Citrus Sinensis ID: 034001

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MGKPGTVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPKGEHSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIEAHHPPKQA
cccccEEEEEEEEccccEEEEEEEEEEEEccccEEEEEEEcccHHcccEEEEEEEEEEEcccccEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccc
cccccEEEEEEEEcccccEEEEEEEEEEcccccEEEEEEEcccHHHHccEEEEEEEEEEcccccEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccc
MGKPGTVITWTYKHDGVTEIAKEIIEEIddeknsttFKVIEGHLLDKYNSFYVTvqaipkgehscLARWTIkyekksedvpdpqgIVNLAIEMtkgieahhppkqa
mgkpgtvitwtykhdgvtEIAKEIIEeiddeknsTTFKVIEGHLLDKYNSFYVTVQAIPKGEHSCLARWTIKyekksedvpdpqGIVNLAIEMTKGieahhppkqa
MGKPGTVITWTYKHDGVTeiakeiieeiddekNSTTFKVIEGHLLDKYNSFYVTVQAIPKGEHSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIEAHHPPKQA
*****TVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPKGEHSCLARWTIKYEK*********GIVNLAIE**************
**KPGTVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPKGEHSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIEAHHPP***
MGKPGTVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPKGEHSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIE********
**KPGTVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPKGEHSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIEAHHPPK**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKPGTVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPKGEHSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIEAHHPPKQA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query106 2.2.26 [Sep-21-2011]
Q9SSK5158 MLP-like protein 43 OS=Ar no no 0.933 0.626 0.44 4e-19
P85524150 Kirola OS=Actinidia delic N/A no 0.933 0.66 0.46 4e-19
Q9SSK7316 MLP-like protein 34 OS=Ar no no 0.933 0.313 0.43 1e-18
Q941R6171 MLP-like protein 31 OS=Ar no no 0.933 0.578 0.42 1e-17
Q9SSK9 335 MLP-like protein 28 OS=Ar no no 0.933 0.295 0.41 1e-17
Q9C7I7152 MLP-like protein 165 OS=A no no 0.933 0.651 0.346 8e-12
Q9C7I3151 MLP-like protein 168 OS=A no no 0.933 0.655 0.3 3e-09
Q9ZVF3151 MLP-like protein 328 OS=A no no 0.896 0.629 0.302 9e-09
Q93VR4155 MLP-like protein 423 OS=A no no 0.905 0.619 0.306 1e-07
Q06394159 Major latex protein 146 O N/A no 0.896 0.597 0.329 4e-07
>sp|Q9SSK5|MLP43_ARATH MLP-like protein 43 OS=Arabidopsis thaliana GN=MLP43 PE=2 SV=1 Back     alignment and function desciption
 Score = 93.2 bits (230), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 2   GKPGTVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPK- 60
           GK G+++ W Y HDG   + K  IE +D EKN  TFKV+EG L+++Y SF  T+Q  PK 
Sbjct: 54  GKVGSIVIWKYVHDGKLTVGKNKIEAVDPEKNLITFKVLEGDLMNEYKSFAFTLQVTPKQ 113

Query: 61  GEHSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIEAH 100
           GE   +A W ++YEK SE+V  P+ ++   +E++K I+ H
Sbjct: 114 GESGSIAHWHLEYEKISEEVAHPETLLQFCVEISKEIDEH 153

Arabidopsis thaliana (taxid: 3702)
>sp|P85524|KIRO_ACTDE Kirola OS=Actinidia deliciosa PE=1 SV=1 Back     alignment and function description
>sp|Q9SSK7|MLP34_ARATH MLP-like protein 34 OS=Arabidopsis thaliana GN=MLP34 PE=2 SV=1 Back     alignment and function description
>sp|Q941R6|MLP31_ARATH MLP-like protein 31 OS=Arabidopsis thaliana GN=MLP31 PE=1 SV=2 Back     alignment and function description
>sp|Q9SSK9|MLP28_ARATH MLP-like protein 28 OS=Arabidopsis thaliana GN=MLP28 PE=1 SV=1 Back     alignment and function description
>sp|Q9C7I7|ML165_ARATH MLP-like protein 165 OS=Arabidopsis thaliana GN=MLP165 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7I3|ML168_ARATH MLP-like protein 168 OS=Arabidopsis thaliana GN=MLP168 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZVF3|ML328_ARATH MLP-like protein 328 OS=Arabidopsis thaliana GN=MLP328 PE=1 SV=1 Back     alignment and function description
>sp|Q93VR4|ML423_ARATH MLP-like protein 423 OS=Arabidopsis thaliana GN=MLP423 PE=1 SV=1 Back     alignment and function description
>sp|Q06394|ML146_PAPSO Major latex protein 146 OS=Papaver somniferum GN=MLP146 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
224111490158 predicted protein [Populus trichocarpa] 0.990 0.664 0.596 3e-29
255587430121 Major latex protein, putative [Ricinus c 0.981 0.859 0.519 3e-24
255590991151 Major latex protein, putative [Ricinus c 0.933 0.655 0.5 1e-21
224140773120 predicted protein [Populus trichocarpa] 0.981 0.866 0.485 4e-21
255587428151 Major latex protein, putative [Ricinus c 0.933 0.655 0.47 8e-21
224140771153 predicted protein [Populus trichocarpa] 0.962 0.666 0.490 5e-20
13172242156 major latex-like protein [Prunus persica 0.990 0.673 0.452 5e-20
255587426151 Major latex protein, putative [Ricinus c 0.933 0.655 0.44 5e-20
449459826154 PREDICTED: MLP-like protein 34-like [Cuc 0.924 0.636 0.474 1e-19
297841837161 hypothetical protein ARALYDRAFT_894905 [ 0.915 0.602 0.448 9e-19
>gi|224111490|ref|XP_002315876.1| predicted protein [Populus trichocarpa] gi|222864916|gb|EEF02047.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  132 bits (331), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 65/109 (59%), Positives = 78/109 (71%), Gaps = 4/109 (3%)

Query: 2   GKPGTVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPKG 61
           GKPGTVI W+Y HDGV + AKE+IE IDDEK STTFKVIEG +  +Y +F + VQA PKG
Sbjct: 50  GKPGTVICWSYVHDGVAKTAKEVIEAIDDEKLSTTFKVIEGDITTEYKNFIIIVQATPKG 109

Query: 62  EHSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIEAHH----PPKQA 106
           E SCLA WT +YEK +E+VPDPQ ++   I  +K IE HH    P  QA
Sbjct: 110 EGSCLAHWTFEYEKLNENVPDPQTLLEFCIHCSKDIEDHHLTQLPTAQA 158

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255587430|ref|XP_002534268.1| Major latex protein, putative [Ricinus communis] gi|223525606|gb|EEF28117.1| Major latex protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255590991|ref|XP_002535412.1| Major latex protein, putative [Ricinus communis] gi|223523187|gb|EEF26971.1| Major latex protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224140773|ref|XP_002323753.1| predicted protein [Populus trichocarpa] gi|222866755|gb|EEF03886.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255587428|ref|XP_002534267.1| Major latex protein, putative [Ricinus communis] gi|223525605|gb|EEF28116.1| Major latex protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224140771|ref|XP_002323752.1| predicted protein [Populus trichocarpa] gi|118484286|gb|ABK94022.1| unknown [Populus trichocarpa] gi|222866754|gb|EEF03885.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|13172242|gb|AAK14060.1|AF239177_1 major latex-like protein [Prunus persica] Back     alignment and taxonomy information
>gi|255587426|ref|XP_002534266.1| Major latex protein, putative [Ricinus communis] gi|223525604|gb|EEF28115.1| Major latex protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449459826|ref|XP_004147647.1| PREDICTED: MLP-like protein 34-like [Cucumis sativus] gi|449528160|ref|XP_004171074.1| PREDICTED: MLP-like protein 28-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297841837|ref|XP_002888800.1| hypothetical protein ARALYDRAFT_894905 [Arabidopsis lyrata subsp. lyrata] gi|297334641|gb|EFH65059.1| hypothetical protein ARALYDRAFT_894905 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query106
TAIR|locus:2013950158 MLP43 "AT1G70890" [Arabidopsis 0.933 0.626 0.38 4.7e-16
TAIR|locus:2013920159 AT1G70880 "AT1G70880" [Arabido 0.943 0.628 0.386 1.3e-15
UNIPROTKB|P85524150 P85524 "Kirola" [Actinidia del 0.933 0.66 0.39 2e-15
TAIR|locus:2013970171 MLP31 "AT1G70840" [Arabidopsis 0.933 0.578 0.35 2.3e-14
TAIR|locus:2013930316 MLP34 "AT1G70850" [Arabidopsis 0.933 0.313 0.35 2.7e-14
TAIR|locus:2014000 335 MLP28 "AT1G70830" [Arabidopsis 0.933 0.295 0.35 4.6e-14
TAIR|locus:2143809166 AT5G28010 "AT5G28010" [Arabido 0.933 0.596 0.34 2.7e-13
TAIR|locus:2143804164 AT5G28000 "AT5G28000" [Arabido 0.933 0.603 0.31 1.7e-11
TAIR|locus:2013910139 AT1G70870 "AT1G70870" [Arabido 0.915 0.697 0.333 1.8e-09
TAIR|locus:2128439151 AT4G23670 [Arabidopsis thalian 0.886 0.622 0.288 2.2e-09
TAIR|locus:2013950 MLP43 "AT1G70890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 200 (75.5 bits), Expect = 4.7e-16, P = 4.7e-16
 Identities = 38/100 (38%), Positives = 57/100 (57%)

Query:     2 GKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYNSFYVTVQAIPK- 60
             GK G+++ W Y HDG                N  TFKV+EG L+++Y SF  T+Q  PK 
Sbjct:    54 GKVGSIVIWKYVHDGKLTVGKNKIEAVDPEKNLITFKVLEGDLMNEYKSFAFTLQVTPKQ 113

Query:    61 GEHSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIEAH 100
             GE   +A W ++YEK SE+V  P+ ++   +E++K I+ H
Sbjct:   114 GESGSIAHWHLEYEKISEEVAHPETLLQFCVEISKEIDEH 153
GO:0003674 "molecular_function" evidence=ND
GO:0006952 "defense response" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0030003 "cellular cation homeostasis" evidence=RCA
GO:0070838 "divalent metal ion transport" evidence=RCA
TAIR|locus:2013920 AT1G70880 "AT1G70880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P85524 P85524 "Kirola" [Actinidia deliciosa (taxid:3627)] Back     alignment and assigned GO terms
TAIR|locus:2013970 MLP31 "AT1G70840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013930 MLP34 "AT1G70850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2014000 MLP28 "AT1G70830" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143809 AT5G28010 "AT5G28010" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143804 AT5G28000 "AT5G28000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013910 AT1G70870 "AT1G70870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128439 AT4G23670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_X1001
hypothetical protein (158 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
pfam00407150 pfam00407, Bet_v_1, Pathogenesis-related protein B 1e-33
smart01037151 smart01037, Bet_v_1, Pathogenesis-related protein 2e-33
cd07816148 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domai 1e-26
cd07821140 cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 0.002
>gnl|CDD|215904 pfam00407, Bet_v_1, Pathogenesis-related protein Bet v I family Back     alignment and domain information 
 Score =  113 bits (285), Expect = 1e-33
 Identities = 41/100 (41%), Positives = 63/100 (63%)

Query: 2   GKPGTVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPKG 61
           G  G++  WTY  DG  ++ KE IE  D++  + T+ V+EG +L+ Y SF  T+Q IPK 
Sbjct: 48  GTGGSIKKWTYTEDGKPKVVKERIEADDEKNKTITYSVLEGDVLEDYKSFITTLQVIPKS 107

Query: 62  EHSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIEAHH 101
               + +WTI+YEK  +DVP+P+  +   +++TK IEAH 
Sbjct: 108 NGGSIVKWTIEYEKIGDDVPEPEKYLKFVVKLTKDIEAHL 147

This family is named after Bet v 1, the major birch pollen allergen. This protein belongs to family 10 of plant pathogenesis-related proteins (PR-10), cytoplasmic proteins of 15-17 kd that are wide-spread among dicotyledonous plants. In recent years, a number of diverse plant proteins with low sequence similarity to Bet v 1 was identified. A classification by sequence similarity yielded several subfamilies related to PR-10: - Pathogenesis-related proteins PR-10: These proteins were identified as major tree pollen allergens in birch and related species (hazel, alder), as plant food allergens expressed in high levels in fruits, vegetables and seeds (apple, celery, hazelnut), and as pathogenesis-related proteins whose expression is induced by pathogen infection, wounding, or abiotic stress. Hyp-1, an enzyme involved in the synthesis of the bioactive naphthodianthrone hypericin in St. John's wort (Hypericum perforatum) also belongs to this family. Most of these proteins were found in dicotyledonous plants. In addition, related sequences were identified in monocots and conifers. - Cytokinin-specific binding proteins: These legume proteins bind cytokinin plant hormones. - (S)-Norcoclaurine synthases are enzymes catalyzing the condensation of dopamine and 4-hydroxyphenylacetaldehyde to (S)-norcoclaurine, the first committed step in the biosynthesis of benzylisoquinoline alkaloids such as morphine. -Major latex proteins and ripening-related proteins are proteins of unknown biological function that were first discovered in the latex of opium poppy (Papaver somniferum) and later found to be upregulated during ripening of fruits such as strawberry and cucumber. The occurrence of Bet v 1-related proteins is confined to seed plants with the exception of a cytokinin-binding protein from the moss Physcomitrella patens. Length = 150
>gnl|CDD|198105 smart01037, Bet_v_1, Pathogenesis-related protein Bet v I family Back     alignment and domain information
>gnl|CDD|176858 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins Back     alignment and domain information
>gnl|CDD|176863 cd07821, PYR_PYL_RCAR_like, Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 106
PF00407151 Bet_v_1: Pathogenesis-related protein Bet v I fami 100.0
cd07816148 Bet_v1-like Ligand-binding bet_v_1 domain of major 99.96
cd07821140 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), 99.05
PF10604139 Polyketide_cyc2: Polyketide cyclase / dehydrase an 98.38
cd08866144 SRPBCC_11 Ligand-binding SRPBCC domain of an uncha 98.19
cd08865140 SRPBCC_10 Ligand-binding SRPBCC domain of an uncha 97.95
cd08861142 OtcD1_ARO-CYC_like N-terminal and C-terminal aroma 97.89
cd07813138 COQ10p_like Coenzyme Q-binding protein COQ10p and 97.81
cd07822141 SRPBCC_4 Ligand-binding SRPBCC domain of an unchar 97.66
PRK10724158 hypothetical protein; Provisional 97.53
cd07825144 SRPBCC_7 Ligand-binding SRPBCC domain of an unchar 97.5
cd07812141 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SR 97.45
cd07819140 SRPBCC_2 Ligand-binding SRPBCC domain of an unchar 97.36
cd07820137 SRPBCC_3 Ligand-binding SRPBCC domain of an unchar 97.05
cd07814139 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand- 97.0
cd07818150 SRPBCC_1 Ligand-binding SRPBCC domain of an unchar 96.97
cd08862138 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of 96.34
cd07817139 SRPBCC_8 Ligand-binding SRPBCC domain of an unchar 96.14
cd05018144 CoxG Carbon monoxide dehydrogenase subunit G (CoxG 95.74
cd07823146 SRPBCC_5 Ligand-binding SRPBCC domain of an unchar 94.89
cd08860146 TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom 94.67
cd07824146 SRPBCC_6 Ligand-binding SRPBCC domain of an unchar 94.19
COG2867146 Oligoketide cyclase/lipid transport protein [Lipid 94.16
PF03364130 Polyketide_cyc: Polyketide cyclase / dehydrase and 93.96
cd08899157 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligan 92.87
COG3427146 Carbon monoxide dehydrogenase subunit G, CoxG [Ene 92.55
PF06240140 COXG: Carbon monoxide dehydrogenase subunit G (Cox 91.91
cd08894139 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligan 90.09
>PF00407 Bet_v_1: Pathogenesis-related protein Bet v I family; InterPro: IPR000916 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms Back     alignment and domain information 
Probab=100.00  E-value=1.2e-32  Score=186.98  Aligned_cols=103  Identities=45%  Similarity=0.826  Sum_probs=97.2

Q ss_pred             CCCC-eEEEEEEecCCeeeEEEEEEEEEeCCCCEEEEEEEeCcccCceeEEEEEEEEEecCCCceEEEEEEEEEeCCCCC
Q 034001            2 GKPG-TVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPKGEHSCLARWTIKYEKKSEDV   80 (106)
Q Consensus         2 g~~G-svr~~~~~~~g~~~~~kErl~~~D~~~~~~~y~iieg~~~~~~~~~~~t~~v~p~~~g~s~v~W~~~ye~~~~~~   80 (106)
                      |++| |||.|+|.+++++.++||||+.+|+++++++|++|||+++..|++|+.++++.|.++|+|+++|+++|++.+++.
T Consensus        48 gg~gGSIk~~~f~~~~~~~~~Kekve~~D~~~~~~~y~viEGd~l~~~~~~~~~~~~~~~~~g~~v~k~t~~Ye~~~~~~  127 (151)
T PF00407_consen   48 GGPGGSIKKWTFGPGGPFKYVKEKVEAIDEENKTITYTVIEGDVLGDYKSFKSTIQKIPKGDGGCVVKWTIEYEKKGEDV  127 (151)
T ss_dssp             SSTTT-EEEEEEETTSSEEEEEEEEEEEETTTTEEEEEEEEETTGTTTEEEEEEEEEEEETTSCEEEEEEEEEEESSTSC
T ss_pred             CCCCCeEEEEEecCCCCcceeEEEEEeecCCCcEEEEEEEeccccccEEEEEEEEEecCCCCCceEEEEEEEEEecCCCC
Confidence            5666 999999998888889999999999999999999999999988999999999999999999999999999999999


Q ss_pred             CChhhHHHHHHHHHHHHHhcCCCC
Q 034001           81 PDPQGIVNLAIEMTKGIEAHHPPK  104 (106)
Q Consensus        81 ~~p~~~~~~~~~~~k~ie~yl~~~  104 (106)
                      |+|+.+++++..|+|+||+||++|
T Consensus       128 ~~p~~~~~~~~~~~K~ieayLlan  151 (151)
T PF00407_consen  128 PPPEKYLDFAVGMFKAIEAYLLAN  151 (151)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CCcHHHHHHHHHHHHHHHHHHhcC
Confidence            889999999999999999999987

A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation. The allergens in this family include allergens with the following designations: Aln g 1, Api g 1, Bet v 1, Car b 1, Cor a 1, Dau c 1, Mal d 1 and Pru a 1. Trees within the order Fagales possess particularly potent allergens, e.g. Bet v1, the major White Birch (Betula verrucosa) pollen antigen. Bet v1 is the main cause of type I allergies observed in early spring. Type I, or immunoglobulin E-mediated (IgE-mediated) allergies affect 1 in 5 people in Europe and North America. Commonly-observed symptoms are hay fever, dermatitis, asthma and, in severe cases, anaphylactic shock. First contact with these allergens results in sensitisation; subsequent contact produces a cross-linking reaction of IgE on mast cells and concomitant release of histamine. The inevitable symptoms of an allergic reaction ensue. Recent NMR analysis [] has confirmed earlier predictions of the protein structure and site of the major T-cell epitope []. The Bet v1 protein comprises 6 anti-parallel beta-strands and 3 alpha-helices. Four of the strands dominate the global fold, and 2 of the helices form a C-terminal amphipathic helical motif. This motif is believed to be the T-cell epitope. Other proteins belonging to this family include the major pollen allergens: Aln g I from Alnus glutinosa (Alder); Api G I from Apium graveolens (Celery); Car b I from Carpinus betulus (European hornbeam); Cor a I from Corylus avellana (European hazel); Mal d I from Malus domestica (Apple). The motif is also found in: the wound-induced protein AoPR1 from Asparagus officinalis (Garden asparagus); pathogenesis-related proteins from Phaseolus vulgaris (Kidney bean) and Petroselinum crispum (Parsley) (PR1-1 and PR1-3); the disease resistance response proteins, STH-2 and STH-21, from Solanum tuberosum (Potato) and pI49, pI176 and DRRG49-C from Pisum sativum (Garden pea); the P. sativum abscisic acid-responsive proteins ABR17 and ABR18; and the stress-induced protein SAM22 from Glycine max (Soybean). ; GO: 0006952 defense response, 0009607 response to biotic stimulus; PDB: 1IFV_A 4A8V_A 4A8U_A 2K7H_A 2QIM_A 3E85_A 1H2O_A 1E09_A 1QMR_A 1FSK_D ....
>cd07816 Bet_v1-like Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins Back     alignment and domain information
>cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins Back     alignment and domain information
>PF10604 Polyketide_cyc2: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR019587 This family contains polyketide cylcases/dehydrases which are enzymes involved in polyketide synthesis Back     alignment and domain information
>cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08865 SRPBCC_10 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains Back     alignment and domain information
>cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins Back     alignment and domain information
>cd07822 SRPBCC_4 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>PRK10724 hypothetical protein; Provisional Back     alignment and domain information
>cd07825 SRPBCC_7 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07812 SRPBCC START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC) ligand-binding domain superfamily Back     alignment and domain information
>cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07820 SRPBCC_3 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd07814 SRPBCC_CalC_Aha1-like Putative hydrophobic ligand-binding SRPBCC domain of Micromonospora echinospora CalC, human Aha1, and related proteins Back     alignment and domain information
>cd07818 SRPBCC_1 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08862 SRPBCC_Smu440-like Ligand-binding SRPBCC domain of Streptococcus mutans Smu Back     alignment and domain information
>cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) Back     alignment and domain information
>cd07823 SRPBCC_5 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains Back     alignment and domain information
>cd07824 SRPBCC_6 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>COG2867 Oligoketide cyclase/lipid transport protein [Lipid metabolism] Back     alignment and domain information
>PF03364 Polyketide_cyc: Polyketide cyclase / dehydrase and lipid transport; InterPro: IPR005031 Members of this family of enzymes from Streptomyces spp Back     alignment and domain information
>cd08899 SRPBCC_CalC_Aha1-like_6 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information
>COG3427 Carbon monoxide dehydrogenase subunit G, CoxG [Energy production and conversion] Back     alignment and domain information
>PF06240 COXG: Carbon monoxide dehydrogenase subunit G (CoxG); InterPro: IPR010419 The CO dehydrogenase structural genes coxMSL are flanked by nine accessory genes arranged as the cox gene cluster Back     alignment and domain information
>cd08894 SRPBCC_CalC_Aha1-like_1 Putative hydrophobic ligand-binding SRPBCC domain of an uncharacterized subgroup of CalC- and Aha1-like proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
2i9y_A166 Solution Structure Of Arabidopsis Thaliana Protein 5e-14
>pdb|2I9Y|A Chain A, Solution Structure Of Arabidopsis Thaliana Protein At1g70830, A Member Of The Major Latex Protein Family Length = 166 Back     alignment and structure 
Iteration: 1

 Score = 72.4 bits (176), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
Query: 2   GKPGTVITWTYKHDGVTXXXXXXXXXXXXXXNSTTFKVIEGHLLDKYNSFYVTVQAIPK- 60
           G  G+++ W Y HDG                N  TF+VIEG L+ +Y SF +T+Q  PK 
Sbjct: 62  GTVGSIVFWNYVHDGEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKP 121
Query: 61  GEHSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIEAH 100
           G    +  W ++YEK SE+V  P+ ++   +E++K I+ H
Sbjct: 122 GGPGSIVHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEH 161

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query106
2i9y_A166 Major latex protein-like protein 28 or MLP-like pr 5e-28
1vjh_A122 BET V I allergen family; structural genomics, cent 1e-25
2flh_A155 Cytokinin-specific binding protein; zeatin, pathog 9e-21
2vq5_A201 S-norcoclaurine synthase; lyase, S- norcoclaurine 2e-20
1e09_A159 PRU AV 1; allergen, major cherry allergen, pathoge 3e-19
2qim_A158 PR10.2B; trans-zeatin, cytokinin, plant hormones, 8e-19
1tw0_A157 Pathogenesis-related class 10 protein SPE-16; seve 1e-18
2vjg_A154 Major allergen DAU C 1; major carrot allergen, pat 1e-18
4a8u_A159 Major pollen allergen BET V 1-J; PR-10 protein; 1. 2e-18
3rws_A168 MTN13 protein; zeatin, cytokinin, hormone, lucerne 5e-18
1icx_A155 Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, 1e-17
3ie5_A165 Phenolic oxidative coupling protein HYP-1; hyperic 1e-16
3kl1_A190 PYL2, putative uncharacterized protein AT2G26040; 8e-11
3k3k_A211 Abscisic acid receptor PYR1; ABA receptor, plant h 7e-08
3qrz_A223 Abscisic acid receptor PYL5; crystal, hormone rece 1e-07
3jrs_A208 PYL1, putative uncharacterized protein AT5G46790; 3e-07
3rt2_A183 Abscisic acid receptor PYL10; ABA-independent PP2C 6e-06
2le1_A151 Uncharacterized protein; structural genomics, nort 1e-04
3oji_A189 Abscisic acid receptor PYL3; crystal, PP2C, pyraba 6e-04
>2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 166 Back     alignment and structure
 Score = 98.9 bits (246), Expect = 5e-28
 Identities = 40/100 (40%), Positives = 64/100 (64%), Gaps = 1/100 (1%)

Query: 2   GKPGTVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPKG 61
           G  G+++ W Y HDG  ++AKE IE ++ +KN  TF+VIEG L+ +Y SF +T+Q  PK 
Sbjct: 62  GTVGSIVFWNYVHDGEAKVAKERIEAVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKP 121

Query: 62  E-HSCLARWTIKYEKKSEDVPDPQGIVNLAIEMTKGIEAH 100
                +  W ++YEK SE+V  P+ ++   +E++K I+ H
Sbjct: 122 GGPGSIVHWHLEYEKISEEVAHPETLLQFCVEVSKEIDEH 161
>1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A Length = 122 Back     alignment and structure
>2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Length = 155 Back     alignment and structure
>2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Length = 201 Back     alignment and structure
>1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A Length = 159 Back     alignment and structure
>2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Length = 158 Back     alignment and structure
>1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Length = 157 Back     alignment and structure
>4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A Length = 159 Back     alignment and structure
>1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Length = 155 Back     alignment and structure
>3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} Length = 165 Back     alignment and structure
>3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* Length = 190 Back     alignment and structure
>3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* Length = 211 Back     alignment and structure
>3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} Length = 208 Back     alignment and structure
>3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C Length = 183 Back     alignment and structure
>2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} Length = 151 Back     alignment and structure
>3oji_A Abscisic acid receptor PYL3; crystal, PP2C, pyrabactin, HOR receptor; HET: PYV; 1.84A {Arabidopsis thaliana} PDB: 3klx_A Length = 189 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
4a8u_A159 Major pollen allergen BET V 1-J; PR-10 protein; 1. 100.0
2wql_A154 Major allergen DAU C 1; pathogenesis-related prote 100.0
2vjg_A154 Major allergen DAU C 1; major carrot allergen, pat 100.0
3ie5_A165 Phenolic oxidative coupling protein HYP-1; hyperic 100.0
1tw0_A157 Pathogenesis-related class 10 protein SPE-16; seve 100.0
3rws_A168 MTN13 protein; zeatin, cytokinin, hormone, lucerne 100.0
2qim_A158 PR10.2B; trans-zeatin, cytokinin, plant hormones, 100.0
1icx_A155 Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, 99.98
2i9y_A166 Major latex protein-like protein 28 or MLP-like pr 99.98
1e09_A159 PRU AV 1; allergen, major cherry allergen, pathoge 99.97
2flh_A155 Cytokinin-specific binding protein; zeatin, pathog 99.97
2vq5_A201 S-norcoclaurine synthase; lyase, S- norcoclaurine 99.97
1vjh_A122 BET V I allergen family; structural genomics, cent 99.95
3jrs_A208 PYL1, putative uncharacterized protein AT5G46790; 99.85
3rt2_A183 Abscisic acid receptor PYL10; ABA-independent PP2C 99.84
3kl1_A190 PYL2, putative uncharacterized protein AT2G26040; 99.83
3k3k_A211 Abscisic acid receptor PYR1; ABA receptor, plant h 99.81
3oqu_A205 Abscisic acid receptor PYL9; RCAR1, hormone recept 99.78
3f08_A146 Uncharacterized protein Q6HG14; NESG Q6HG14_bachk 99.77
3p51_A160 Uncharacterized protein; structural genomics, PSI- 99.75
3qrz_A223 Abscisic acid receptor PYL5; crystal, hormone rece 99.72
3oji_A189 Abscisic acid receptor PYL3; crystal, PP2C, pyraba 99.72
2le1_A151 Uncharacterized protein; structural genomics, nort 99.55
2d4r_A147 Hypothetical protein TTHA0849; start domain, struc 98.39
3tl1_A159 WHIE ORF VI, polyketide cyclase; helix-GRIP fold, 98.35
3tfz_A172 Cyclase; helix-GRIP, BET V1-like superfamily, bios 98.29
3tvq_A169 Multifunctional cyclase-dehydratase-3-O-methyl TR 98.28
3p9v_A161 Uncharacterized protein; structural genomics, PSI- 97.94
1t17_A148 Conserved hypothetical protein; beta-alpha-beta-BE 97.77
3ijt_A155 SMU.440, putative uncharacterized protein; hypothe 97.73
2pcs_A162 Conserved protein; structural genomics, unknown fu 96.77
3ggn_A155 Uncharacterized protein DR_A0006; structural genom 96.67
2ns9_A157 Hypothetical protein APE2225; uncharacterized cons 95.97
2leq_A146 Uncharacterized protein; start domains, structural 95.53
1xn6_A143 Hypothetical protein BC4709; structural genomics, 95.03
1z94_A147 Conserved hypothetical protein; NESG, CV1439, stru 94.3
1xuv_A178 Hypothetical protein MM0500; alpha-beta protein, n 93.77
2il5_A171 Hypothetical protein; structural genomics, APC2365 92.65
2lcg_A142 Uncharacterized protein; start domain, structural 91.95
3put_A166 Hypothetical conserved protein; structural genomic 88.57
3rd6_A161 MLL3558 protein; structural genomics, PSI-biology, 86.72
2l8o_A144 Uncharacterized protein; mixed alpha-beta protein, 86.47
3q64_A162 MLL3774 protein; structural genomics, PSI-biology, 84.42
3uid_A168 Putative uncharacterized protein; SRPBCC superfami 83.53
2lak_A160 AHSA1-like protein RHE_CH02687; NESG, structural g 82.25
3q6a_A135 Uncharacterized protein; structural genomics, PSI- 82.17
>4a8u_A Major pollen allergen BET V 1-J; PR-10 protein; 1.16A {Betula pendula} PDB: 4a8v_A* 4a87_A* 4a81_A* 4a80_A* 4a83_A* 4a86_A* 4a85_A* 4a88_A 4a8g_A* 1b6f_A 1btv_A 1bv1_A 1fsk_A 4a84_A* 1llt_A 1fm4_A* 3k78_A 1qmr_A Back     alignment and structure
Probab=100.00  E-value=7.1e-34  Score=193.21  Aligned_cols=105  Identities=16%  Similarity=0.299  Sum_probs=96.5

Q ss_pred             CCCCeEEEEEEecCCeeeEEEEEEEEEeCCCCEEEEEEEeCccc-CceeEEEEEEEEEecCCCceEEEEEEEEEeCCCCC
Q 034001            2 GKPGTVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLL-DKYNSFYVTVQAIPKGEHSCLARWTIKYEKKSEDV   80 (106)
Q Consensus         2 g~~Gsvr~~~~~~~g~~~~~kErl~~~D~~~~~~~y~iieg~~~-~~~~~~~~t~~v~p~~~g~s~v~W~~~ye~~~~~~   80 (106)
                      |++||||+|+|.++++..++||||+++|+++|+++|+++||+++ ..|++|+++++|.|.++|+|+++|+++|++.++..
T Consensus        48 gg~Gsir~~~~~~g~~~~~~kErl~~iD~~~~~~~y~iiegd~l~~~~~~y~~ti~v~p~~~ggs~v~wt~~y~~~~~~~  127 (159)
T 4a8u_A           48 GGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKYHTKGDHE  127 (159)
T ss_dssp             SSTTCEEEEECCTTSSCSEEEEEEEEEETTTTEEEEEEEEETTCBTTEEEEEEEEEEEECTTSCEEEEEEEEEEESSSCC
T ss_pred             CCCceEEEEEEecCCCccEEEEEEEEEccccCEEEEEEeeCCCCccceEEEEEEEEEEECCCCceEEEEEEEEEECCCCc
Confidence            58999999999977777799999999999999999999999987 56999999999999988899999999999999988


Q ss_pred             CChhhH---HHHHHHHHHHHHhcCCCCCC
Q 034001           81 PDPQGI---VNLAIEMTKGIEAHHPPKQA  106 (106)
Q Consensus        81 ~~p~~~---~~~~~~~~k~ie~yl~~~~~  106 (106)
                      ++|+.+   ++.+.+|+|+||+||++||+
T Consensus       128 ~~~~~~k~~~~~~~~~~k~ie~yll~np~  156 (159)
T 4a8u_A          128 VKAEQIKASKEMGETLLRAVESYLLAHSD  156 (159)
T ss_dssp             C-CHHHHHHHHHHHHHHHHHHHHHHHCTT
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHhhChh
Confidence            888765   78899999999999999996
>2wql_A Major allergen DAU C 1; pathogenesis-related protein, plant defense; HET: P4C; 2.70A {Daucus carota} PDB: 2bk0_A Back     alignment and structure
>3ie5_A Phenolic oxidative coupling protein HYP-1; hypericin, ST JOHN'S WORT, depression, allergy, PR-10 protein, cytokinin, plant hormones; HET: PGE PG4 PE8 1PE; 1.69A {Hypericum perforatum} SCOP: d.129.3.0 Back     alignment and structure
>1tw0_A Pathogenesis-related class 10 protein SPE-16; seven antiparallel beta-sheet, plant protein; 2.20A {Pachyrhizus erosus} SCOP: d.129.3.1 PDB: 1txc_A* Back     alignment and structure
>2qim_A PR10.2B; trans-zeatin, cytokinin, plant hormones, plant protein, PR-1 protein, pathogenesis-related protein, allergen; HET: ZEA; 1.35A {Lupinus luteus} PDB: 3e85_A* 1xdf_A* 2k7h_A Back     alignment and structure
>1icx_A Protein LLR18A, LLPR10.1A; 7-stranded beta sheet, C-terminal helix, allergen; 1.95A {Lupinus luteus} SCOP: d.129.3.1 PDB: 1ifv_A Back     alignment and structure
>2i9y_A Major latex protein-like protein 28 or MLP-like protein 28; AT1G70830, BET V1-like, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1e09_A PRU AV 1; allergen, major cherry allergen, pathogenesis-related protein, heteronuclear structure; NMR {Prunus avium} SCOP: d.129.3.1 PDB: 1h2o_A 2lpx_A Back     alignment and structure
>2flh_A Cytokinin-specific binding protein; zeatin, pathogenesis-related proteins, multiple- ligand binding, plant protein; HET: ZEA; 1.20A {Vigna radiata} PDB: 3c0v_A* Back     alignment and structure
>2vq5_A S-norcoclaurine synthase; lyase, S- norcoclaurine biosynthesis, dopamine, hydroxybenzaldehyde; HET: MSE LDP HBA; 2.09A {Thalictrum flavum} PDB: 2vne_A* Back     alignment and structure
>1vjh_A BET V I allergen family; structural genomics, center for eukaryotic structural genomics, protein structure initiative, CESG, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.129.3.1 PDB: 2q3q_A Back     alignment and structure
>3jrs_A PYL1, putative uncharacterized protein AT5G46790; plant hormone receptor, abscisic acid, hormone recepto; HET: A8S; 2.05A {Arabidopsis thaliana} Back     alignment and structure
>3rt2_A Abscisic acid receptor PYL10; ABA-independent PP2C inhibitor, PP2CS, hydrolase inhibitor; 1.50A {Arabidopsis thaliana} PDB: 3r6p_A* 3qtj_A* 3uqh_A 3rt0_C Back     alignment and structure
>3kl1_A PYL2, putative uncharacterized protein AT2G26040; abscisic acid receptor, crystal, high resolution, PP2C, HORM receptor; 1.55A {Arabidopsis thaliana} PDB: 3kdi_A* 3kdh_A 3nr4_A* 3ns2_A* 3nj0_A* 3nj1_A* 3nmh_A* 3kaz_A 3kb0_A* 3kb3_A* 3ujl_A* 3nmp_A* 3nmt_A* 3nmv_A* Back     alignment and structure
>3k3k_A Abscisic acid receptor PYR1; ABA receptor, plant hormone receptor, A sensor, drought tolerance, plant development; HET: A8S; 1.70A {Arabidopsis thaliana} PDB: 3njo_A* 3qn1_A* 3k90_A* 3zvu_A* 3jrq_B* 3kdj_A* 3nef_A* 3neg_A* 3nmn_A* 3kay_A* Back     alignment and structure
>3oqu_A Abscisic acid receptor PYL9; RCAR1, hormone receptor; HET: A8S; 2.68A {Arabidopsis thaliana} Back     alignment and structure
>3f08_A Uncharacterized protein Q6HG14; NESG Q6HG14_bachk Q6HG14 BUR153, structural genomics, PSI-2; 2.20A {Bacillus thuringiensis serovar konkukiorganism_taxid} SCOP: d.129.3.8 PDB: 3cnw_A Back     alignment and structure
>3p51_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 2.06A {Nitrosospira multiformis} Back     alignment and structure
>3oji_A Abscisic acid receptor PYL3; crystal, PP2C, pyrabactin, HOR receptor; HET: PYV; 1.84A {Arabidopsis thaliana} PDB: 4ds8_A* 3klx_A* 4dsb_A* 4dsc_A* Back     alignment and structure
>2le1_A Uncharacterized protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, unknown function; NMR {Thermobifida fusca} Back     alignment and structure
>2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 Back     alignment and structure
>3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A Back     alignment and structure
>3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} Back     alignment and structure
>3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A Back     alignment and structure
>3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} Back     alignment and structure
>1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 Back     alignment and structure
>3ijt_A SMU.440, putative uncharacterized protein; hypothetical protein, unknown function; 2.38A {Streptococcus mutans} SCOP: d.129.3.9 PDB: 2b79_A Back     alignment and structure
>2pcs_A Conserved protein; structural genomics, unknown function, ligand binding, PSI-2 structure initiative; HET: UNL; 2.40A {Geobacillus kaustophilus} SCOP: d.129.3.10 Back     alignment and structure
>3ggn_A Uncharacterized protein DR_A0006; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Deinococcus radiodurans R1} PDB: 2kcz_A Back     alignment and structure
>2ns9_A Hypothetical protein APE2225; uncharacterized conserved protein, structural genomics, PSI, structure initiative; 1.80A {Aeropyrum pernix} SCOP: d.129.3.10 Back     alignment and structure
>2leq_A Uncharacterized protein; start domains, structural genomics, PSI-biology, protein STR initiative; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>1xn6_A Hypothetical protein BC4709; structural genomics, protein structure initiative, PSI, NESG target protein BCR68, alpha + beta; NMR {Bacillus cereus} SCOP: d.129.3.5 Back     alignment and structure
>1z94_A Conserved hypothetical protein; NESG, CV1439, structural genomics, PSI structure initiative; 2.10A {Chromobacterium violaceum} SCOP: d.129.3.5 Back     alignment and structure
>1xuv_A Hypothetical protein MM0500; alpha-beta protein, northeast structural genomics consortium, NESG, structural genomics; 2.10A {Methanosarcina mazei GO1} SCOP: d.129.3.5 Back     alignment and structure
>2il5_A Hypothetical protein; structural genomics, APC23650, PSI-2, structure initiative; 2.30A {Staphylococcus aureus subsp} SCOP: d.129.3.5 Back     alignment and structure
>2lcg_A Uncharacterized protein; start domain, structural genomics, northeast structural GENO consortium, NESG, unknown function, AHSA1; NMR {Ralstonia metallidurans} Back     alignment and structure
>3put_A Hypothetical conserved protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.83A {Rhizobium etli cfn 42} PDB: 3otl_A* Back     alignment and structure
>3rd6_A MLL3558 protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 2.80A {Mesorhizobium loti} Back     alignment and structure
>2l8o_A Uncharacterized protein; mixed alpha-beta protein, PSI-biology, structural genomics, structure initiative; NMR {Cytophaga hutchinsonii} Back     alignment and structure
>3q64_A MLL3774 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.50A {Mesorhizobium loti} Back     alignment and structure
>3uid_A Putative uncharacterized protein; SRPBCC superfamily, beta sandwich, function, structural genomics, TB structural genomics conso TBSGC; 1.57A {Mycobacterium smegmatis} SCOP: d.129.3.0 Back     alignment and structure
>2lak_A AHSA1-like protein RHE_CH02687; NESG, structural genomics, northeast structural genomics CON PSI-biology, structure genomics, unknown function; NMR {Rhizobium etli} Back     alignment and structure
>3q6a_A Uncharacterized protein; structural genomics, PSI-biology; 1.80A {Staphylococcus saprophyticus subsp} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 106
d1vjha_120 d.129.3.1 (A:) Hypothetical protein At1G24000 {Tha 1e-25
d2bk0a1153 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery 6e-24
d1e09a_159 d.129.3.1 (A:) Major tree pollen allergen {Sweet c 2e-22
d1fm4a_159 d.129.3.1 (A:) Major tree pollen allergen {Europea 2e-21
d1xdfa1157 d.129.3.1 (A:1-157) Plant pathogenesis-related pro 2e-21
d1icxa_155 d.129.3.1 (A:) Plant pathogenesis-related protein 7e-20
d1txca1147 d.129.3.1 (A:1-147) Plant pathogenesis-related pro 1e-16
>d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 120 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: Pathogenesis-related protein 10 (PR10)-like
domain: Hypothetical protein At1G24000
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 90.2 bits (224), Expect = 1e-25
 Identities = 17/81 (20%), Positives = 36/81 (44%), Gaps = 1/81 (1%)

Query: 21  AKEIIEEIDDEKNSTTFKVIEGHLLDKYNSFYVTVQAIPKGEHS-CLARWTIKYEKKSED 79
            K  IE +D  K + T ++    +   + +   ++   P G        WT  +EK  +D
Sbjct: 36  GKTEIEAVDLVKKTMTIQMSGSEIQKYFKTLKGSIAVTPIGVGDGSHVVWTFHFEKVHKD 95

Query: 80  VPDPQGIVNLAIEMTKGIEAH 100
           + DP  I++ +++  K ++  
Sbjct: 96  IDDPHSIIDESVKYFKKLDEA 116
>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Length = 153 Back     information, alignment and structure
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Length = 159 Back     information, alignment and structure
>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Length = 159 Back     information, alignment and structure
>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Length = 157 Back     information, alignment and structure
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Length = 155 Back     information, alignment and structure
>d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query106
d1xdfa1157 Plant pathogenesis-related protein PR10 {Yellow lu 100.0
d1fm4a_159 Major tree pollen allergen {European white birch ( 100.0
d1icxa_155 Plant pathogenesis-related protein PR10 {Yellow lu 100.0
d1e09a_159 Major tree pollen allergen {Sweet cherry (Prunus a 100.0
d2bk0a1153 Major allergen api g 1 {Celery (Apium graveolens) 100.0
d1txca1147 Plant pathogenesis-related protein PR10 {Jicama (P 99.96
d1vjha_120 Hypothetical protein At1G24000 {Thale cress (Arabi 99.96
d3cnwa1138 Uncharacterized protein XoxI {Bacillus cereus [Tax 99.64
d2d4ra1146 Hypothetical protein TTHA0849 {Thermus thermophilu 98.16
d2b79a1137 Hypothetical protein SMU440 {Streptococcus mutans 97.44
d2rera1155 Multifunctional enzyme TcmN, cyclase/aromatase dom 97.13
d1t17a_148 Hypothetical protein CC1736 {Caulobacter crescentu 96.18
d1xuva_163 Hypothetical protein MM0500 {Methanosarcina mazei 93.98
d2ns9a1147 Hypothetical protein APE2225 {Aeropyrum pernix [Ta 91.1
d3elia1143 Uncharacterized protein SPO3351 {Silicibacter pome 86.29
d2qpva1133 Uncharacterized protein Atu1531 {Agrobacterium tum 84.85
d2il5a1164 Hypothetical protein SA2116 {Staphylococcus aureus 83.06
d2pcsa1147 Hypothetical protein GKP20 {Geobacillus kaustophil 81.64
>d1xdfa1 d.129.3.1 (A:1-157) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: TBP-like
superfamily: Bet v1-like
family: Pathogenesis-related protein 10 (PR10)-like
domain: Plant pathogenesis-related protein PR10
species: Yellow lupine (Lupinus luteus) [TaxId: 3873]

Probab=100.00  E-value=2.4e-35  Score=198.61  Aligned_cols=105  Identities=21%  Similarity=0.285  Sum_probs=98.3

Q ss_pred             CCCCeEEEEEEecCCeeeEEEEEEEEEeCCCCEEEEEEEeCccc-CceeEEEEEEEEEecCCCceEEEEEEEEEeCCCCC
Q 034001            2 GKPGTVITWTYKHDGVTEIAKEIIEEIDDEKNSTTFKVIEGHLL-DKYNSFYVTVQAIPKGEHSCLARWTIKYEKKSEDV   80 (106)
Q Consensus         2 g~~Gsvr~~~~~~~g~~~~~kErl~~~D~~~~~~~y~iieg~~~-~~~~~~~~t~~v~p~~~g~s~v~W~~~ye~~~~~~   80 (106)
                      |++||||.|+|.++++..++||||+++|+++++++|++|||+.+ +.|++|+.++++.|.++|||+++|+++|+++++..
T Consensus        47 G~~GsIr~~~~~~g~~~~~~Kerie~vD~e~~~~~y~viEGd~l~~~~~s~~~~~k~~~~~~ggsv~k~t~eYe~~~~~~  126 (157)
T d1xdfa1          47 GGPGTIKKLTLIEGGETKYVLHKIEAVDEANLRYNYSIVGGVGLPDTIEKISFETKLVEGANGGSIGKVTIKIETKGDAQ  126 (157)
T ss_dssp             SSTTCEEEEEEEETTEEEEEEEEEEEEEGGGTEEEEEEESSTTSCTTEEEEEEEEEEEECTTSSEEEEEEEEEEESSSSC
T ss_pred             CCCCcEEEEEEcCCCccEEEEEEEEEEechhcEEEEEEEecccccccEEEEEEEEEEEcCCCCceEEEEEEEEEECCCCC
Confidence            79999999999988888899999999999999999999999976 67999999999999999999999999999999998


Q ss_pred             CChhhH---HHHHHHHHHHHHhcCCCCCC
Q 034001           81 PDPQGI---VNLAIEMTKGIEAHHPPKQA  106 (106)
Q Consensus        81 ~~p~~~---~~~~~~~~k~ie~yl~~~~~  106 (106)
                      ++|+.+   ++.+..|+|+||+||+|||+
T Consensus       127 ~~~e~ik~~~e~~~~~~K~iEaYLlanpd  155 (157)
T d1xdfa1         127 PNEEEGKAAKARGDAFFKAIENYLSAHPE  155 (157)
T ss_dssp             CCHHHHHHHHHHHHTTTHHHHHHHHTSGG
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHhhCCC
Confidence            888765   56688999999999999996
>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l [TaxId: 3505]} Back     information, alignment and structure
>d1icxa_ d.129.3.1 (A:) Plant pathogenesis-related protein PR10 {Yellow lupine (Lupinus luteus) [TaxId: 3873]} Back     information, alignment and structure
>d1e09a_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]} Back     information, alignment and structure
>d2bk0a1 d.129.3.1 (A:2-154) Major allergen api g 1 {Celery (Apium graveolens) [TaxId: 4045]} Back     information, alignment and structure
>d1txca1 d.129.3.1 (A:1-147) Plant pathogenesis-related protein PR10 {Jicama (Pachyrhizus erosus), SPE-16 [TaxId: 109171]} Back     information, alignment and structure
>d1vjha_ d.129.3.1 (A:) Hypothetical protein At1G24000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3cnwa1 d.129.3.8 (A:3-140) Uncharacterized protein XoxI {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b79a1 d.129.3.9 (A:1-137) Hypothetical protein SMU440 {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Back     information, alignment and structure
>d1t17a_ d.129.3.6 (A:) Hypothetical protein CC1736 {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1xuva_ d.129.3.5 (A:) Hypothetical protein MM0500 {Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d2ns9a1 d.129.3.10 (A:10-156) Hypothetical protein APE2225 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d3elia1 d.129.3.5 (A:2-144) Uncharacterized protein SPO3351 {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
>d2qpva1 d.129.3.8 (A:1-133) Uncharacterized protein Atu1531 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2pcsa1 d.129.3.10 (A:1-147) Hypothetical protein GKP20 {Geobacillus kaustophilus [TaxId: 1462]} Back     information, alignment and structure