 95.01 | |
| PF10601 | 73 | zf-LITAF-like: LITAF-like zinc ribbon domain; Inte | 95.01 | |
| TIGR01206 | 54 | lysW lysine biosynthesis protein LysW. This very s | 95.0 | |
| TIGR00100 | 115 | hypA hydrogenase nickel insertion protein HypA. In | 94.95 | |
| PF10083 | 158 | DUF2321: Uncharacterized protein conserved in bact | 94.89 | |
| PF09297 | 32 | zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do | 94.83 | |
| COG4260 | 345 | Membrane protease subunit, stomatin/prohibitin fam | 94.69 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 94.65 | |
| PF14353 | 128 | CpXC: CpXC protein | 94.62 | |
| PF09723 | 42 | Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 | 94.62 | |
| TIGR01206 | 54 | lysW lysine biosynthesis protein LysW. This very s | 94.57 | |
| PRK03564 | 309 | formate dehydrogenase accessory protein FdhE; Prov | 94.56 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 94.53 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 94.43 | |
| cd00729 | 34 | rubredoxin_SM Rubredoxin, Small Modular nonheme ir | 94.42 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 94.4 | |
| PRK03824 | 135 | hypA hydrogenase nickel incorporation protein; Pro | 94.36 | |
| COG1645 | 131 | Uncharacterized Zn-finger containing protein [Gene | 94.36 | |
| PF09723 | 42 | Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 | 94.26 | |
| PF04216 | 290 | FdhE: Protein involved in formate dehydrogenase fo | 94.16 | |
| TIGR02300 | 129 | FYDLN_acid conserved hypothetical protein TIGR0230 | 94.16 | |
| smart00714 | 67 | LITAF Possible membrane-associated motif in LPS-in | 94.09 | |
| PF12172 | 37 | DUF35_N: Rubredoxin-like zinc ribbon domain (DUF35 | 94.07 | |
| PF14803 | 34 | Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. | 94.04 | |
| COG2051 | 67 | RPS27A Ribosomal protein S27E [Translation, riboso | 94.02 | |
| COG1594 | 113 | RPB9 DNA-directed RNA polymerase, subunit M/Transc | 93.92 | |
| PRK00415 | 59 | rps27e 30S ribosomal protein S27e; Reviewed | 93.7 | |
| PF08274 | 30 | PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 | 93.58 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 93.58 | |
| PRK00564 | 117 | hypA hydrogenase nickel incorporation protein; Pro | 93.52 | |
| COG1645 | 131 | Uncharacterized Zn-finger containing protein [Gene | 93.46 | |
| COG1996 | 49 | RPC10 DNA-directed RNA polymerase, subunit RPC10 ( | 93.39 | |
| COG1545 | 140 | Predicted nucleic-acid-binding protein containing | 93.37 | |
| PRK00420 | 112 | hypothetical protein; Validated | 93.29 | |
| PF09855 | 64 | DUF2082: Nucleic-acid-binding protein containing Z | 93.29 | |
| PF01155 | 113 | HypA: Hydrogenase expression/synthesis hypA family | 93.12 | |
| PF02150 | 35 | RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I | 92.99 | |
| PF11781 | 36 | RRN7: RNA polymerase I-specific transcription init | 92.93 | |
| TIGR02605 | 52 | CxxC_CxxC_SSSS putative regulatory protein, FmdB f | 92.88 | |
| PRK00415 | 59 | rps27e 30S ribosomal protein S27e; Reviewed | 92.88 | |
| PF05191 | 36 | ADK_lid: Adenylate kinase, active site lid; InterP | 92.78 | |
| PF11023 | 114 | DUF2614: Protein of unknown function (DUF2614); In | 92.71 | |
| TIGR00100 | 115 | hypA hydrogenase nickel insertion protein HypA. In | 92.65 | |
| PRK04136 | 48 | rpl40e 50S ribosomal protein L40e; Provisional | 92.61 | |
| PHA00626 | 59 | hypothetical protein | 92.55 | |
| PRK12380 | 113 | hydrogenase nickel incorporation protein HybF; Pro | 92.52 | |
| PF06677 | 41 | Auto_anti-p27: Sjogren's syndrome/scleroderma auto | 92.49 | |
| PF08792 | 33 | A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I | 92.32 | |
| PF04216 | 290 | FdhE: Protein involved in formate dehydrogenase fo | 92.31 | |
| PF06906 | 57 | DUF1272: Protein of unknown function (DUF1272); In | 92.24 | |
| PF15616 | 131 | TerY-C: TerY-C metal binding domain | 92.13 | |
| smart00531 | 147 | TFIIE Transcription initiation factor IIE. | 92.05 | |
| PF14319 | 111 | Zn_Tnp_IS91: Transposase zinc-binding domain | 91.96 | |
| smart00531 | 147 | TFIIE Transcription initiation factor IIE. | 91.92 | |
| PRK00432 | 50 | 30S ribosomal protein S27ae; Validated | 91.81 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 91.7 | |
| PRK08351 | 61 | DNA-directed RNA polymerase subunit E''; Validated | 91.52 | |
| PF05876 | 557 | Terminase_GpA: Phage terminase large subunit (GpA) | 91.51 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 91.39 | |
| PRK14892 | 99 | putative transcription elongation factor Elf1; Pro | 91.32 | |
| PRK03824 | 135 | hypA hydrogenase nickel incorporation protein; Pro | 91.28 | |
| TIGR01384 | 104 | TFS_arch transcription factor S, archaeal. There h | 91.19 | |
| PRK06393 | 64 | rpoE DNA-directed RNA polymerase subunit E''; Vali | 91.17 | |
| PHA02942 | 383 | putative transposase; Provisional | 91.15 | |
| PF13453 | 41 | zf-TFIIB: Transcription factor zinc-finger | 91.15 | |
| PRK12286 | 57 | rpmF 50S ribosomal protein L32; Reviewed | 91.12 | |
| PF12760 | 46 | Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int | 91.11 | |
| TIGR01562 | 305 | FdhE formate dehydrogenase accessory protein FdhE. | 90.85 | |
| PF08772 | 73 | NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon lik | 90.83 | |
| PF01155 | 113 | HypA: Hydrogenase expression/synthesis hypA family | 90.54 | |
| PRK02935 | 110 | hypothetical protein; Provisional | 90.4 | |
| TIGR02300 | 129 | FYDLN_acid conserved hypothetical protein TIGR0230 | 90.35 | |
| TIGR00515 | 285 | accD acetyl-CoA carboxylase, carboxyl transferase, | 90.35 | |
| PF10058 | 54 | DUF2296: Predicted integral membrane metal-binding | 90.32 | |
| CHL00174 | 296 | accD acetyl-CoA carboxylase beta subunit; Reviewed | 90.3 | |
| COG2093 | 64 | DNA-directed RNA polymerase, subunit E'' [Transcri | 90.3 | |
| PF01485 | 64 | IBR: IBR domain; InterPro: IPR002867 Zinc finger ( | 90.3 | |
| PRK00564 | 117 | hypA hydrogenase nickel incorporation protein; Pro | 90.17 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 90.14 | |
| PRK03681 | 114 | hypA hydrogenase nickel incorporation protein; Val | 90.12 | |
| PRK12495 | 226 | hypothetical protein; Provisional | 90.11 | |
| TIGR03831 | 46 | YgiT_finger YgiT-type zinc finger domain. This dom | 89.89 | |
| PF14354 | 61 | Lar_restr_allev: Restriction alleviation protein L | 89.67 | |
| PF01667 | 55 | Ribosomal_S27e: Ribosomal protein S27; InterPro: I | 89.58 | |
| PF01783 | 56 | Ribosomal_L32p: Ribosomal L32p protein family; Int | 89.55 | |
| PRK05978 | 148 | hypothetical protein; Provisional | 89.47 | |
| PF03833 | 900 | PolC_DP2: DNA polymerase II large subunit DP2; Int | 89.39 | |
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 89.33 | |
| KOG2906 | 105 | consensus RNA polymerase III subunit C11 [Transcri | 89.12 | |
| PF14369 | 35 | zf-RING_3: zinc-finger | 88.89 | |
| PRK12496 | 164 | hypothetical protein; Provisional | 88.86 | |
| COG0375 | 115 | HybF Zn finger protein HypA/HybF (possibly regulat | 88.63 | |
| TIGR01031 | 55 | rpmF_bact ribosomal protein L32. This protein desc | 88.55 | |
| COG4306 | 160 | Uncharacterized protein conserved in bacteria [Fun | 88.54 | |
| PRK00762 | 124 | hypA hydrogenase nickel incorporation protein; Pro | 88.54 | |
| PRK05654 | 292 | acetyl-CoA carboxylase subunit beta; Validated | 88.51 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 88.48 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 88.43 | |
| COG4888 | 104 | Uncharacterized Zn ribbon-containing protein [Gene | 88.33 | |
| PF14205 | 55 | Cys_rich_KTR: Cysteine-rich KTR | 88.17 | |
| COG1594 | 113 | RPB9 DNA-directed RNA polymerase, subunit M/Transc | 88.11 | |
| PF05129 | 81 | Elf1: Transcription elongation factor Elf1 like; I | 87.99 | |
| smart00647 | 64 | IBR In Between Ring fingers. the domains occurs be | 87.78 | |
| TIGR03826 | 137 | YvyF flagellar operon protein TIGR03826. This gene | 87.78 | |
| PRK14973 | 936 | DNA topoisomerase I; Provisional | 87.74 | |
| PRK00464 | 154 | nrdR transcriptional regulator NrdR; Validated | 87.67 | |
| smart00547 | 26 | ZnF_RBZ Zinc finger domain. Zinc finger domain in | 87.6 | |
| PRK08579 | 625 | anaerobic ribonucleoside triphosphate reductase; P | 87.34 | |
| COG2260 | 59 | Predicted Zn-ribbon RNA-binding protein [Translati | 87.34 | |
| PLN00209 | 86 | ribosomal protein S27; Provisional | 87.32 | |
| PF04981 | 236 | NMD3: NMD3 family ; InterPro: IPR007064 The NMD3 p | 87.27 | |
| COG1592 | 166 | Rubrerythrin [Energy production and conversion] | 87.13 | |
| PRK15103 | 419 | paraquat-inducible membrane protein A; Provisional | 87.09 | |
| TIGR00373 | 158 | conserved hypothetical protein TIGR00373. This fam | 87.05 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 87.03 | |
| PF00641 | 30 | zf-RanBP: Zn-finger in Ran binding protein and oth | 86.98 | |
| COG0675 | 364 | Transposase and inactivated derivatives [DNA repli | 86.79 | |
| TIGR01562 | 305 | FdhE formate dehydrogenase accessory protein FdhE. | 86.55 | |
| COG1552 | 50 | RPL40A Ribosomal protein L40E [Translation, riboso | 86.51 | |
| PRK03564 | 309 | formate dehydrogenase accessory protein FdhE; Prov | 86.34 | |
| PF07295 | 146 | DUF1451: Protein of unknown function (DUF1451); In | 86.29 | |
| PF02591 | 56 | DUF164: Putative zinc ribbon domain; InterPro: IPR | 86.26 | |
| PF13901 | 202 | DUF4206: Domain of unknown function (DUF4206) | 86.21 | |
| PRK00464 | 154 | nrdR transcriptional regulator NrdR; Validated | 86.17 | |
| PTZ00083 | 85 | 40S ribosomal protein S27; Provisional | 86.15 | |
| PF06827 | 30 | zf-FPG_IleRS: Zinc finger found in FPG and IleRS; | 86.03 | |
| PRK05978 | 148 | hypothetical protein; Provisional | 86.0 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 85.95 | |
| PRK07418 | 616 | acetolactate synthase 3 catalytic subunit; Reviewe | 85.9 | |
| PF09567 | 314 | RE_MamI: MamI restriction endonuclease; InterPro: | 85.79 | |
| PF01396 | 39 | zf-C4_Topoisom: Topoisomerase DNA binding C4 zinc | 85.73 | |
| smart00440 | 40 | ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo | 85.69 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 85.66 | |
| PRK08270 | 656 | anaerobic ribonucleoside triphosphate reductase; P | 85.58 | |
| PRK08271 | 623 | anaerobic ribonucleoside triphosphate reductase; P | 85.35 | |
| PRK07219 | 822 | DNA topoisomerase I; Validated | 85.28 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.16 | |
| PF06044 | 254 | DRP: Dam-replacing family; InterPro: IPR010324 Dam | 85.15 | |
| PRK06260 | 397 | threonine synthase; Validated | 85.13 | |
| PRK11595 | 227 | DNA utilization protein GntX; Provisional | 85.06 | |
| PF13597 | 546 | NRDD: Anaerobic ribonucleoside-triphosphate reduct | 85.04 | |
| COG0068 | 750 | HypF Hydrogenase maturation factor [Posttranslatio | 84.95 | |
| COG4640 | 465 | Predicted membrane protein [Function unknown] | 84.8 | |
| COG0777 | 294 | AccD Acetyl-CoA carboxylase beta subunit [Lipid me | 84.35 | |
| PRK11032 | 160 | hypothetical protein; Provisional | 84.34 | |
| PRK10445 | 263 | endonuclease VIII; Provisional | 84.28 | |
| PRK14810 | 272 | formamidopyrimidine-DNA glycosylase; Provisional | 84.08 | |
| PRK03922 | 113 | hypothetical protein; Provisional | 84.06 | |
| PRK01103 | 274 | formamidopyrimidine/5-formyluracil/ 5-hydroxymethy | 83.77 | |
| PF14353 | 128 | CpXC: CpXC protein | 83.75 | |
| PF06221 | 57 | zf-C2HC5: Putative zinc finger motif, C2HC5-type; | 83.7 | |
| COG1592 | 166 | Rubrerythrin [Energy production and conversion] | 83.66 | |
| TIGR00577 | 272 | fpg formamidopyrimidine-DNA glycosylase (fpg). All | 83.46 | |
| cd01675 | 555 | RNR_III Class III ribonucleotide reductase. Ribonu | 83.2 | |
| COG1545 | 140 | Predicted nucleic-acid-binding protein containing | 83.18 | |
| PRK03988 | 138 | translation initiation factor IF-2 subunit beta; V | 83.06 | |
| PF03119 | 28 | DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f | 83.04 | |
| COG1998 | 51 | RPS31 Ribosomal protein S27AE [Translation, riboso | 83.0 | |
| TIGR00311 | 133 | aIF-2beta translation initiation factor aIF-2, bet | 82.86 | |
| PF04475 | 102 | DUF555: Protein of unknown function (DUF555); Inte | 82.84 | |
| COG1997 | 89 | RPL43A Ribosomal protein L37AE/L43A [Translation, | 82.66 | |
| COG4391 | 62 | Uncharacterized protein conserved in bacteria [Fun | 82.6 | |
| smart00653 | 110 | eIF2B_5 domain present in translation initiation f | 82.44 | |
| COG1885 | 115 | Uncharacterized protein conserved in archaea [Func | 82.36 | |
| TIGR00155 | 403 | pqiA_fam integral membrane protein, PqiA family. T | 82.31 | |
| TIGR03655 | 53 | anti_R_Lar restriction alleviation protein, Lar fa | 82.21 | |
| PRK14811 | 269 | formamidopyrimidine-DNA glycosylase; Provisional | 82.02 | |
| TIGR00354 | 1095 | polC DNA polymerase, archaeal type II, large subun | 81.97 | |
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 81.97 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 81.95 | |
| TIGR00155 | 403 | pqiA_fam integral membrane protein, PqiA family. T | 81.89 | |
| PF14569 | 80 | zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. | 81.73 | |
| PF01363 | 69 | FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f | 81.61 | |
| PRK09678 | 72 | DNA-binding transcriptional regulator; Provisional | 81.6 | |
| PRK00481 | 242 | NAD-dependent deacetylase; Provisional | 81.59 | |
| PRK07591 | 421 | threonine synthase; Validated | 81.52 | |
| TIGR02487 | 579 | NrdD anaerobic ribonucleoside-triphosphate reducta | 81.32 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 81.09 | |
| PF07295 | 146 | DUF1451: Protein of unknown function (DUF1451); In | 81.06 | |
| PRK09710 | 64 | lar restriction alleviation and modification prote | 81.05 | |
| TIGR00310 | 192 | ZPR1_znf ZPR1 zinc finger domain. | 80.75 | |
| COG2995 | 418 | PqiA Uncharacterized paraquat-inducible protein A | 80.72 | |
| COG0333 | 57 | RpmF Ribosomal protein L32 [Translation, ribosomal | 80.56 | |
| PF09334 | 391 | tRNA-synt_1g: tRNA synthetases class I (M); InterP | 80.55 | |
| PF04502 | 324 | DUF572: Family of unknown function (DUF572) ; Inte | 80.47 | |
| PF13005 | 47 | zf-IS66: zinc-finger binding domain of transposase | 80.32 | |
| PF04606 | 47 | Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: I | 80.19 | |
| PRK11827 | 60 | hypothetical protein; Provisional | 80.06 |
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
Probab=99.23 E-value=7.3e-12 Score=71.41 Aligned_cols=42 Identities=31% Similarity=0.755 Sum_probs=34.8
Q ss_pred CCCceeCCCCCCCCCCCCCCCCCCCCCccCccccccCCceecCCCccCcCCC
Q 033949 53 KEPALFCNNCNLLFPSSLPPPPPPPPLVSDVSKCRFCDRLVEPDFSFCPYCG 104 (107)
Q Consensus 53 ~~~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~C~~CG~~i~~~~~fCP~CG 104 (107)
.....+|++||..+..... ....|++||++++.+++||++||
T Consensus 9 ~~~~~fC~~CG~~l~~~~~----------~~~~C~~Cg~~~~~~~~fC~~CG 50 (50)
T PF12773_consen 9 PDDAKFCPHCGTPLPPPDQ----------SKKICPNCGAENPPNAKFCPNCG 50 (50)
T ss_pred CccccCChhhcCChhhccC----------CCCCCcCCcCCCcCCcCccCccc
Confidence 3579999999999872111 25789999999999999999998
|
|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK14559 putative protein serine/threonine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14714 DNA polymerase II large subunit; Provisional | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >PRK04023 DNA polymerase II large subunit; Validated | Back alignment and domain information |
|---|
| >PF03833 PolC_DP2: DNA polymerase II large subunit DP2; InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus | Back alignment and domain information |
|---|
| >PRK14559 putative protein serine/threonine phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >smart00659 RPOLCX RNA polymerase subunit CX | Back alignment and domain information |
|---|
| >PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PRK14714 DNA polymerase II large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >PRK04023 DNA polymerase II large subunit; Validated | Back alignment and domain information |
|---|
| >PF09889 DUF2116: Uncharacterized protein containing a Zn-ribbon (DUF2116); InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13719 zinc_ribbon_5: zinc-ribbon domain | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00420 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription] | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >PRK12496 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00834 CxxC_CXXC_SSSS Putative regulatory protein | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF15616 TerY-C: TerY-C metal binding domain | Back alignment and domain information |
|---|
| >smart00834 CxxC_CXXC_SSSS Putative regulatory protein | Back alignment and domain information |
|---|
| >PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins | Back alignment and domain information |
|---|
| >TIGR01384 TFS_arch transcription factor S, archaeal | Back alignment and domain information |
|---|
| >PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed | Back alignment and domain information |
|---|
| >PF13719 zinc_ribbon_5: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins | Back alignment and domain information |
|---|
| >smart00659 RPOLCX RNA polymerase subunit CX | Back alignment and domain information |
|---|
| >PRK14892 putative transcription elongation factor Elf1; Provisional | Back alignment and domain information |
|---|
| >COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only] | Back alignment and domain information |
|---|
| >PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PRK03681 hypA hydrogenase nickel incorporation protein; Validated | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >PRK12380 hydrogenase nickel incorporation protein HybF; Provisional | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase | Back alignment and domain information |
|---|
| >PRK02935 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates | Back alignment and domain information |
|---|
| >PF10601 zf-LITAF-like: LITAF-like zinc ribbon domain; InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues | Back alignment and domain information |
|---|
| >TIGR01206 lysW lysine biosynthesis protein LysW | Back alignment and domain information |
|---|
| >TIGR00100 hypA hydrogenase nickel insertion protein HypA | Back alignment and domain information |
|---|
| >PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 | Back alignment and domain information |
|---|
| >PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains | Back alignment and domain information |
|---|
| >COG4260 Membrane protease subunit, stomatin/prohibitin family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >PF14353 CpXC: CpXC protein | Back alignment and domain information |
|---|
| >PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria | Back alignment and domain information |
|---|
| >TIGR01206 lysW lysine biosynthesis protein LysW | Back alignment and domain information |
|---|
| >PRK03564 formate dehydrogenase accessory protein FdhE; Provisional | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >PRK03824 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria | Back alignment and domain information |
|---|
| >PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] | Back alignment and domain information |
|---|
| >TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 | Back alignment and domain information |
|---|
| >smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins | Back alignment and domain information |
|---|
| >PF12172 DUF35_N: Rubredoxin-like zinc ribbon domain (DUF35_N); InterPro: IPR022002 This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins | Back alignment and domain information |
|---|
| >PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C | Back alignment and domain information |
|---|
| >COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] | Back alignment and domain information |
|---|
| >PRK00415 rps27e 30S ribosomal protein S27e; Reviewed | Back alignment and domain information |
|---|
| >PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >PRK00564 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] | Back alignment and domain information |
|---|
| >COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00420 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins | Back alignment and domain information |
|---|
| >PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation | Back alignment and domain information |
|---|
| >PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 | Back alignment and domain information |
|---|
| >PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] | Back alignment and domain information |
|---|
| >TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family | Back alignment and domain information |
|---|
| >PRK00415 rps27e 30S ribosomal protein S27e; Reviewed | Back alignment and domain information |
|---|
| >PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 | Back alignment and domain information |
|---|
| >PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins | Back alignment and domain information |
|---|
| >TIGR00100 hypA hydrogenase nickel insertion protein HypA | Back alignment and domain information |
|---|
| >PRK04136 rpl40e 50S ribosomal protein L40e; Provisional | Back alignment and domain information |
|---|
| >PHA00626 hypothetical protein | Back alignment and domain information |
|---|
| >PRK12380 hydrogenase nickel incorporation protein HybF; Provisional | Back alignment and domain information |
|---|
| >PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) | Back alignment and domain information |
|---|
| >PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] | Back alignment and domain information |
|---|
| >PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] | Back alignment and domain information |
|---|
| >PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length | Back alignment and domain information |
|---|
| >PF15616 TerY-C: TerY-C metal binding domain | Back alignment and domain information |
|---|
| >smart00531 TFIIE Transcription initiation factor IIE | Back alignment and domain information |
|---|
| >PF14319 Zn_Tnp_IS91: Transposase zinc-binding domain | Back alignment and domain information |
|---|
| >smart00531 TFIIE Transcription initiation factor IIE | Back alignment and domain information |
|---|
| >PRK00432 30S ribosomal protein S27ae; Validated | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PRK08351 DNA-directed RNA polymerase subunit E''; Validated | Back alignment and domain information |
|---|
| >PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PRK14892 putative transcription elongation factor Elf1; Provisional | Back alignment and domain information |
|---|
| >PRK03824 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01384 TFS_arch transcription factor S, archaeal | Back alignment and domain information |
|---|
| >PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated | Back alignment and domain information |
|---|
| >PHA02942 putative transposase; Provisional | Back alignment and domain information |
|---|
| >PF13453 zf-TFIIB: Transcription factor zinc-finger | Back alignment and domain information |
|---|
| >PRK12286 rpmF 50S ribosomal protein L32; Reviewed | Back alignment and domain information |
|---|
| >PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc | Back alignment and domain information |
|---|
| >TIGR01562 FdhE formate dehydrogenase accessory protein FdhE | Back alignment and domain information |
|---|
| >PF08772 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon like; InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1 | Back alignment and domain information |
|---|
| >PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation | Back alignment and domain information |
|---|
| >PRK02935 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 | Back alignment and domain information |
|---|
| >TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit | Back alignment and domain information |
|---|
| >PF10058 DUF2296: Predicted integral membrane metal-binding protein (DUF2296); InterPro: IPR019273 This domain, found mainly in the eukaryotic lunapark proteins, has no known function [] | Back alignment and domain information |
|---|
| >CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed | Back alignment and domain information |
|---|
| >COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription] | Back alignment and domain information |
|---|
| >PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK00564 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK03681 hypA hydrogenase nickel incorporation protein; Validated | Back alignment and domain information |
|---|
| >PRK12495 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03831 YgiT_finger YgiT-type zinc finger domain | Back alignment and domain information |
|---|
| >PF14354 Lar_restr_allev: Restriction alleviation protein Lar | Back alignment and domain information |
|---|
| >PF01667 Ribosomal_S27e: Ribosomal protein S27; InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF01783 Ribosomal_L32p: Ribosomal L32p protein family; InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK05978 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03833 PolC_DP2: DNA polymerase II large subunit DP2; InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >KOG2906 consensus RNA polymerase III subunit C11 [Transcription] | Back alignment and domain information |
|---|
| >PF14369 zf-RING_3: zinc-finger | Back alignment and domain information |
|---|
| >PRK12496 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01031 rpmF_bact ribosomal protein L32 | Back alignment and domain information |
|---|
| >COG4306 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK00762 hypA hydrogenase nickel incorporation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05654 acetyl-CoA carboxylase subunit beta; Validated | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14205 Cys_rich_KTR: Cysteine-rich KTR | Back alignment and domain information |
|---|
| >COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] | Back alignment and domain information |
|---|
| >PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines | Back alignment and domain information |
|---|
| >smart00647 IBR In Between Ring fingers | Back alignment and domain information |
|---|
| >TIGR03826 YvyF flagellar operon protein TIGR03826 | Back alignment and domain information |
|---|
| >PRK14973 DNA topoisomerase I; Provisional | Back alignment and domain information |
|---|
| >PRK00464 nrdR transcriptional regulator NrdR; Validated | Back alignment and domain information |
|---|
| >smart00547 ZnF_RBZ Zinc finger domain | Back alignment and domain information |
|---|
| >PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN00209 ribosomal protein S27; Provisional | Back alignment and domain information |
|---|
| >PF04981 NMD3: NMD3 family ; InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay | Back alignment and domain information |
|---|
| >COG1592 Rubrerythrin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK15103 paraquat-inducible membrane protein A; Provisional | Back alignment and domain information |
|---|
| >TIGR00373 conserved hypothetical protein TIGR00373 | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00641 zf-RanBP: Zn-finger in Ran binding protein and others; InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01562 FdhE formate dehydrogenase accessory protein FdhE | Back alignment and domain information |
|---|
| >COG1552 RPL40A Ribosomal protein L40E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK03564 formate dehydrogenase accessory protein FdhE; Provisional | Back alignment and domain information |
|---|
| >PF07295 DUF1451: Protein of unknown function (DUF1451); InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length | Back alignment and domain information |
|---|
| >PF02591 DUF164: Putative zinc ribbon domain; InterPro: IPR003743 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PF13901 DUF4206: Domain of unknown function (DUF4206) | Back alignment and domain information |
|---|
| >PRK00464 nrdR transcriptional regulator NrdR; Validated | Back alignment and domain information |
|---|
| >PTZ00083 40S ribosomal protein S27; Provisional | Back alignment and domain information |
|---|
| >PF06827 zf-FPG_IleRS: Zinc finger found in FPG and IleRS; InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK05978 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed | Back alignment and domain information |
|---|
| >PF09567 RE_MamI: MamI restriction endonuclease; InterPro: IPR019067 There are four classes of restriction endonucleases: types I, II,III and IV | Back alignment and domain information |
|---|
| >PF01396 zf-C4_Topoisom: Topoisomerase DNA binding C4 zinc finger; InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i | Back alignment and domain information |
|---|
| >smart00440 ZnF_C2C2 C2C2 Zinc finger | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07219 DNA topoisomerase I; Validated | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06044 DRP: Dam-replacing family; InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements | Back alignment and domain information |
|---|
| >PRK06260 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK11595 DNA utilization protein GntX; Provisional | Back alignment and domain information |
|---|
| >PF13597 NRDD: Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A | Back alignment and domain information |
|---|
| >COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG4640 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK11032 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10445 endonuclease VIII; Provisional | Back alignment and domain information |
|---|
| >PRK14810 formamidopyrimidine-DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >PRK03922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated | Back alignment and domain information |
|---|
| >PF14353 CpXC: CpXC protein | Back alignment and domain information |
|---|
| >PF06221 zf-C2HC5: Putative zinc finger motif, C2HC5-type; InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG1592 Rubrerythrin [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg) | Back alignment and domain information |
|---|
| >cd01675 RNR_III Class III ribonucleotide reductase | Back alignment and domain information |
|---|
| >COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03988 translation initiation factor IF-2 subunit beta; Validated | Back alignment and domain information |
|---|
| >PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative | Back alignment and domain information |
|---|
| >PF04475 DUF555: Protein of unknown function (DUF555); InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins | Back alignment and domain information |
|---|
| >COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4391 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5 | Back alignment and domain information |
|---|
| >COG1885 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00155 pqiA_fam integral membrane protein, PqiA family | Back alignment and domain information |
|---|
| >TIGR03655 anti_R_Lar restriction alleviation protein, Lar family | Back alignment and domain information |
|---|
| >PRK14811 formamidopyrimidine-DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00354 polC DNA polymerase, archaeal type II, large subunit | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >TIGR00155 pqiA_fam integral membrane protein, PqiA family | Back alignment and domain information |
|---|
| >PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A | Back alignment and domain information |
|---|
| >PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK09678 DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK00481 NAD-dependent deacetylase; Provisional | Back alignment and domain information |
|---|
| >PRK07591 threonine synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF07295 DUF1451: Protein of unknown function (DUF1451); InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length | Back alignment and domain information |
|---|
| >PRK09710 lar restriction alleviation and modification protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00310 ZPR1_znf ZPR1 zinc finger domain | Back alignment and domain information |
|---|
| >COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown] | Back alignment and domain information |
|---|
| >COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF04502 DUF572: Family of unknown function (DUF572) ; InterPro: IPR007590 This entry represents eukaryotic proteins with undetermined function belonging to the CWC16 family | Back alignment and domain information |
|---|
| >PF13005 zf-IS66: zinc-finger binding domain of transposase IS66 ; InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [] | Back alignment and domain information |
|---|
| >PF04606 Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr | Back alignment and domain information |
|---|
| >PRK11827 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 98.11 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 97.82 | |
| 1twf_L | 70 | ABC10-alpha, DNA-directed RNA polymerases I, II, a | 97.13 | |
| 3j21_g | 51 | 50S ribosomal protein L40E; archaea, archaeal, KIN | 96.51 | |
| 3h0g_L | 63 | DNA-directed RNA polymerases I, II, and III subuni | 96.49 | |
| 2lcq_A | 165 | Putative toxin VAPC6; PIN domain, Zn ribbon domain | 96.35 | |
| 3h0g_I | 113 | DNA-directed RNA polymerases I, II, and III subuni | 96.15 | |
| 2jne_A | 101 | Hypothetical protein YFGJ; zinc fingers, two zinc, | 96.07 | |
| 2jne_A | 101 | Hypothetical protein YFGJ; zinc fingers, two zinc, | 96.04 | |
| 2apo_B | 60 | Ribosome biogenesis protein NOP10; protein-protein | 95.62 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 95.45 | |
| 2aus_D | 60 | NOP10, ribosome biogenesis protein NOP10; isomeras | 95.33 | |
| 3qt1_I | 133 | DNA-directed RNA polymerases I, II, and III subun; | 94.85 | |
| 1twf_L | 70 | ABC10-alpha, DNA-directed RNA polymerases I, II, a | 94.54 | |
| 2lcq_A | 165 | Putative toxin VAPC6; PIN domain, Zn ribbon domain | 94.28 | |
| 2kdx_A | 119 | HYPA, hydrogenase/urease nickel incorporation prot | 94.0 | |
| 2fiy_A | 309 | Protein FDHE homolog; FDHE protein, structural gen | 93.87 | |
| 3j20_Y | 50 | 30S ribosomal protein S27AE; archaea, archaeal, KI | 93.82 | |
| 4ayb_P | 48 | DNA-directed RNA polymerase; transferase, multi-su | 93.78 | |
| 4ayb_P | 48 | DNA-directed RNA polymerase; transferase, multi-su | 93.6 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 93.53 | |
| 3h0g_L | 63 | DNA-directed RNA polymerases I, II, and III subuni | 93.39 | |
| 1vq8_Z | 83 | 50S ribosomal protein L37AE; ribosome 50S, protein | 93.24 | |
| 2kdx_A | 119 | HYPA, hydrogenase/urease nickel incorporation prot | 92.64 | |
| 1vq8_Z | 83 | 50S ribosomal protein L37AE; ribosome 50S, protein | 92.59 | |
| 3a43_A | 139 | HYPD, hydrogenase nickel incorporation protein HYP | 92.42 | |
| 2k4x_A | 55 | 30S ribosomal protein S27AE; metal-binding, ribonu | 92.33 | |
| 3a43_A | 139 | HYPD, hydrogenase nickel incorporation protein HYP | 92.3 | |
| 2ayj_A | 56 | 50S ribosomal protein L40E; Zn-binding, beta-stran | 92.29 | |
| 2ct7_A | 86 | Ring finger protein 31; IBR, structural genomics, | 92.25 | |
| 1qxf_A | 66 | GR2, 30S ribosomal protein S27E; structural genomi | 91.91 | |
| 3qt1_I | 133 | DNA-directed RNA polymerases I, II, and III subun; | 91.8 | |
| 2apo_B | 60 | Ribosome biogenesis protein NOP10; protein-protein | 91.53 | |
| 2con_A | 79 | RUH-035 protein, NIN one binding protein; ribosome | 91.14 | |
| 3h0g_I | 113 | DNA-directed RNA polymerases I, II, and III subuni | 90.78 | |
| 2zjr_Z | 60 | 50S ribosomal protein L32; ribosome, large ribosom | 90.68 | |
| 3j20_W | 63 | 30S ribosomal protein S27E; archaea, archaeal, KIN | 90.5 | |
| 3irb_A | 145 | Uncharacterized protein from DUF35 family; 1381535 | 90.33 | |
| 1dl6_A | 58 | Transcription factor II B (TFIIB); zinc ribbon, ge | 90.21 | |
| 3v2d_5 | 60 | 50S ribosomal protein L32; ribosome associated inh | 90.01 | |
| 2xzm_6 | 81 | RPS27E; ribosome, translation; 3.93A {Tetrahymena | 88.54 | |
| 6rxn_A | 46 | Rubredoxin; electron transfer(iron-sulfur protein) | 88.42 | |
| 1gh9_A | 71 | 8.3 kDa protein (gene MTH1184); beta+alpha complex | 88.42 | |
| 3pwf_A | 170 | Rubrerythrin; non heme iron peroxidases, oxidative | 88.4 | |
| 1wd2_A | 60 | Ariadne-1 protein homolog; ring, IBR, triad, zinc | 87.96 | |
| 2k2d_A | 79 | Ring finger and CHY zinc finger domain- containing | 87.85 | |
| 3u5c_b | 82 | RP61, YS20, 40S ribosomal protein S27-A; translati | 87.7 | |
| 1wii_A | 85 | Hypothetical UPF0222 protein MGC4549; domain of un | 87.42 | |
| 4esj_A | 257 | Type-2 restriction enzyme DPNI; restriction endonu | 87.34 | |
| 2gnr_A | 145 | Conserved hypothetical protein; 13815350, structur | 87.28 | |
| 3iz6_X | 86 | 40S ribosomal protein S27 (S27E); eukaryotic ribos | 87.14 | |
| 3pwf_A | 170 | Rubrerythrin; non heme iron peroxidases, oxidative | 86.63 | |
| 1twf_I | 122 | B12.6, DNA-directed RNA polymerase II 14.2 kDa pol | 86.26 | |
| 2pk7_A | 69 | Uncharacterized protein; NESG, PLR1, putative tetr | 86.2 | |
| 2fiy_A | 309 | Protein FDHE homolog; FDHE protein, structural gen | 85.97 | |
| 2gmg_A | 105 | Hypothetical protein PF0610; winged-helix like pro | 85.6 | |
| 2js4_A | 70 | UPF0434 protein BB2007; NESG, northeast structural | 85.19 | |
| 2hf1_A | 68 | Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A | 85.16 | |
| 1k81_A | 36 | EIF-2-beta, probable translation initiation factor | 84.96 | |
| 2jr6_A | 68 | UPF0434 protein NMA0874; solution, structural geno | 84.95 | |
| 2gmg_A | 105 | Hypothetical protein PF0610; winged-helix like pro | 84.41 | |
| 2kn9_A | 81 | Rubredoxin; metalloprotein, ssgcid, structural gen | 84.37 | |
| 1e8j_A | 52 | Rubredoxin; iron-sulfur-protein, zinc-substitution | 84.21 | |
| 4rxn_A | 54 | Rubredoxin; electron transfer(iron-sulfur protein) | 84.1 | |
| 2l7x_A | 77 | Envelope glycoprotein; cytoplasmic tail, viral pro | 83.92 | |
| 1dx8_A | 70 | Rubredoxin; electron transport, zinc-substitution; | 83.87 | |
| 1yuz_A | 202 | Nigerythrin; rubrythrin, rubredoxin, hemerythrin, | 83.63 | |
| 1x4u_A | 84 | Zinc finger, FYVE domain containing 27 isoform B; | 83.59 | |
| 1ryq_A | 69 | DNA-directed RNA polymerase, subunit E''; structur | 83.52 | |
| 1lko_A | 191 | Rubrerythrin all-iron(II) form; reduced form, DIIR | 83.45 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 83.38 | |
| 4esj_A | 257 | Type-2 restriction enzyme DPNI; restriction endonu | 83.04 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 82.79 | |
| 2v3b_B | 55 | Rubredoxin 2, rubredoxin; alkane degradation, iron | 82.64 | |
| 1nj3_A | 31 | NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, | 82.62 | |
| 1y02_A | 120 | CARP2, FYVE-ring finger protein sakura; zinc-bindi | 82.42 | |
| 2lk0_A | 32 | RNA-binding protein 5; zinc finger; NMR {Homo sapi | 82.03 | |
| 2jny_A | 67 | Uncharacterized BCR; structure, CGR1, NESG, struct | 81.67 | |
| 2akl_A | 138 | PHNA-like protein PA0128; two domains, Zn binding | 80.33 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 80.23 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 80.2 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 80.19 |
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
Probab=98.11 E-value=8.2e-07 Score=54.71 Aligned_cols=37 Identities=19% Similarity=0.381 Sum_probs=24.3
Q ss_pred CceeCCCCCCCCCCCCCCCCCCCCCccCccccccCCceecC------CCccCcCCCC
Q 033949 55 PALFCNNCNLLFPSSLPPPPPPPPLVSDVSKCRFCDRLVEP------DFSFCPYCGS 105 (107)
Q Consensus 55 ~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~C~~CG~~i~~------~~~fCP~CG~ 105 (107)
....|..|+..+.. ...||.||.+++. ...||+.||.
T Consensus 17 ~~~~C~~C~~~~~~--------------~afCPeCgq~Le~lkACGA~~yFC~~C~~ 59 (81)
T 2jrp_A 17 DTAHCETCAKDFSL--------------QALCPDCRQPLQVLKACGAVDYFCQNGHG 59 (81)
T ss_dssp SEEECTTTCCEEEE--------------EEECSSSCSCCCEEEETTEEEECCTTTTC
T ss_pred CceECccccccCCC--------------cccCcchhhHHHHHHhcCCcCeeeccCCC
Confidence 46678888887644 2367777766644 3667777774
|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... | Back alignment and structure |
|---|
| >3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 | Back alignment and structure |
|---|
| >2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 | Back alignment and structure |
|---|
| >2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2aus_D NOP10, ribosome biogenesis protein NOP10; isomerase, structural protein, isomerase-structural protein; 2.10A {Pyrococcus abyssi} PDB: 3lwr_B 3lwo_B* 3lwq_B* 3lwp_B 3lwv_B 3hax_C* 2hvy_C* 3hay_C* 2ey4_E 3hjw_B* 2rfk_B* 3hjy_B 3mqk_B | Back alignment and structure |
|---|
| >3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... | Back alignment and structure |
|---|
| >2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 | Back alignment and structure |
|---|
| >3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X | Back alignment and structure |
|---|
| >4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... | Back alignment and structure |
|---|
| >2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... | Back alignment and structure |
|---|
| >3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* | Back alignment and structure |
|---|
| >2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 | Back alignment and structure |
|---|
| >3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* | Back alignment and structure |
|---|
| >2ayj_A 50S ribosomal protein L40E; Zn-binding, beta-strand protein, structural genomics, PSI, protein structure initiative; NMR {Sulfolobus solfataricus} SCOP: g.41.8.7 | Back alignment and structure |
|---|
| >2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 | Back alignment and structure |
|---|
| >1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4 | Back alignment and structure |
|---|
| >3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A | Back alignment and structure |
|---|
| >2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1 | Back alignment and structure |
|---|
| >3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2zjr_Z 50S ribosomal protein L32; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: g.41.8.5 PDB: 1j5a_M* 1jzy_M* 1jzz_M* 1k01_M* 1nkw_Z 1ond_Z* 1sm1_Z* 1yl3_5 2b66_5 2b9n_5 2b9p_5 2zjp_Y* 2zjq_Z 1jzx_M 3cf5_Y* 3dll_Y* 3pio_Z* 3pip_Z* 1nwy_Z* 1nwx_Z* ... | Back alignment and structure |
|---|
| >3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3irb_A Uncharacterized protein from DUF35 family; 13815350, protein with unknown function from DUF35 family, S genomics; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A | Back alignment and structure |
|---|
| >3v2d_5 50S ribosomal protein L32; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2hgq_4 2hgj_4 2hgu_4 2j03_5 2jl6_5 2jl8_5 2v47_5 2v49_5 2wdi_5 2wdj_5 2wdl_5 2wdn_5 2wh2_5 2wh4_5 2wrj_5 2wrl_5 2wro_5 2wrr_5 2x9s_5 2x9u_5 ... | Back alignment and structure |
|---|
| >2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 | Back alignment and structure |
|---|
| >6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 | Back alignment and structure |
|---|
| >1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 | Back alignment and structure |
|---|
| >3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A | Back alignment and structure |
|---|
| >1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b | Back alignment and structure |
|---|
| >1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 | Back alignment and structure |
|---|
| >4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2gnr_A Conserved hypothetical protein; 13815350, structural genomics, PSI, protein structure initiative; 1.80A {Sulfolobus solfataricus P2} PDB: 3irb_A | Back alignment and structure |
|---|
| >3iz6_X 40S ribosomal protein S27 (S27E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A | Back alignment and structure |
|---|
| >1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... | Back alignment and structure |
|---|
| >2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 | Back alignment and structure |
|---|
| >2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 | Back alignment and structure |
|---|
| >2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 | Back alignment and structure |
|---|
| >2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 | Back alignment and structure |
|---|
| >2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A | Back alignment and structure |
|---|
| >4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... | Back alignment and structure |
|---|
| >2l7x_A Envelope glycoprotein; cytoplasmic tail, viral protein; NMR {Crimean-congo hemorrhagic fever virus} | Back alignment and structure |
|---|
| >1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A | Back alignment and structure |
|---|
| >1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A | Back alignment and structure |
|---|
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ryq_A DNA-directed RNA polymerase, subunit E''; structural genomics, zinc, PSI, protein structure initiative; 1.38A {Pyrococcus furiosus} SCOP: g.41.9.3 PDB: 3qqc_E | Back alignment and structure |
|---|
| >1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A | Back alignment and structure |
|---|
| >4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
| >2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1nj3_A NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, zinc- finger, ubiquitin, protein binding; NMR {Rattus norvegicus} SCOP: g.41.11.1 PDB: 1q5w_A | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 | Back alignment and structure |
|---|
| >2lk0_A RNA-binding protein 5; zinc finger; NMR {Homo sapiens} PDB: 2lk1_A* | Back alignment and structure |
|---|
| >2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 96.18 | |
| d1dl6a_ | 58 | Transcription initiation factor TFIIB, N-terminal | 96.17 | |
| d2dkta1 | 74 | RING finger and CHY zinc finger domain-containing | 96.06 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 95.21 | |
| d1pfta_ | 50 | Transcription initiation factor TFIIB, N-terminal | 95.21 | |
| d1nnqa2 | 37 | Rubrerythrin, C-terminal domain {Archaeon Pyrococc | 95.15 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 95.13 | |
| d2fiya1 | 290 | FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId | 94.39 | |
| d1rqga3 | 35 | Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro | 93.76 | |
| d2ayja1 | 56 | Ribosomal protein L40e {Sulfolobus solfataricus [T | 93.33 | |
| d1yuza2 | 36 | Nigerythrin, C-terminal domain {Desulfovibrio vulg | 93.13 | |
| d1nnqa2 | 37 | Rubrerythrin, C-terminal domain {Archaeon Pyrococc | 93.12 | |
| d1yuza2 | 36 | Nigerythrin, C-terminal domain {Desulfovibrio vulg | 92.96 | |
| d2cona1 | 66 | RNA-binding protein NOB1 (Nin one binding) {Mouse | 92.74 | |
| d2ak3a2 | 37 | Microbial and mitochondrial ADK, insert "zinc fing | 92.34 | |
| d1qxfa_ | 58 | Ribosomal protein S27e {Archaeon Archaeoglobus ful | 92.34 | |
| d1pfva3 | 35 | Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch | 92.25 | |
| d2ey4e1 | 52 | Ribosome biogenesis protein Nop10 {Archaeon Pyroco | 92.23 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 92.14 | |
| d2apob1 | 55 | Ribosome biogenesis protein Nop10 {Archaeon Methan | 91.98 | |
| d1zina2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 91.87 | |
| d2j0151 | 59 | Ribosomal protein L32p {Thermus thermophilus [TaxI | 91.8 | |
| d1twfl_ | 46 | RBP12 subunit of RNA polymerase II {Baker's yeast | 91.78 | |
| d1s3ga2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 91.7 | |
| d1akya2 | 38 | Microbial and mitochondrial ADK, insert "zinc fing | 91.67 | |
| d2akla2 | 38 | Hypothetical protein PA0128, N-terminal domain {Ps | 91.65 | |
| d1e4va2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 91.45 | |
| d1lkoa2 | 44 | Rubrerythrin, C-terminal domain {Desulfovibrio vul | 91.24 | |
| d1k3xa3 | 40 | Endonuclease VIII {Escherichia coli [TaxId: 562]} | 90.67 | |
| d2zjrz1 | 58 | Ribosomal protein L32p {Deinococcus radiodurans [T | 90.66 | |
| d1joca1 | 64 | Eea1 {Human (Homo sapiens) [TaxId: 9606]} | 90.4 | |
| d1rqga3 | 35 | Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro | 90.27 | |
| d2gnra1 | 137 | Hypothetical protein SSO2064 {Sulfolobus solfatari | 89.87 | |
| d2dkta1 | 74 | RING finger and CHY zinc finger domain-containing | 89.73 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 89.49 | |
| d1k82a3 | 44 | DNA repair protein MutM (Fpg) {Escherichia coli [T | 89.19 | |
| d1wd2a_ | 60 | Ariadne-1 protein homolog {Human (Homo sapiens) [T | 88.7 | |
| d2qam01 | 56 | Ribosomal protein L32p {Escherichia coli [TaxId: 5 | 88.34 | |
| d1r2za3 | 46 | DNA repair protein MutM (Fpg) {Bacillus stearother | 88.12 | |
| d1iroa_ | 53 | Rubredoxin {Clostridium pasteurianum [TaxId: 1501] | 88.09 | |
| d1dx8a_ | 70 | Rubredoxin {Guillardia theta [TaxId: 55529]} | 87.81 | |
| d6rxna_ | 45 | Rubredoxin {Desulfovibrio desulfuricans, strain 27 | 87.75 | |
| d2dsxa1 | 52 | Rubredoxin {Desulfovibrio gigas [TaxId: 879]} | 87.73 | |
| d2k4xa1 | 55 | Ribosomal protein S27ae {Thermoplasma acidophilum | 87.61 | |
| d1tdza3 | 47 | DNA repair protein MutM (Fpg) {Lactococcus lactis | 86.57 | |
| d1neea2 | 37 | Zinc-binding domain of translation initiation fact | 86.45 | |
| d2fiya1 | 290 | FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId | 86.43 | |
| d1k81a_ | 36 | Zinc-binding domain of translation initiation fact | 86.39 | |
| d1tfia_ | 50 | Transcriptional factor SII, C-terminal domain {Hum | 84.83 | |
| d2j9ub1 | 47 | Vacuolar protein-sorting-associated protein 36, VP | 84.51 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 84.29 | |
| d1brfa_ | 53 | Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 | 83.71 | |
| d1twfi2 | 72 | RBP9 subunit of RNA polymerase II {Baker's yeast ( | 83.51 | |
| d1wiia_ | 85 | Hypothetical UPF0222 protein MGC4549 {Mouse (Mus m | 83.46 | |
| d1ryqa_ | 67 | putative DNA-directed RNA polymerase subunit E'' ( | 82.7 | |
| d1vzia2 | 37 | Desulfoferrodoxin N-terminal domain {Desulfoarculu | 82.3 | |
| d1s24a_ | 56 | Two-iron rubredoxin {Pseudomonas oleovorans [TaxId | 80.81 | |
| d1dxga_ | 36 | Desulforedoxin {Desulfovibrio gigas [TaxId: 879]} | 80.72 | |
| d2gmga1 | 105 | Hypothetical protein PF0610 {Pyrococcus furiosus [ | 80.61 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 80.1 |
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Rubredoxin-like superfamily: YfgJ-like family: YfgJ-like domain: Hypothetical protein YfgJ species: Escherichia coli [TaxId: 562]
Probab=96.18 E-value=0.00029 Score=40.62 Aligned_cols=28 Identities=14% Similarity=0.396 Sum_probs=19.0
Q ss_pred CCceeCCCCCCCCCCCCCCCCCCCCCccCccccccCCceecC
Q 033949 54 EPALFCNNCNLLFPSSLPPPPPPPPLVSDVSKCRFCDRLVEP 95 (107)
Q Consensus 54 ~~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~C~~CG~~i~~ 95 (107)
+....|..|...+.. .-.||.|+.+++.
T Consensus 16 ~~~~~C~~C~~~~~~--------------~a~CPdC~~~Le~ 43 (71)
T d2jnea1 16 NGHARCRSCGEFIEM--------------KALCPDCHQPLQV 43 (71)
T ss_dssp TTEEEETTTCCEEEE--------------EEECTTTCSBCEE
T ss_pred CCCEehhhhhhhhee--------------EEeCCccccHHHH
Confidence 357788888887743 3467777777654
|
| >d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2ayja1 g.41.8.7 (A:1-56) Ribosomal protein L40e {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ey4e1 g.41.16.1 (E:4-55) Ribosome biogenesis protein Nop10 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2apob1 g.41.16.1 (B:403-457) Ribosome biogenesis protein Nop10 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1twfl_ g.41.9.2 (L:) RBP12 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1k3xa3 g.39.1.8 (A:223-262) Endonuclease VIII {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2zjrz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2gnra1 b.40.4.15 (A:8-144) Hypothetical protein SSO2064 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k82a3 g.39.1.8 (A:225-268) DNA repair protein MutM (Fpg) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qam01 g.41.8.5 (0:1-56) Ribosomal protein L32p {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r2za3 g.39.1.8 (A:229-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} | Back information, alignment and structure |
|---|
| >d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1tdza3 g.39.1.8 (A:225-271) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1tfia_ g.41.3.1 (A:) Transcriptional factor SII, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j9ub1 g.41.11.1 (B:115-161) Vacuolar protein-sorting-associated protein 36, VPS36 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wiia_ g.41.3.4 (A:) Hypothetical UPF0222 protein MGC4549 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ryqa_ g.41.9.3 (A:) putative DNA-directed RNA polymerase subunit E'' (RpoE2) {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vzia2 g.41.5.2 (A:1-37) Desulfoferrodoxin N-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]} | Back information, alignment and structure |
|---|
| >d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} | Back information, alignment and structure |
|---|
| >d1dxga_ g.41.5.2 (A:) Desulforedoxin {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|