Citrus Sinensis ID: 033949


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MFFFFVGGVNQQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCNNCNLLFPSSLPPPPPPPPLVSDVSKCRFCDRLVEPDFSFCPYCGSAL
cEEEEEccccccEEEEEEEccEEEcccccccEEEEEcEEEEEEEEEcccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccc
cEEEEEccHHHHHHHHHHHcccccccccccccHHHHHHHEEEEEEEEEEccccccEEEccccccccccccccccccccccHHHHccccccccccccccEcccccccc
MFFFFVGGVNQQVSRVLKSgagrcincgstADLVEYEKVLKAFFvpvwkwpakepalfcnncnllfpsslpppppppplvsdvskcrfcdrlvepdfsfcpycgsal
MFFFFVGGVNQQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCNNCNLLFPSSLPPPPPPPPLVSDVSKCRFCDRLVepdfsfcpycgsal
MffffvggvNQQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCNNCNLLFpsslpppppppplVSDVSKCRFCDRLVEPDFSFCPYCGSAL
*FFFFVGGVNQQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCNNCNLLF*****************************************
MFFFFVGGVNQQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCNNCNLL*******************KCRFCDRLVEPDFSFCPYCGSA*
MFFFFVGGVNQQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCNNCNLLFPSSLPPPPPPPPLVSDVSKCRFCDRLVEPDFSFCPYCGSAL
MFFFFVGGVNQQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCNNCNLLFPSSLPP***********SKCRFCDRLVEPDFSFCPYCGS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFFFFVGGVNQQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCNNCNLLFPSSLPPPPPPPPLVSDVSKCRFCDRLVEPDFSFCPYCGSAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
255545392112 conserved hypothetical protein [Ricinus 1.0 0.955 0.687 2e-38
224063078113 predicted protein [Populus trichocarpa] 1.0 0.946 0.663 2e-37
297846816101 hypothetical protein ARALYDRAFT_891393 [ 0.943 1.0 0.654 2e-34
15219391101 uncharacterized protein [Arabidopsis tha 0.943 1.0 0.654 2e-34
225459571102 PREDICTED: uncharacterized protein LOC10 0.953 1.0 0.654 6e-30
226531153106 uncharacterized protein LOC100275135 [Ze 0.990 1.0 0.598 1e-29
242090657110 hypothetical protein SORBIDRAFT_09g02146 1.0 0.972 0.581 6e-29
357133537106 PREDICTED: uncharacterized protein LOC10 0.990 1.0 0.598 1e-28
356552679114 PREDICTED: uncharacterized protein LOC10 1.0 0.938 0.552 3e-28
326487958104 predicted protein [Hordeum vulgare subsp 0.971 1.0 0.579 1e-27
>gi|255545392|ref|XP_002513756.1| conserved hypothetical protein [Ricinus communis] gi|223546842|gb|EEF48339.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 77/112 (68%), Positives = 89/112 (79%), Gaps = 5/112 (4%)

Query: 1   MFFFFVGGVNQQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCN 60
           MFFFF GGV QQVSRVLKSG GRC+NCGS ADLVEYEKVLK FF+PV+KWP KEPA++CN
Sbjct: 1   MFFFFAGGVEQQVSRVLKSGVGRCVNCGSMADLVEYEKVLKLFFIPVYKWPGKEPAMYCN 60

Query: 61  NCNLLFPSSLPPPPP-----PPPLVSDVSKCRFCDRLVEPDFSFCPYCGSAL 107
           NCNL+FP S   PPP      P  VSD  +C FCDR+ EP+F FCP+CG++L
Sbjct: 61  NCNLMFPRSFSFPPPRTDSVSPSAVSDGLRCHFCDRVAEPEFRFCPFCGNSL 112




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224063078|ref|XP_002300985.1| predicted protein [Populus trichocarpa] gi|222842711|gb|EEE80258.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297846816|ref|XP_002891289.1| hypothetical protein ARALYDRAFT_891393 [Arabidopsis lyrata subsp. lyrata] gi|297337131|gb|EFH67548.1| hypothetical protein ARALYDRAFT_891393 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15219391|ref|NP_175087.1| uncharacterized protein [Arabidopsis thaliana] gi|13876513|gb|AAK43489.1|AC084807_14 hypothetical protein [Arabidopsis thaliana] gi|44917499|gb|AAS49074.1| At1g44414 [Arabidopsis thaliana] gi|332193912|gb|AEE32033.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225459571|ref|XP_002285858.1| PREDICTED: uncharacterized protein LOC100262547 [Vitis vinifera] Back     alignment and taxonomy information
>gi|226531153|ref|NP_001142776.1| uncharacterized protein LOC100275135 [Zea mays] gi|195609474|gb|ACG26567.1| hypothetical protein [Zea mays] gi|195641802|gb|ACG40369.1| hypothetical protein [Zea mays] gi|413949185|gb|AFW81834.1| hypothetical protein ZEAMMB73_807317 [Zea mays] Back     alignment and taxonomy information
>gi|242090657|ref|XP_002441161.1| hypothetical protein SORBIDRAFT_09g021460 [Sorghum bicolor] gi|241946446|gb|EES19591.1| hypothetical protein SORBIDRAFT_09g021460 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|357133537|ref|XP_003568381.1| PREDICTED: uncharacterized protein LOC100838692 [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|356552679|ref|XP_003544690.1| PREDICTED: uncharacterized protein LOC100820054 [Glycine max] Back     alignment and taxonomy information
>gi|326487958|dbj|BAJ89818.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query107
TAIR|locus:2823681101 AT1G44414 "AT1G44414" [Arabido 0.850 0.900 0.597 3.9e-28
TAIR|locus:2823681 AT1G44414 "AT1G44414" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 314 (115.6 bits), Expect = 3.9e-28, P = 3.9e-28
 Identities = 58/97 (59%), Positives = 71/97 (73%)

Query:    11 QQVSRVLKSGAGRCINCGSTADLVEYEKVLKAFFVPVWKWPAKEPALFCNNCNLLFXXXX 70
             QQV +VLKSGAG CI CGS ADLVEY+KV+K FFVPVW+WP K+P L C +C+L F    
Sbjct:    11 QQVRQVLKSGAGTCIRCGSQADLVEYDKVIKLFFVPVWRWPGKDPLLHCRDCDLFFPQSL 70

Query:    71 XXXXXXXXXVSDVSKCRFCDRLVEPDFSFCPYCGSAL 107
                      VS ++ CRFCDR+VEP+F FCP+CGS+L
Sbjct:    71 SPPP-----VS-LATCRFCDRVVEPEFRFCPFCGSSL 101


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.327   0.140   0.481    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      107        86   0.00091  102 3  11 22  0.39    29
                                                     29  0.47    30


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  554 (59 KB)
  Total size of DFA:  121 KB (2078 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  8.24u 0.14s 8.38t   Elapsed:  00:00:01
  Total cpu time:  8.24u 0.14s 8.38t   Elapsed:  00:00:01
  Start:  Fri May 10 09:17:33 2013   End:  Fri May 10 09:17:34 2013


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0006457 "protein folding" evidence=RCA
GO:0009408 "response to heat" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
grail3.0003070401
hypothetical protein (113 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 107
PF1277350 DZR: Double zinc ribbon 99.23
PF1324826 zf-ribbon_3: zinc-ribbon domain 99.11
PF1324023 zinc_ribbon_2: zinc-ribbon domain 99.08
PRK14559 645 putative protein serine/threonine phosphatase; Pro 98.95
PRK14714 1337 DNA polymerase II large subunit; Provisional 98.61
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 98.47
PF1277350 DZR: Double zinc ribbon 98.26
PF1324826 zf-ribbon_3: zinc-ribbon domain 97.85
PF1324023 zinc_ribbon_2: zinc-ribbon domain 97.82
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 97.77
PRK04023 1121 DNA polymerase II large subunit; Validated 97.57
PF03833 900 PolC_DP2: DNA polymerase II large subunit DP2; Int 97.5
PRK14559 645 putative protein serine/threonine phosphatase; Pro 97.4
COG1198 730 PriA Primosomal protein N' (replication factor Y) 97.37
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 97.33
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 97.3
PRK14873 665 primosome assembly protein PriA; Provisional 97.14
TIGR00595 505 priA primosomal protein N'. All proteins in this f 97.13
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 97.06
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 96.88
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 96.76
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 96.75
PRK05580 679 primosome assembly protein PriA; Validated 96.7
PRK14714 1337 DNA polymerase II large subunit; Provisional 96.57
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 96.56
PRK04023 1121 DNA polymerase II large subunit; Validated 96.52
PF0988959 DUF2116: Uncharacterized protein containing a Zn-r 96.51
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 96.41
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 96.4
PF1371736 zinc_ribbon_4: zinc-ribbon domain 96.39
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 96.34
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.32
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 96.32
PF1371937 zinc_ribbon_5: zinc-ribbon domain 96.18
COG1198 730 PriA Primosomal protein N' (replication factor Y) 96.13
PRK00420112 hypothetical protein; Validated 95.99
COG209364 DNA-directed RNA polymerase, subunit E'' [Transcri 95.98
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 95.96
PRK12496164 hypothetical protein; Provisional 95.96
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 95.95
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 95.92
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 95.9
PF15616131 TerY-C: TerY-C metal binding domain 95.84
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 95.82
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 95.79
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 95.74
PRK1313056 H/ACA RNA-protein complex component Nop10p; Review 95.74
PF1371937 zinc_ribbon_5: zinc-ribbon domain 95.73
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 95.71
PF11023114 DUF2614: Protein of unknown function (DUF2614); In 95.69
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 95.53
PRK1489299 putative transcription elongation factor Elf1; Pro 95.45
COG1439177 Predicted nucleic acid-binding protein, consists o 95.44
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 95.4
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 95.37
PF1371736 zinc_ribbon_4: zinc-ribbon domain 95.32
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 95.3
PRK05580 679 primosome assembly protein PriA; Validated 95.24
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 95.23
PRK12380113 hydrogenase nickel incorporation protein HybF; Pro 95.22
PRK14873 665 primosome assembly protein PriA; Provisional 95.22
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 95.11
PRK02935110 hypothetical protein; Provisional 95.02
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 95.01
PF1060173 zf-LITAF-like: LITAF-like zinc ribbon domain; Inte 95.01
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 95.0
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 94.95
PF10083158 DUF2321: Uncharacterized protein conserved in bact 94.89
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 94.83
COG4260345 Membrane protease subunit, stomatin/prohibitin fam 94.69
smart0066152 RPOL9 RNA polymerase subunit 9. 94.65
PF14353128 CpXC: CpXC protein 94.62
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 94.62
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 94.57
PRK03564309 formate dehydrogenase accessory protein FdhE; Prov 94.56
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 94.53
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 94.43
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 94.42
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 94.4
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 94.36
COG1645131 Uncharacterized Zn-finger containing protein [Gene 94.36
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 94.26
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 94.16
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 94.16
smart0071467 LITAF Possible membrane-associated motif in LPS-in 94.09
PF1217237 DUF35_N: Rubredoxin-like zinc ribbon domain (DUF35 94.07
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 94.04
COG205167 RPS27A Ribosomal protein S27E [Translation, riboso 94.02
COG1594113 RPB9 DNA-directed RNA polymerase, subunit M/Transc 93.92
PRK0041559 rps27e 30S ribosomal protein S27e; Reviewed 93.7
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 93.58
smart0066152 RPOL9 RNA polymerase subunit 9. 93.58
PRK00564117 hypA hydrogenase nickel incorporation protein; Pro 93.52
COG1645131 Uncharacterized Zn-finger containing protein [Gene 93.46
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 93.39
COG1545140 Predicted nucleic-acid-binding protein containing 93.37
PRK00420112 hypothetical protein; Validated 93.29
PF0985564 DUF2082: Nucleic-acid-binding protein containing Z 93.29
PF01155113 HypA: Hydrogenase expression/synthesis hypA family 93.12
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 92.99
PF1178136 RRN7: RNA polymerase I-specific transcription init 92.93
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 92.88
PRK0041559 rps27e 30S ribosomal protein S27e; Reviewed 92.88
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 92.78
PF11023114 DUF2614: Protein of unknown function (DUF2614); In 92.71
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 92.65
PRK0413648 rpl40e 50S ribosomal protein L40e; Provisional 92.61
PHA0062659 hypothetical protein 92.55
PRK12380113 hydrogenase nickel incorporation protein HybF; Pro 92.52
PF0667741 Auto_anti-p27: Sjogren's syndrome/scleroderma auto 92.49
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 92.32
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 92.31
PF0690657 DUF1272: Protein of unknown function (DUF1272); In 92.24
PF15616131 TerY-C: TerY-C metal binding domain 92.13
smart00531147 TFIIE Transcription initiation factor IIE. 92.05
PF14319111 Zn_Tnp_IS91: Transposase zinc-binding domain 91.96
smart00531147 TFIIE Transcription initiation factor IIE. 91.92
PRK0043250 30S ribosomal protein S27ae; Validated 91.81
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 91.7
PRK0835161 DNA-directed RNA polymerase subunit E''; Validated 91.52
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 91.51
PLN03086567 PRLI-interacting factor K; Provisional 91.39
PRK1489299 putative transcription elongation factor Elf1; Pro 91.32
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 91.28
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 91.19
PRK0639364 rpoE DNA-directed RNA polymerase subunit E''; Vali 91.17
PHA02942383 putative transposase; Provisional 91.15
PF1345341 zf-TFIIB: Transcription factor zinc-finger 91.15
PRK1228657 rpmF 50S ribosomal protein L32; Reviewed 91.12
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 91.11
TIGR01562305 FdhE formate dehydrogenase accessory protein FdhE. 90.85
PF0877273 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon lik 90.83
PF01155113 HypA: Hydrogenase expression/synthesis hypA family 90.54
PRK02935110 hypothetical protein; Provisional 90.4
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 90.35
TIGR00515 285 accD acetyl-CoA carboxylase, carboxyl transferase, 90.35
PF1005854 DUF2296: Predicted integral membrane metal-binding 90.32
CHL00174 296 accD acetyl-CoA carboxylase beta subunit; Reviewed 90.3
COG209364 DNA-directed RNA polymerase, subunit E'' [Transcri 90.3
PF0148564 IBR: IBR domain; InterPro: IPR002867 Zinc finger ( 90.3
PRK00564117 hypA hydrogenase nickel incorporation protein; Pro 90.17
PRK06266178 transcription initiation factor E subunit alpha; V 90.14
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 90.12
PRK12495 226 hypothetical protein; Provisional 90.11
TIGR0383146 YgiT_finger YgiT-type zinc finger domain. This dom 89.89
PF1435461 Lar_restr_allev: Restriction alleviation protein L 89.67
PF0166755 Ribosomal_S27e: Ribosomal protein S27; InterPro: I 89.58
PF0178356 Ribosomal_L32p: Ribosomal L32p protein family; Int 89.55
PRK05978148 hypothetical protein; Provisional 89.47
PF03833 900 PolC_DP2: DNA polymerase II large subunit DP2; Int 89.39
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 89.33
KOG2906105 consensus RNA polymerase III subunit C11 [Transcri 89.12
PF1436935 zf-RING_3: zinc-finger 88.89
PRK12496164 hypothetical protein; Provisional 88.86
COG0375115 HybF Zn finger protein HypA/HybF (possibly regulat 88.63
TIGR0103155 rpmF_bact ribosomal protein L32. This protein desc 88.55
COG4306160 Uncharacterized protein conserved in bacteria [Fun 88.54
PRK00762124 hypA hydrogenase nickel incorporation protein; Pro 88.54
PRK05654 292 acetyl-CoA carboxylase subunit beta; Validated 88.51
COG1096188 Predicted RNA-binding protein (consists of S1 doma 88.48
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 88.43
COG4888104 Uncharacterized Zn ribbon-containing protein [Gene 88.33
PF1420555 Cys_rich_KTR: Cysteine-rich KTR 88.17
COG1594113 RPB9 DNA-directed RNA polymerase, subunit M/Transc 88.11
PF0512981 Elf1: Transcription elongation factor Elf1 like; I 87.99
smart0064764 IBR In Between Ring fingers. the domains occurs be 87.78
TIGR03826137 YvyF flagellar operon protein TIGR03826. This gene 87.78
PRK14973 936 DNA topoisomerase I; Provisional 87.74
PRK00464154 nrdR transcriptional regulator NrdR; Validated 87.67
smart0054726 ZnF_RBZ Zinc finger domain. Zinc finger domain in 87.6
PRK08579625 anaerobic ribonucleoside triphosphate reductase; P 87.34
COG226059 Predicted Zn-ribbon RNA-binding protein [Translati 87.34
PLN0020986 ribosomal protein S27; Provisional 87.32
PF04981 236 NMD3: NMD3 family ; InterPro: IPR007064 The NMD3 p 87.27
COG1592166 Rubrerythrin [Energy production and conversion] 87.13
PRK15103 419 paraquat-inducible membrane protein A; Provisional 87.09
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 87.05
COG1096188 Predicted RNA-binding protein (consists of S1 doma 87.03
PF0064130 zf-RanBP: Zn-finger in Ran binding protein and oth 86.98
COG0675364 Transposase and inactivated derivatives [DNA repli 86.79
TIGR01562305 FdhE formate dehydrogenase accessory protein FdhE. 86.55
COG155250 RPL40A Ribosomal protein L40E [Translation, riboso 86.51
PRK03564309 formate dehydrogenase accessory protein FdhE; Prov 86.34
PF07295146 DUF1451: Protein of unknown function (DUF1451); In 86.29
PF0259156 DUF164: Putative zinc ribbon domain; InterPro: IPR 86.26
PF13901202 DUF4206: Domain of unknown function (DUF4206) 86.21
PRK00464 154 nrdR transcriptional regulator NrdR; Validated 86.17
PTZ0008385 40S ribosomal protein S27; Provisional 86.15
PF0682730 zf-FPG_IleRS: Zinc finger found in FPG and IleRS; 86.03
PRK05978148 hypothetical protein; Provisional 86.0
PRK06266178 transcription initiation factor E subunit alpha; V 85.95
PRK07418616 acetolactate synthase 3 catalytic subunit; Reviewe 85.9
PF09567 314 RE_MamI: MamI restriction endonuclease; InterPro: 85.79
PF0139639 zf-C4_Topoisom: Topoisomerase DNA binding C4 zinc 85.73
smart0044040 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo 85.69
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 85.66
PRK08270656 anaerobic ribonucleoside triphosphate reductase; P 85.58
PRK08271623 anaerobic ribonucleoside triphosphate reductase; P 85.35
PRK07219 822 DNA topoisomerase I; Validated 85.28
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 85.16
PF06044 254 DRP: Dam-replacing family; InterPro: IPR010324 Dam 85.15
PRK06260 397 threonine synthase; Validated 85.13
PRK11595 227 DNA utilization protein GntX; Provisional 85.06
PF13597546 NRDD: Anaerobic ribonucleoside-triphosphate reduct 85.04
COG0068 750 HypF Hydrogenase maturation factor [Posttranslatio 84.95
COG4640 465 Predicted membrane protein [Function unknown] 84.8
COG0777 294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 84.35
PRK11032160 hypothetical protein; Provisional 84.34
PRK10445263 endonuclease VIII; Provisional 84.28
PRK14810272 formamidopyrimidine-DNA glycosylase; Provisional 84.08
PRK03922113 hypothetical protein; Provisional 84.06
PRK01103274 formamidopyrimidine/5-formyluracil/ 5-hydroxymethy 83.77
PF14353128 CpXC: CpXC protein 83.75
PF0622157 zf-C2HC5: Putative zinc finger motif, C2HC5-type; 83.7
COG1592166 Rubrerythrin [Energy production and conversion] 83.66
TIGR00577272 fpg formamidopyrimidine-DNA glycosylase (fpg). All 83.46
cd01675555 RNR_III Class III ribonucleotide reductase. Ribonu 83.2
COG1545140 Predicted nucleic-acid-binding protein containing 83.18
PRK03988138 translation initiation factor IF-2 subunit beta; V 83.06
PF0311928 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f 83.04
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 83.0
TIGR00311133 aIF-2beta translation initiation factor aIF-2, bet 82.86
PF04475102 DUF555: Protein of unknown function (DUF555); Inte 82.84
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 82.66
COG439162 Uncharacterized protein conserved in bacteria [Fun 82.6
smart00653110 eIF2B_5 domain present in translation initiation f 82.44
COG1885115 Uncharacterized protein conserved in archaea [Func 82.36
TIGR00155 403 pqiA_fam integral membrane protein, PqiA family. T 82.31
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 82.21
PRK14811269 formamidopyrimidine-DNA glycosylase; Provisional 82.02
TIGR00354 1095 polC DNA polymerase, archaeal type II, large subun 81.97
COG2816 279 NPY1 NTP pyrophosphohydrolases containing a Zn-fin 81.97
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 81.95
TIGR00155 403 pqiA_fam integral membrane protein, PqiA family. T 81.89
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 81.73
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 81.61
PRK0967872 DNA-binding transcriptional regulator; Provisional 81.6
PRK00481242 NAD-dependent deacetylase; Provisional 81.59
PRK07591 421 threonine synthase; Validated 81.52
TIGR02487579 NrdD anaerobic ribonucleoside-triphosphate reducta 81.32
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 81.09
PF07295146 DUF1451: Protein of unknown function (DUF1451); In 81.06
PRK0971064 lar restriction alleviation and modification prote 81.05
TIGR00310 192 ZPR1_znf ZPR1 zinc finger domain. 80.75
COG2995 418 PqiA Uncharacterized paraquat-inducible protein A 80.72
COG033357 RpmF Ribosomal protein L32 [Translation, ribosomal 80.56
PF09334 391 tRNA-synt_1g: tRNA synthetases class I (M); InterP 80.55
PF04502 324 DUF572: Family of unknown function (DUF572) ; Inte 80.47
PF1300547 zf-IS66: zinc-finger binding domain of transposase 80.32
PF0460647 Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: I 80.19
PRK1182760 hypothetical protein; Provisional 80.06
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
Probab=99.23  E-value=7.3e-12  Score=71.41  Aligned_cols=42  Identities=31%  Similarity=0.755  Sum_probs=34.8

Q ss_pred             CCCceeCCCCCCCCCCCCCCCCCCCCCccCccccccCCceecCCCccCcCCC
Q 033949           53 KEPALFCNNCNLLFPSSLPPPPPPPPLVSDVSKCRFCDRLVEPDFSFCPYCG  104 (107)
Q Consensus        53 ~~~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~C~~CG~~i~~~~~fCP~CG  104 (107)
                      .....+|++||..+.....          ....|++||++++.+++||++||
T Consensus         9 ~~~~~fC~~CG~~l~~~~~----------~~~~C~~Cg~~~~~~~~fC~~CG   50 (50)
T PF12773_consen    9 PDDAKFCPHCGTPLPPPDQ----------SKKICPNCGAENPPNAKFCPNCG   50 (50)
T ss_pred             CccccCChhhcCChhhccC----------CCCCCcCCcCCCcCCcCccCccc
Confidence            3579999999999872111          25789999999999999999998



>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>PF03833 PolC_DP2: DNA polymerase II large subunit DP2; InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>PF09889 DUF2116: Uncharacterized protein containing a Zn-ribbon (DUF2116); InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PRK12496 hypothetical protein; Provisional Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15616 TerY-C: TerY-C metal binding domain Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only] Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PRK02935 hypothetical protein; Provisional Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>PF10601 zf-LITAF-like: LITAF-like zinc ribbon domain; InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>COG4260 Membrane protease subunit, stomatin/prohibitin family [Amino acid transport and metabolism] Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins Back     alignment and domain information
>PF12172 DUF35_N: Rubredoxin-like zinc ribbon domain (DUF35_N); InterPro: IPR022002 This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] Back     alignment and domain information
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only] Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins Back     alignment and domain information
>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>PF11023 DUF2614: Protein of unknown function (DUF2614); InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional Back     alignment and domain information
>PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length Back     alignment and domain information
>PF15616 TerY-C: TerY-C metal binding domain Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF14319 Zn_Tnp_IS91: Transposase zinc-binding domain Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated Back     alignment and domain information
>PHA02942 putative transposase; Provisional Back     alignment and domain information
>PF13453 zf-TFIIB: Transcription factor zinc-finger Back     alignment and domain information
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE Back     alignment and domain information
>PF08772 NOB1_Zn_bind: Nin one binding (NOB1) Zn-ribbon like; InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1 Back     alignment and domain information
>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation Back     alignment and domain information
>PRK02935 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>PF10058 DUF2296: Predicted integral membrane metal-binding protein (DUF2296); InterPro: IPR019273 This domain, found mainly in the eukaryotic lunapark proteins, has no known function [] Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription] Back     alignment and domain information
>PF01485 IBR: IBR domain; InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>PRK12495 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03831 YgiT_finger YgiT-type zinc finger domain Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>PF01667 Ribosomal_S27e: Ribosomal protein S27; InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01783 Ribosomal_L32p: Ribosomal L32p protein family; InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>PF03833 PolC_DP2: DNA polymerase II large subunit DP2; InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription] Back     alignment and domain information
>PF14369 zf-RING_3: zinc-finger Back     alignment and domain information
>PRK12496 hypothetical protein; Provisional Back     alignment and domain information
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only] Back     alignment and domain information
>TIGR01031 rpmF_bact ribosomal protein L32 Back     alignment and domain information
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>PF14205 Cys_rich_KTR: Cysteine-rich KTR Back     alignment and domain information
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] Back     alignment and domain information
>PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines Back     alignment and domain information
>smart00647 IBR In Between Ring fingers Back     alignment and domain information
>TIGR03826 YvyF flagellar operon protein TIGR03826 Back     alignment and domain information
>PRK14973 DNA topoisomerase I; Provisional Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>smart00547 ZnF_RBZ Zinc finger domain Back     alignment and domain information
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00209 ribosomal protein S27; Provisional Back     alignment and domain information
>PF04981 NMD3: NMD3 family ; InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PRK15103 paraquat-inducible membrane protein A; Provisional Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00641 zf-RanBP: Zn-finger in Ran binding protein and others; InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE Back     alignment and domain information
>COG1552 RPL40A Ribosomal protein L40E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional Back     alignment and domain information
>PF07295 DUF1451: Protein of unknown function (DUF1451); InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length Back     alignment and domain information
>PF02591 DUF164: Putative zinc ribbon domain; InterPro: IPR003743 This entry describes proteins of unknown function Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PTZ00083 40S ribosomal protein S27; Provisional Back     alignment and domain information
>PF06827 zf-FPG_IleRS: Zinc finger found in FPG and IleRS; InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PF09567 RE_MamI: MamI restriction endonuclease; InterPro: IPR019067 There are four classes of restriction endonucleases: types I, II,III and IV Back     alignment and domain information
>PF01396 zf-C4_Topoisom: Topoisomerase DNA binding C4 zinc finger; InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>smart00440 ZnF_C2C2 C2C2 Zinc finger Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional Back     alignment and domain information
>PRK07219 DNA topoisomerase I; Validated Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06044 DRP: Dam-replacing family; InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PRK11595 DNA utilization protein GntX; Provisional Back     alignment and domain information
>PF13597 NRDD: Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A Back     alignment and domain information
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4640 Predicted membrane protein [Function unknown] Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>PRK11032 hypothetical protein; Provisional Back     alignment and domain information
>PRK10445 endonuclease VIII; Provisional Back     alignment and domain information
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional Back     alignment and domain information
>PRK03922 hypothetical protein; Provisional Back     alignment and domain information
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PF06221 zf-C2HC5: Putative zinc finger motif, C2HC5-type; InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg) Back     alignment and domain information
>cd01675 RNR_III Class III ribonucleotide reductase Back     alignment and domain information
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only] Back     alignment and domain information
>PRK03988 translation initiation factor IF-2 subunit beta; Validated Back     alignment and domain information
>PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative Back     alignment and domain information
>PF04475 DUF555: Protein of unknown function (DUF555); InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5 Back     alignment and domain information
>COG1885 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR00155 pqiA_fam integral membrane protein, PqiA family Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional Back     alignment and domain information
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit Back     alignment and domain information
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR00155 pqiA_fam integral membrane protein, PqiA family Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK00481 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK07591 threonine synthase; Validated Back     alignment and domain information
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF07295 DUF1451: Protein of unknown function (DUF1451); InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain Back     alignment and domain information
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown] Back     alignment and domain information
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF04502 DUF572: Family of unknown function (DUF572) ; InterPro: IPR007590 This entry represents eukaryotic proteins with undetermined function belonging to the CWC16 family Back     alignment and domain information
>PF13005 zf-IS66: zinc-finger binding domain of transposase IS66 ; InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [] Back     alignment and domain information
>PF04606 Ogr_Delta: Ogr/Delta-like zinc finger; InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr Back     alignment and domain information
>PRK11827 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 98.11
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 97.82
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 97.13
3j21_g51 50S ribosomal protein L40E; archaea, archaeal, KIN 96.51
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 96.49
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 96.35
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 96.15
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 96.07
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 96.04
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein 95.62
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 95.45
2aus_D60 NOP10, ribosome biogenesis protein NOP10; isomeras 95.33
3qt1_I133 DNA-directed RNA polymerases I, II, and III subun; 94.85
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 94.54
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 94.28
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 94.0
2fiy_A309 Protein FDHE homolog; FDHE protein, structural gen 93.87
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 93.82
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 93.78
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 93.6
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 93.53
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 93.39
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 93.24
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 92.64
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 92.59
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 92.42
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 92.33
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 92.3
2ayj_A56 50S ribosomal protein L40E; Zn-binding, beta-stran 92.29
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 92.25
1qxf_A66 GR2, 30S ribosomal protein S27E; structural genomi 91.91
3qt1_I133 DNA-directed RNA polymerases I, II, and III subun; 91.8
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein 91.53
2con_A79 RUH-035 protein, NIN one binding protein; ribosome 91.14
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 90.78
2zjr_Z60 50S ribosomal protein L32; ribosome, large ribosom 90.68
3j20_W63 30S ribosomal protein S27E; archaea, archaeal, KIN 90.5
3irb_A145 Uncharacterized protein from DUF35 family; 1381535 90.33
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 90.21
3v2d_560 50S ribosomal protein L32; ribosome associated inh 90.01
2xzm_681 RPS27E; ribosome, translation; 3.93A {Tetrahymena 88.54
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 88.42
1gh9_A71 8.3 kDa protein (gene MTH1184); beta+alpha complex 88.42
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 88.4
1wd2_A60 Ariadne-1 protein homolog; ring, IBR, triad, zinc 87.96
2k2d_A79 Ring finger and CHY zinc finger domain- containing 87.85
3u5c_b82 RP61, YS20, 40S ribosomal protein S27-A; translati 87.7
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 87.42
4esj_A 257 Type-2 restriction enzyme DPNI; restriction endonu 87.34
2gnr_A145 Conserved hypothetical protein; 13815350, structur 87.28
3iz6_X86 40S ribosomal protein S27 (S27E); eukaryotic ribos 87.14
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 86.63
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 86.26
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetr 86.2
2fiy_A309 Protein FDHE homolog; FDHE protein, structural gen 85.97
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 85.6
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 85.19
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 85.16
1k81_A36 EIF-2-beta, probable translation initiation factor 84.96
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 84.95
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 84.41
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 84.37
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 84.21
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 84.1
2l7x_A77 Envelope glycoprotein; cytoplasmic tail, viral pro 83.92
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 83.87
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 83.63
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 83.59
1ryq_A69 DNA-directed RNA polymerase, subunit E''; structur 83.52
1lko_A191 Rubrerythrin all-iron(II) form; reduced form, DIIR 83.45
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 83.38
4esj_A 257 Type-2 restriction enzyme DPNI; restriction endonu 83.04
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 82.79
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 82.64
1nj3_A31 NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, 82.62
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 82.42
2lk0_A32 RNA-binding protein 5; zinc finger; NMR {Homo sapi 82.03
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 81.67
2akl_A138 PHNA-like protein PA0128; two domains, Zn binding 80.33
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 80.23
3nw0_A238 Non-structural maintenance of chromosomes element 80.2
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 80.19
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
Probab=98.11  E-value=8.2e-07  Score=54.71  Aligned_cols=37  Identities=19%  Similarity=0.381  Sum_probs=24.3

Q ss_pred             CceeCCCCCCCCCCCCCCCCCCCCCccCccccccCCceecC------CCccCcCCCC
Q 033949           55 PALFCNNCNLLFPSSLPPPPPPPPLVSDVSKCRFCDRLVEP------DFSFCPYCGS  105 (107)
Q Consensus        55 ~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~C~~CG~~i~~------~~~fCP~CG~  105 (107)
                      ....|..|+..+..              ...||.||.+++.      ...||+.||.
T Consensus        17 ~~~~C~~C~~~~~~--------------~afCPeCgq~Le~lkACGA~~yFC~~C~~   59 (81)
T 2jrp_A           17 DTAHCETCAKDFSL--------------QALCPDCRQPLQVLKACGAVDYFCQNGHG   59 (81)
T ss_dssp             SEEECTTTCCEEEE--------------EEECSSSCSCCCEEEETTEEEECCTTTTC
T ss_pred             CceECccccccCCC--------------cccCcchhhHHHHHHhcCCcCeeeccCCC
Confidence            46678888887644              2367777766644      3667777774



>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>2aus_D NOP10, ribosome biogenesis protein NOP10; isomerase, structural protein, isomerase-structural protein; 2.10A {Pyrococcus abyssi} PDB: 3lwr_B 3lwo_B* 3lwq_B* 3lwp_B 3lwv_B 3hax_C* 2hvy_C* 3hay_C* 2ey4_E 3hjw_B* 2rfk_B* 3hjy_B 3mqk_B Back     alignment and structure
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>2ayj_A 50S ribosomal protein L40E; Zn-binding, beta-strand protein, structural genomics, PSI, protein structure initiative; NMR {Sulfolobus solfataricus} SCOP: g.41.8.7 Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4 Back     alignment and structure
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>2con_A RUH-035 protein, NIN one binding protein; ribosome, RNA binding protein, unknown function, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.41.15.1 Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2zjr_Z 50S ribosomal protein L32; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: g.41.8.5 PDB: 1j5a_M* 1jzy_M* 1jzz_M* 1k01_M* 1nkw_Z 1ond_Z* 1sm1_Z* 1yl3_5 2b66_5 2b9n_5 2b9p_5 2zjp_Y* 2zjq_Z 1jzx_M 3cf5_Y* 3dll_Y* 3pio_Z* 3pip_Z* 1nwy_Z* 1nwx_Z* ... Back     alignment and structure
>3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3irb_A Uncharacterized protein from DUF35 family; 13815350, protein with unknown function from DUF35 family, S genomics; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>3v2d_5 50S ribosomal protein L32; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 2hgq_4 2hgj_4 2hgu_4 2j03_5 2jl6_5 2jl8_5 2v47_5 2v49_5 2wdi_5 2wdj_5 2wdl_5 2wdn_5 2wh2_5 2wh4_5 2wrj_5 2wrl_5 2wro_5 2wrr_5 2x9s_5 2x9u_5 ... Back     alignment and structure
>2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>1wd2_A Ariadne-1 protein homolog; ring, IBR, triad, zinc finger, ligase; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b Back     alignment and structure
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure
>4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae} Back     alignment and structure
>2gnr_A Conserved hypothetical protein; 13815350, structural genomics, PSI, protein structure initiative; 1.80A {Sulfolobus solfataricus P2} PDB: 3irb_A Back     alignment and structure
>3iz6_X 40S ribosomal protein S27 (S27E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 Back     alignment and structure
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>2l7x_A Envelope glycoprotein; cytoplasmic tail, viral protein; NMR {Crimean-congo hemorrhagic fever virus} Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ryq_A DNA-directed RNA polymerase, subunit E''; structural genomics, zinc, PSI, protein structure initiative; 1.38A {Pyrococcus furiosus} SCOP: g.41.9.3 PDB: 3qqc_E Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>4esj_A Type-2 restriction enzyme DPNI; restriction endonuclease-DNA complex, type IIM, type IIE, RE enzyme, DPNI; HET: DNA 6MA; 2.05A {Streptococcus pneumoniae} Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>1nj3_A NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, zinc- finger, ubiquitin, protein binding; NMR {Rattus norvegicus} SCOP: g.41.11.1 PDB: 1q5w_A Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>2lk0_A RNA-binding protein 5; zinc finger; NMR {Homo sapiens} PDB: 2lk1_A* Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query107
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 96.18
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 96.17
d2dkta174 RING finger and CHY zinc finger domain-containing 96.06
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 95.21
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 95.21
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 95.15
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 95.13
d2fiya1290 FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId 94.39
d1rqga335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro 93.76
d2ayja156 Ribosomal protein L40e {Sulfolobus solfataricus [T 93.33
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 93.13
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 93.12
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 92.96
d2cona166 RNA-binding protein NOB1 (Nin one binding) {Mouse 92.74
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 92.34
d1qxfa_58 Ribosomal protein S27e {Archaeon Archaeoglobus ful 92.34
d1pfva335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Esch 92.25
d2ey4e152 Ribosome biogenesis protein Nop10 {Archaeon Pyroco 92.23
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 92.14
d2apob155 Ribosome biogenesis protein Nop10 {Archaeon Methan 91.98
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 91.87
d2j015159 Ribosomal protein L32p {Thermus thermophilus [TaxI 91.8
d1twfl_46 RBP12 subunit of RNA polymerase II {Baker's yeast 91.78
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 91.7
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 91.67
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 91.65
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 91.45
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 91.24
d1k3xa340 Endonuclease VIII {Escherichia coli [TaxId: 562]} 90.67
d2zjrz158 Ribosomal protein L32p {Deinococcus radiodurans [T 90.66
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 90.4
d1rqga335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro 90.27
d2gnra1137 Hypothetical protein SSO2064 {Sulfolobus solfatari 89.87
d2dkta174 RING finger and CHY zinc finger domain-containing 89.73
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 89.49
d1k82a344 DNA repair protein MutM (Fpg) {Escherichia coli [T 89.19
d1wd2a_60 Ariadne-1 protein homolog {Human (Homo sapiens) [T 88.7
d2qam0156 Ribosomal protein L32p {Escherichia coli [TaxId: 5 88.34
d1r2za346 DNA repair protein MutM (Fpg) {Bacillus stearother 88.12
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 88.09
d1dx8a_70 Rubredoxin {Guillardia theta [TaxId: 55529]} 87.81
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 87.75
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 87.73
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 87.61
d1tdza347 DNA repair protein MutM (Fpg) {Lactococcus lactis 86.57
d1neea237 Zinc-binding domain of translation initiation fact 86.45
d2fiya1290 FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId 86.43
d1k81a_36 Zinc-binding domain of translation initiation fact 86.39
d1tfia_50 Transcriptional factor SII, C-terminal domain {Hum 84.83
d2j9ub147 Vacuolar protein-sorting-associated protein 36, VP 84.51
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 84.29
d1brfa_53 Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 83.71
d1twfi272 RBP9 subunit of RNA polymerase II {Baker's yeast ( 83.51
d1wiia_85 Hypothetical UPF0222 protein MGC4549 {Mouse (Mus m 83.46
d1ryqa_67 putative DNA-directed RNA polymerase subunit E'' ( 82.7
d1vzia237 Desulfoferrodoxin N-terminal domain {Desulfoarculu 82.3
d1s24a_56 Two-iron rubredoxin {Pseudomonas oleovorans [TaxId 80.81
d1dxga_36 Desulforedoxin {Desulfovibrio gigas [TaxId: 879]} 80.72
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 80.61
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 80.1
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: YfgJ-like
family: YfgJ-like
domain: Hypothetical protein YfgJ
species: Escherichia coli [TaxId: 562]
Probab=96.18  E-value=0.00029  Score=40.62  Aligned_cols=28  Identities=14%  Similarity=0.396  Sum_probs=19.0

Q ss_pred             CCceeCCCCCCCCCCCCCCCCCCCCCccCccccccCCceecC
Q 033949           54 EPALFCNNCNLLFPSSLPPPPPPPPLVSDVSKCRFCDRLVEP   95 (107)
Q Consensus        54 ~~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~C~~CG~~i~~   95 (107)
                      +....|..|...+..              .-.||.|+.+++.
T Consensus        16 ~~~~~C~~C~~~~~~--------------~a~CPdC~~~Le~   43 (71)
T d2jnea1          16 NGHARCRSCGEFIEM--------------KALCPDCHQPLQV   43 (71)
T ss_dssp             TTEEEETTTCCEEEE--------------EEECTTTCSBCEE
T ss_pred             CCCEehhhhhhhhee--------------EEeCCccccHHHH
Confidence            357788888887743              3467777777654



>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2ayja1 g.41.8.7 (A:1-56) Ribosomal protein L40e {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pfva3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ey4e1 g.41.16.1 (E:4-55) Ribosome biogenesis protein Nop10 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2apob1 g.41.16.1 (B:403-457) Ribosome biogenesis protein Nop10 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1twfl_ g.41.9.2 (L:) RBP12 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1k3xa3 g.39.1.8 (A:223-262) Endonuclease VIII {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2zjrz1 g.41.8.5 (Z:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2gnra1 b.40.4.15 (A:8-144) Hypothetical protein SSO2064 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k82a3 g.39.1.8 (A:225-268) DNA repair protein MutM (Fpg) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qam01 g.41.8.5 (0:1-56) Ribosomal protein L32p {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r2za3 g.39.1.8 (A:229-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1tdza3 g.39.1.8 (A:225-271) DNA repair protein MutM (Fpg) {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tfia_ g.41.3.1 (A:) Transcriptional factor SII, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j9ub1 g.41.11.1 (B:115-161) Vacuolar protein-sorting-associated protein 36, VPS36 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wiia_ g.41.3.4 (A:) Hypothetical UPF0222 protein MGC4549 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ryqa_ g.41.9.3 (A:) putative DNA-directed RNA polymerase subunit E'' (RpoE2) {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vzia2 g.41.5.2 (A:1-37) Desulfoferrodoxin N-terminal domain {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]} Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Back     information, alignment and structure
>d1dxga_ g.41.5.2 (A:) Desulforedoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure