Citrus Sinensis ID: 034049

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTGNLKAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKVEYVSLLFYLRYCVC
cccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHcccccccc
cHcccHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHccccccccc
MYSEDLCKRLSSELSGKLEMAVLLWMhdpagrdaVVVRNSLTTGNLKAATEVICSRTPSQIQLIRQHYHSkfgvhleddikrhtsgdhekVEYVSLLFYLRYCVC
MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTGNLKAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKrhtsgdhekveyvsllfYLRYCVC
MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTGNLKAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKVEYVSLLFYLRYCVC
****************KLEMAVLLWMHDPAGRDAVVVRNSLTTGNLKAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKVEYVSLLFYLRYCV*
MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTGNLKAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKVEYVSLLFYLRYCVC
MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTGNLKAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKVEYVSLLFYLRYCVC
*YSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTGNLKAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKVEYVSLLFYLRYCVC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTGNLKAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKVEYVSLLFYLRYCVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query105 2.2.26 [Sep-21-2011]
Q9C9X3 316 Annexin D5 OS=Arabidopsis yes no 0.904 0.300 0.475 2e-17
Q9SYT0 317 Annexin D1 OS=Arabidopsis no no 0.952 0.315 0.407 3e-14
Q9LX07 316 Annexin D7 OS=Arabidopsis no no 0.952 0.316 0.388 7e-13
Q9XEE2 317 Annexin D2 OS=Arabidopsis no no 0.952 0.315 0.368 1e-12
Q9LX08 318 Annexin D6 OS=Arabidopsis no no 0.952 0.314 0.388 1e-12
P51074 314 Annexin-like protein RJ4 N/A no 0.961 0.321 0.375 6e-12
P20072 463 Annexin A7 OS=Bos taurus yes no 0.866 0.196 0.376 4e-10
Q4R5L5 488 Annexin A7 OS=Macaca fasc N/A no 0.857 0.184 0.369 7e-10
Q5R1W0 320 Annexin A5 OS=Pan troglod no no 0.914 0.3 0.357 1e-09
P08758 320 Annexin A5 OS=Homo sapien yes no 0.914 0.3 0.357 1e-09
>sp|Q9C9X3|ANXD5_ARATH Annexin D5 OS=Arabidopsis thaliana GN=ANN5 PE=2 SV=2 Back     alignment and function desciption
 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 68/101 (67%), Gaps = 6/101 (5%)

Query: 2   YSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSL--TTGNLKAATEVICSRTPS 59
           +S+DL KRL SEL G L+ AVLLWM +   RDA +++ SL     + KA  E+IC+R+ S
Sbjct: 57  FSDDLRKRLHSELHGHLKKAVLLWMPEAVERDASILKRSLRGAVTDHKAIAEIICTRSGS 116

Query: 60  QIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKVEYVSLLFYL 100
           Q++ I+Q Y + FGV LE+DI+   SG+H++V    LL YL
Sbjct: 117 QLRQIKQVYSNTFGVKLEEDIESEASGNHKRV----LLAYL 153

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SYT0|ANXD1_ARATH Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LX07|ANXD7_ARATH Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1 Back     alignment and function description
>sp|Q9XEE2|ANXD2_ARATH Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LX08|ANXD6_ARATH Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1 Back     alignment and function description
>sp|P51074|ANX4_FRAAN Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2 Back     alignment and function description
>sp|P20072|ANXA7_BOVIN Annexin A7 OS=Bos taurus GN=ANXA7 PE=1 SV=2 Back     alignment and function description
>sp|Q4R5L5|ANXA7_MACFA Annexin A7 OS=Macaca fascicularis GN=ANXA7 PE=2 SV=1 Back     alignment and function description
>sp|Q5R1W0|ANXA5_PANTR Annexin A5 OS=Pan troglodytes GN=ANXA5 PE=2 SV=3 Back     alignment and function description
>sp|P08758|ANXA5_HUMAN Annexin A5 OS=Homo sapiens GN=ANXA5 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
255588168 248 annexin, putative [Ricinus communis] gi| 0.866 0.366 0.709 8e-32
356524724 315 PREDICTED: annexin D5-like [Glycine max] 0.866 0.288 0.717 1e-31
255648073 315 unknown [Glycine max] 0.866 0.288 0.706 6e-31
224125894 316 predicted protein [Populus trichocarpa] 0.942 0.313 0.650 1e-30
357521715 315 Annexin-like protein [Medicago truncatul 0.895 0.298 0.659 2e-30
217071700193 unknown [Medicago truncatula] 0.895 0.487 0.659 4e-30
388496086 315 unknown [Medicago truncatula] 0.895 0.298 0.659 4e-30
356531118 322 PREDICTED: LOW QUALITY PROTEIN: annexin 0.914 0.298 0.660 6e-30
255635417 322 unknown [Glycine max] 0.914 0.298 0.660 7e-30
255646485 317 unknown [Glycine max] 0.914 0.302 0.650 6e-29
>gi|255588168|ref|XP_002534522.1| annexin, putative [Ricinus communis] gi|223525120|gb|EEF27861.1| annexin, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 66/93 (70%), Positives = 79/93 (84%), Gaps = 2/93 (2%)

Query: 1   MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSL--TTGNLKAATEVICSRTP 58
           +YSEDL KRLSSELSGKLE+A+LLWMHD  GRDA++VR  L     N++AATEVICSRTP
Sbjct: 10  IYSEDLLKRLSSELSGKLEIAILLWMHDLPGRDAIIVRQGLLPDISNIEAATEVICSRTP 69

Query: 59  SQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKV 91
           SQIQ+ +QHYH+KFGVHLE DI  +TSGDH+K+
Sbjct: 70  SQIQVFKQHYHAKFGVHLEHDINLYTSGDHKKL 102

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356524724|ref|XP_003530978.1| PREDICTED: annexin D5-like [Glycine max] Back     alignment and taxonomy information
>gi|255648073|gb|ACU24491.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224125894|ref|XP_002329743.1| predicted protein [Populus trichocarpa] gi|222870651|gb|EEF07782.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357521715|ref|XP_003631146.1| Annexin-like protein [Medicago truncatula] gi|355525168|gb|AET05622.1| Annexin-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|217071700|gb|ACJ84210.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388496086|gb|AFK36109.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356531118|ref|XP_003534125.1| PREDICTED: LOW QUALITY PROTEIN: annexin D5-like [Glycine max] Back     alignment and taxonomy information
>gi|255635417|gb|ACU18061.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255646485|gb|ACU23721.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
TAIR|locus:2200281 316 ANN5 "annexin 5" [Arabidopsis 0.904 0.300 0.475 2e-17
TAIR|locus:2011344 317 ANNAT1 "annexin 1" [Arabidopsi 0.952 0.315 0.407 3.3e-15
TAIR|locus:2184123 316 ANNAT7 "annexin 7" [Arabidopsi 0.952 0.316 0.388 1e-13
TAIR|locus:2184108 318 ANN6 "annexin 6" [Arabidopsis 0.952 0.314 0.388 2.3e-13
TAIR|locus:2177709 317 ANNAT2 "annexin 2" [Arabidopsi 0.952 0.315 0.368 5e-13
UNIPROTKB|E9PHT9163 ANXA5 "Annexin" [Homo sapiens 0.952 0.613 0.378 2.2e-11
UNIPROTKB|E7ENQ5 276 ANXA5 "Annexin" [Homo sapiens 0.914 0.347 0.367 9.2e-11
UNIPROTKB|D6RBL5 260 ANXA5 "Annexin" [Homo sapiens 0.895 0.361 0.375 1.2e-10
TAIR|locus:505006606 316 ANNAT8 "annexin 8" [Arabidopsi 0.961 0.319 0.336 1.5e-10
UNIPROTKB|P08758 320 ANXA5 "Annexin A5" [Homo sapie 0.914 0.3 0.367 1.5e-10
TAIR|locus:2200281 ANN5 "annexin 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 213 (80.0 bits), Expect = 2.0e-17, P = 2.0e-17
 Identities = 48/101 (47%), Positives = 68/101 (67%)

Query:     2 YSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSL--TTGNLKAATEVICSRTPS 59
             +S+DL KRL SEL G L+ AVLLWM +   RDA +++ SL     + KA  E+IC+R+ S
Sbjct:    57 FSDDLRKRLHSELHGHLKKAVLLWMPEAVERDASILKRSLRGAVTDHKAIAEIICTRSGS 116

Query:    60 QIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKVEYVSLLFYL 100
             Q++ I+Q Y + FGV LE+DI+   SG+H++V    LL YL
Sbjct:   117 QLRQIKQVYSNTFGVKLEEDIESEASGNHKRV----LLAYL 153
GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0005544 "calcium-dependent phospholipid binding" evidence=IEA;ISS
GO:0009408 "response to heat" evidence=IEP
GO:0009409 "response to cold" evidence=IEP
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009639 "response to red or far red light" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0009827 "plant-type cell wall modification" evidence=RCA
GO:0009860 "pollen tube growth" evidence=RCA
GO:0030048 "actin filament-based movement" evidence=RCA
TAIR|locus:2011344 ANNAT1 "annexin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184123 ANNAT7 "annexin 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184108 ANN6 "annexin 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177709 ANNAT2 "annexin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E9PHT9 ANXA5 "Annexin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ENQ5 ANXA5 "Annexin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6RBL5 ANXA5 "Annexin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:505006606 ANNAT8 "annexin 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P08758 ANXA5 "Annexin A5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01220062
hypothetical protein (317 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
pfam0019166 pfam00191, Annexin, Annexin 3e-15
smart0033553 smart00335, ANX, Annexin repeats 3e-14
>gnl|CDD|201070 pfam00191, Annexin, Annexin Back     alignment and domain information 
 Score = 64.0 bits (157), Expect = 3e-15
 Identities = 18/45 (40%), Positives = 27/45 (60%)

Query: 47 KAATEVICSRTPSQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKV 91
               ++ +R+ +Q+Q IR+ Y   +G  LE DIK  TSGD EK+
Sbjct: 18 DTLIRILATRSNAQLQAIREAYKKLYGKDLEKDIKSETSGDFEKL 62

This family of annexins also includes giardin that has been shown to function as an annexin. Length = 66
>gnl|CDD|197661 smart00335, ANX, Annexin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 105
KOG0819 321 consensus Annexin [Intracellular trafficking, secr 100.0
KOG0819321 consensus Annexin [Intracellular trafficking, secr 99.94
PF0019166 Annexin: Annexin; InterPro: IPR018502 The annexins 99.8
smart0033553 ANX Annexin repeats. 99.53
PF0019166 Annexin: Annexin; InterPro: IPR018502 The annexins 97.82
smart0033553 ANX Annexin repeats. 97.76
>KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-34  Score=205.06  Aligned_cols=104  Identities=37%  Similarity=0.497  Sum_probs=101.2

Q ss_pred             CccchHHHHHhhhcchhHHHHHHHHccCCHHHHHHHHHHHHcCCCh--HHHHHHHhhCCHHHHHHHHHHHHHhcCCCHHH
Q 034049            1 MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTGNL--KAATEVICSRTPSQIQLIRQHYHSKFGVHLED   78 (105)
Q Consensus         1 ~y~~~L~~~l~~e~sg~~~~~l~~~~~~~~~~dA~~L~~A~~g~gt--~~li~il~~rs~~~l~~i~~~Y~~~yg~~L~~   78 (105)
                      +||+||.++|++|+||+|++++++|+.+|+.+||+.|++||+|.||  ++||+|+|+|+|.|+++|+++|+..|+++|++
T Consensus        61 ~ygkDLi~~Lk~ELsG~Fe~~i~al~~~p~~~DA~~l~~amkg~gtde~vlIEIlcTRT~~el~~i~~aY~~~y~~sLEe  140 (321)
T KOG0819|consen   61 MYGKDLIKDLKSELSGDFERAIVALMKPPAEYDAKELKKAMKGLGTDEKVLIEILCTRTNEELRAIRQAYQELYKKSLEE  140 (321)
T ss_pred             HHhHHHHHHHHHHhCccHHHHHHHHcCCHHHhHHHHHHHHHhccCcchhhheeeeccCCHHHHHHHHHHHHHHHcccHHH
Confidence            5999999999999999999999999999999999999999999999  99999999999999999999999999999999


Q ss_pred             HHhhccccccchh--hhccccccccccc
Q 034049           79 DIKRHTSGDHEKV--EYVSLLFYLRYCV  104 (105)
Q Consensus        79 ~I~~~~sG~~~~~--aL~~~~~~~~~~~  104 (105)
                      +|.+++||+|+++  +|+++.|+|+..|
T Consensus       141 DI~s~TSG~frklLv~L~~~~R~e~~~v  168 (321)
T KOG0819|consen  141 DIASDTSGDFRKLLVSLVQGNRDEGDRV  168 (321)
T ss_pred             HhhhccCchHHHHHHHHHhcCCccCCCc
Confidence            9999999999999  9999999987654

>KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] Back     alignment and domain information
>smart00335 ANX Annexin repeats Back     alignment and domain information
>PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] Back     alignment and domain information
>smart00335 ANX Annexin repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
1ycn_A 317 X-Ray Structure Of Annexin From Arabidopsis Thalian 2e-15
3brx_A 317 Crystal Structure Of Calcium-Bound Cotton Annexin G 3e-14
1n00_A 321 Annexin Gh1 From Cotton Length = 321 3e-14
1dk5_A 322 Crystal Structure Of Annexin 24(Ca32) From Capsicum 8e-14
1bcz_A 319 Recombinant Rat Annexin V, T72s Mutant Length = 319 6e-11
1hvd_A 319 Structural And Electrophysiological Analysis Of Ann 6e-11
1anw_A 319 The Effect Of Metal Binding On The Structure Of Ann 8e-11
1avh_A 320 Crystal And Molecular Structure Of Human Annexin V 8e-11
2h0m_A 318 Structure Of A Mutant Of Rat Annexin A5 Length = 31 1e-10
1bc0_A 319 Recombinant Rat Annexin V, W185a Mutant Length = 31 1e-10
1n41_A 319 Crystal Structure Of Annexin V K27e Mutant Length = 1e-10
2h0k_A 318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 1e-10
1g5n_A 318 Annexin V Complex With Heparin Oligosaccharides Len 1e-10
1n44_A 319 Crystal Structure Of Annexin V R23e Mutant Length = 1e-10
1a8a_A 319 Rat Annexin V Complexed With Glycerophosphoserine L 1e-10
2ran_A 316 Rat Annexin V Crystal Structure: Ca2+-Induced Confo 1e-10
1bcw_A 319 Recombinant Rat Annexin V, T72a Mutant Length = 319 1e-10
1hvf_A 319 Structural And Electrophysiological Analysis Of Ann 1e-10
2h0l_A 318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 2e-10
1hve_A 319 Structural And Electrophysiological Analysis Of Ann 2e-10
1n42_A 319 Crystal Structure Of Annexin V R149e Mutant Length 2e-10
1bcy_A 319 Recombinant Rat Annexin V, T72k Mutant Length = 319 2e-10
1bc1_A 319 Recombinant Rat Annexin V, Quadruple Mutant (T72k, 6e-10
1bc3_A 319 Recombinant Rat Annexin V, Triple Mutant (T72k, S14 6e-10
2xo2_A 320 Human Annexin V With Incorporated Methionine Analog 7e-10
1sav_A 320 Human Annexin V With Proline Substitution By Thiopr 1e-09
1yii_A 320 Crystal Structures Of Chicken Annexin V In Complex 2e-09
1ala_A 321 Structure Of Chicken Annexin V At 2.25-Angstroms Re 2e-09
1w45_A 327 The 2.5 Angstroem Structure Of The K16a Mutant Of A 2e-08
1w3w_A 327 The 2.1 Angstroem Resolution Structure Of Annexin A 2e-08
1aow_A 309 Annexin Iv Length = 309 3e-08
1w7b_A 339 Annexin A2: Does It Induce Membrane Aggregation By 1e-07
2hyu_A 308 Human Annexin A2 With Heparin Tetrasaccharide Bound 1e-07
1xjl_A 319 Structure Of Human Annexin A2 In The Presence Of Ca 1e-07
1ann_A 318 Annexin Iv Length = 318 3e-07
1i4a_A 318 Crystal Structure Of Phosphorylation-Mimicking Muta 3e-07
1avc_A 673 Bovine Annexin Vi (Calcium-Bound) Length = 673 4e-07
2zoc_A 319 Crystal Structure Of Recombinant Human Annexin Iv L 4e-07
1aii_A 323 Annexin Iii Length = 323 1e-06
1axn_A 323 The High Resolution Structure Of Annexin Iii Shows 1e-06
1m9i_A 672 Crystal Structure Of Phosphorylation-Mimicking Muta 2e-06
2zhi_A 322 Crystal Structure Analysis Of The Sodium-Bound Anne 2e-05
1aei_A 315 Crystal Structure Of The Annexin Xii Hexamer Length 3e-04
1dm5_A 315 Annexin Xii E105k Homohexamer Crystal Structure Len 3e-04
1hm6_A 346 X-Ray Structure Of Full-Length Annexin 1 Length = 3 6e-04
1ain_A 314 Crystal Structure Of Human Annexin I At 2.5 Angstro 8e-04
>pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana Gene At1g35720 Length = 317 Back     alignment and structure 
Iteration: 1

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 60/103 (58%), Gaps = 3/103 (2%)
Query: 2   YSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLT--TGNLKAATEVICSRTPS 59
           Y EDL K L  ELS   E A+LLW  +P  RDA++   +    T + +   EV C+RT +
Sbjct: 57  YGEDLLKTLDKELSNDFERAILLWTLEPGERDALLANEATKRWTSSNQVLMEVACTRTST 116
Query: 60  QIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKVEYVSLLFYLRY 102
           Q+   RQ YH+++   LE+D+  HT+GD  K+  VSL+   RY
Sbjct: 117 QLLHARQAYHARYKKSLEEDVAHHTTGDFRKL-LVSLVTSYRY 158
>pdb|3BRX|A Chain A, Crystal Structure Of Calcium-Bound Cotton Annexin Gh1 Length = 317 Back     alignment and structure
>pdb|1N00|A Chain A, Annexin Gh1 From Cotton Length = 321 Back     alignment and structure
>pdb|1DK5|A Chain A, Crystal Structure Of Annexin 24(Ca32) From Capsicum Annuum Length = 322 Back     alignment and structure
>pdb|1BCZ|A Chain A, Recombinant Rat Annexin V, T72s Mutant Length = 319 Back     alignment and structure
>pdb|1HVD|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1ANW|A Chain A, The Effect Of Metal Binding On The Structure Of Annexin V And Implications For Membrane Binding Length = 319 Back     alignment and structure
>pdb|1AVH|A Chain A, Crystal And Molecular Structure Of Human Annexin V After Refinement. Implications For Structure, Membrane Binding And Ion Channel Formation Of The Annexin Family Of Proteins Length = 320 Back     alignment and structure
>pdb|2H0M|A Chain A, Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|1BC0|A Chain A, Recombinant Rat Annexin V, W185a Mutant Length = 319 Back     alignment and structure
>pdb|1N41|A Chain A, Crystal Structure Of Annexin V K27e Mutant Length = 319 Back     alignment and structure
>pdb|2H0K|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|1G5N|A Chain A, Annexin V Complex With Heparin Oligosaccharides Length = 318 Back     alignment and structure
>pdb|1N44|A Chain A, Crystal Structure Of Annexin V R23e Mutant Length = 319 Back     alignment and structure
>pdb|1A8A|A Chain A, Rat Annexin V Complexed With Glycerophosphoserine Length = 319 Back     alignment and structure
>pdb|2RAN|A Chain A, Rat Annexin V Crystal Structure: Ca2+-Induced Conformational Changes Length = 316 Back     alignment and structure
>pdb|1BCW|A Chain A, Recombinant Rat Annexin V, T72a Mutant Length = 319 Back     alignment and structure
>pdb|1HVF|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|2H0L|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|1HVE|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1N42|A Chain A, Crystal Structure Of Annexin V R149e Mutant Length = 319 Back     alignment and structure
>pdb|1BCY|A Chain A, Recombinant Rat Annexin V, T72k Mutant Length = 319 Back     alignment and structure
>pdb|1BC1|A Chain A, Recombinant Rat Annexin V, Quadruple Mutant (T72k, S144k, S228k, S303k) Length = 319 Back     alignment and structure
>pdb|1BC3|A Chain A, Recombinant Rat Annexin V, Triple Mutant (T72k, S144k, S228k) Length = 319 Back     alignment and structure
>pdb|2XO2|A Chain A, Human Annexin V With Incorporated Methionine Analogue Azidohomoalanine Length = 320 Back     alignment and structure
>pdb|1SAV|A Chain A, Human Annexin V With Proline Substitution By Thioproline Length = 320 Back     alignment and structure
>pdb|1YII|A Chain A, Crystal Structures Of Chicken Annexin V In Complex With Ca2+ Length = 320 Back     alignment and structure
>pdb|1ALA|A Chain A, Structure Of Chicken Annexin V At 2.25-Angstroms Resolution Length = 321 Back     alignment and structure
>pdb|1W45|A Chain A, The 2.5 Angstroem Structure Of The K16a Mutant Of Annexin A8, Which Has An Intact N-Terminus. Length = 327 Back     alignment and structure
>pdb|1W3W|A Chain A, The 2.1 Angstroem Resolution Structure Of Annexin A8 Length = 327 Back     alignment and structure
>pdb|1AOW|A Chain A, Annexin Iv Length = 309 Back     alignment and structure
>pdb|1W7B|A Chain A, Annexin A2: Does It Induce Membrane Aggregation By A New Multimeric State Of The Protein Length = 339 Back     alignment and structure
>pdb|2HYU|A Chain A, Human Annexin A2 With Heparin Tetrasaccharide Bound Length = 308 Back     alignment and structure
>pdb|1XJL|A Chain A, Structure Of Human Annexin A2 In The Presence Of Calcium Ions Length = 319 Back     alignment and structure
>pdb|1ANN|A Chain A, Annexin Iv Length = 318 Back     alignment and structure
>pdb|1I4A|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T6d Of Annexin Iv Length = 318 Back     alignment and structure
>pdb|1AVC|A Chain A, Bovine Annexin Vi (Calcium-Bound) Length = 673 Back     alignment and structure
>pdb|2ZOC|A Chain A, Crystal Structure Of Recombinant Human Annexin Iv Length = 319 Back     alignment and structure
>pdb|1AII|A Chain A, Annexin Iii Length = 323 Back     alignment and structure
>pdb|1AXN|A Chain A, The High Resolution Structure Of Annexin Iii Shows Differences With Annexin V Length = 323 Back     alignment and structure
>pdb|1M9I|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T356d Of Annexin Vi Length = 672 Back     alignment and structure
>pdb|2ZHI|A Chain A, Crystal Structure Analysis Of The Sodium-Bound Annexin A4 At 1.58 A Resolution Length = 322 Back     alignment and structure
>pdb|1AEI|A Chain A, Crystal Structure Of The Annexin Xii Hexamer Length = 315 Back     alignment and structure
>pdb|1DM5|A Chain A, Annexin Xii E105k Homohexamer Crystal Structure Length = 315 Back     alignment and structure
>pdb|1HM6|A Chain A, X-Ray Structure Of Full-Length Annexin 1 Length = 346 Back     alignment and structure
>pdb|1AIN|A Chain A, Crystal Structure Of Human Annexin I At 2.5 Angstroms Resolution Length = 314 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 5e-24
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 3e-13
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 1e-09
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 4e-09
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 7e-24
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 5e-12
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 8e-09
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 2e-07
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 9e-24
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 4e-23
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 9e-14
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 1e-11
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 4e-09
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 5e-09
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 5e-09
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 1e-08
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 1e-23
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 2e-11
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 4e-09
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 2e-07
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 3e-23
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 3e-12
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 2e-09
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 3e-07
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 8e-23
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 2e-12
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 1e-09
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 3e-08
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 1e-22
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 8e-12
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 2e-09
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 3e-08
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 1e-22
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 6e-12
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 1e-09
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 8e-09
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 1e-22
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 2e-12
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 1e-09
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 7e-09
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 2e-22
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 2e-12
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 6e-09
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 1e-08
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 2e-22
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 3e-09
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 8e-09
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 5e-08
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 2e-21
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 3e-09
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 4e-09
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 9e-08
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
 Score = 91.9 bits (228), Expect = 5e-24
 Identities = 35/104 (33%), Positives = 51/104 (49%), Gaps = 3/104 (2%)

Query: 1   MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTG--NLKAATEVICSRTP 58
              ++L   L S LSG LE  +L  +  PA  DA  ++ S+     +  +  E+ICSRT 
Sbjct: 47  RTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTN 106

Query: 59  SQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKVEYVSLLFYLRY 102
            ++Q I + Y   +   LE DI   TSGD  K+  V+L    R 
Sbjct: 107 QELQEINRVYKEMYKTDLEKDIISDTSGDFRKL-MVALAKGRRA 149
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 99.96
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 99.96
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 99.96
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 99.96
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 99.96
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 99.96
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 99.96
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 99.96
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 99.95
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 99.95
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 99.95
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 99.95
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 99.95
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 99.94
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 99.93
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 99.93
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 99.93
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 99.93
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 99.93
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 99.92
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 99.91
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 99.89
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 99.89
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 99.89
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
Probab=99.96  E-value=3.2e-30  Score=184.48  Aligned_cols=102  Identities=31%  Similarity=0.388  Sum_probs=98.5

Q ss_pred             CccchHHHHHhhhcchhHHHHHHHHccCCHHHHHHHHHHHHcCCCh--HHHHHHHhhCCHHHHHHHHHHHHHhcCCCHHH
Q 034049            1 MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTGNL--KAATEVICSRTPSQIQLIRQHYHSKFGVHLED   78 (105)
Q Consensus         1 ~y~~~L~~~l~~e~sg~~~~~l~~~~~~~~~~dA~~L~~A~~g~gt--~~li~il~~rs~~~l~~i~~~Y~~~yg~~L~~   78 (105)
                      +||+||.++|++|+||+|++++++|+.+|+.+||..|++||+|.||  ++||+||++|||.|++.|+++|++.||++|++
T Consensus        47 ~~g~dL~~~lk~elsG~fe~~l~~l~~~~~~~DA~~L~~AmkG~Gtde~~LieIL~~Rs~~q~~~Ik~aY~~~y~~~L~~  126 (308)
T 2hyv_A           47 RTKKELASALKSALSGHLETVILGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEK  126 (308)
T ss_dssp             HHSSCHHHHHHHHCCHHHHHHHHHHHSCHHHHHHHHHHHHTSTTCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHSSCHHH
T ss_pred             HhCccHHHHHHHHcCCCHHHHHHHHcCCcHHHHHHHHHHHhhcCCCCHHHHHHHHhcCCHHHHHHHHHHHHHhhCCCHHH
Confidence            4899999999999999999999999999999999999999999999  99999999999999999999999999999999


Q ss_pred             HHhhccccccchh--hhccccc-cccc
Q 034049           79 DIKRHTSGDHEKV--EYVSLLF-YLRY  102 (105)
Q Consensus        79 ~I~~~~sG~~~~~--aL~~~~~-~~~~  102 (105)
                      +|++++||+|+++  +|+.++| +|+.
T Consensus       127 di~se~sG~f~~ll~~l~~~~r~~e~~  153 (308)
T 2hyv_A          127 DIISDTSGDFRKLMVALAKGRRAEDGS  153 (308)
T ss_dssp             HHHHTCCHHHHHHHHHHHTCCCCCCCS
T ss_pred             HHhhccCccHHHHHHHHHccccccccC
Confidence            9999999999999  9999998 6644
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 105
d1axna_ 323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 5e-21
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 1e-12
d1axna_ 323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 8e-10
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 7e-07
d1hm6a_ 343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 6e-21
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 4e-13
d1hm6a_ 343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 7e-09
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 6e-06
d2ie7a1 318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 6e-21
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 8e-14
d2ie7a1 318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 1e-09
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 2e-06
d1avca1 341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 4e-20
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 1e-13
d1avca1 341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 1e-09
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 4e-04
d1avca2 321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 5e-20
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 2e-12
d1avca2 321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 1e-09
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 2e-06
d1n00a_ 318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 1e-19
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 1e-12
d1n00a_ 318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 3e-09
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 2e-05
d1i4aa_ 309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 4e-19
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 5e-12
d1i4aa_ 309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 7e-09
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 1e-06
d1w7ba_ 319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 1e-18
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 7e-13
d1w7ba_ 319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 1e-08
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 5e-08
d1dm5a_ 315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 1e-17
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 1e-12
d1dm5a_ 315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 2e-09
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 4e-06
d1bo9a_73 a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax 3e-12
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure

class: All alpha proteins
fold: Annexin
superfamily: Annexin
family: Annexin
domain: Annexin III
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 82.7 bits (204), Expect = 5e-21
 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 2/93 (2%)

Query: 1   MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTG--NLKAATEVICSRTP 58
            Y ++L   L  +LSG  E  ++  +  PA  DA  ++ S+     N  A  E++ +RT 
Sbjct: 63  AYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLKKSMKGAGTNEDALIEILTTRTS 122

Query: 59  SQIQLIRQHYHSKFGVHLEDDIKRHTSGDHEKV 91
            Q++ I Q Y++ +   L DDI   TSGD  K 
Sbjct: 123 RQMKDISQAYYTVYKKSLGDDISSETSGDFRKA 155
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
d1n00a_ 318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 99.96
d1hm6a_ 343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 99.95
d1avca2 321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1avca1 341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1axna_ 323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1i4aa_ 309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1dm5a_ 315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 99.95
d1w7ba_ 319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2ie7a1 318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 99.95
d1avca2321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1avca1341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1i4aa_309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 99.92
d2ie7a1318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 99.92
d1axna_323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1w7ba_319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1dm5a_315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 99.91
d1hm6a_343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 99.91
d1n00a_318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 99.9
d1bo9a_73 Annexin I {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1bo9a_73 Annexin I {Human (Homo sapiens) [TaxId: 9606]} 97.77
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
class: All alpha proteins
fold: Annexin
superfamily: Annexin
family: Annexin
domain: Annexin GH1
species: Cotton (Gossypium hirsutum) [TaxId: 3635]

Probab=99.96  E-value=2.4e-29  Score=178.92  Aligned_cols=104  Identities=38%  Similarity=0.599  Sum_probs=100.1

Q ss_pred             CccchHHHHHhhhcchhHHHHHHHHccCCHHHHHHHHHHHHcCCCh--HHHHHHHhhCCHHHHHHHHHHHHHhcCCCHHH
Q 034049            1 MYSEDLCKRLSSELSGKLEMAVLLWMHDPAGRDAVVVRNSLTTGNL--KAATEVICSRTPSQIQLIRQHYHSKFGVHLED   78 (105)
Q Consensus         1 ~y~~~L~~~l~~e~sg~~~~~l~~~~~~~~~~dA~~L~~A~~g~gt--~~li~il~~rs~~~l~~i~~~Y~~~yg~~L~~   78 (105)
                      +||+||.++|++++||+|++++++|+.+|+.+||..|++|++|+||  .+|++|||+|+|.||..|+++|+..|+++|++
T Consensus        58 ~~gkdL~~~L~~elsG~f~~~l~~l~~~p~~~dA~~l~~A~kg~gtde~~LieIl~~rs~~e~~~ik~aY~~~~~~~L~~  137 (318)
T d1n00a_          58 TYGEDLLKALDKELSNDFERLVLLWALDPAERDALLANEATKRWTSSNQVLMEIACTRSANQLLHARQAYHARYKKSLEE  137 (318)
T ss_dssp             HHSSCHHHHHHHHSCHHHHHHHHHHHSCHHHHHHHHHHHHHSSSCSSCHHHHHHHHSSCHHHHHHHHHHHHHHHSSCHHH
T ss_pred             HHCccHHHHHHHHhCchHHHHHHHhcCCHHHHHHHHHHHHhhCCCcchhhHhhHhhcCCcHHHHHHHHHHHHHcCccHHH
Confidence            4899999999999999999999999999999999999999999999  99999999999999999999999999999999


Q ss_pred             HHhhccccccchh--hhccccccccccc
Q 034049           79 DIKRHTSGDHEKV--EYVSLLFYLRYCV  104 (105)
Q Consensus        79 ~I~~~~sG~~~~~--aL~~~~~~~~~~~  104 (105)
                      +|.+++||+|+++  +|+.+.|+++-.|
T Consensus       138 di~~~~sg~~~~ll~~ll~~~R~e~~~v  165 (318)
T d1n00a_         138 DVAHHTTGDFHKLLLPLVSSYRYEGEEV  165 (318)
T ss_dssp             HHHHHCCHHHHHHHHHHHHCCCCCSCCC
T ss_pred             HHHhcccHHHHHHHHHHHhcCCcCCCCc
Confidence            9999999999999  9999999886544
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure