Citrus Sinensis ID: 034182

---

Local Sequence Feature Prediction

Residue Number Marker
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
Protein Sequence
MASSLLKILIKSSNLPSTTRNLTAVANQISEHTAKWMQDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHHH
Secondary Structure (PSIPRED)
cHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHcccccEEEcccEEEEccccccccccccEEEEccccccEEcccccccccccccc
Secondary Structure Prediction (SSPRO)
cHHHHHHHHHHccccccccccccEEEcccccccHHHHHccccccHHHHHHccccEEccccEEEEcccccccccccEEEEEccccccccccccccEEcccccc
Coil and Loop (DISEMBL)
MASSLLKILIkssnlpsttrNLTAVANQISEHTAKWMqdvskkspmelinevppikvegrivacegdsnpalghpieficldlkepaickycglryvqdhhh
Flexible Loop (DISEMBL)
MASSLLKILIkssnlpsttrNLTAVANQISEHTAKWMQDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHHH
Low Complexity Region (SEG)
MAssllkilikssnlPSTTRNLTAVANQISEHTAKWMQDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHHH
Disordered region (IsUnstruct)
***********************************************LINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQ****
Disordered Region (DISOPRED)
*********************************AKWMQDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCG**YV*****
Disordered Region (DISEMBL)
MASSLLKILIKSSNLPSTTRNLTAVANQISEHTAKWMQDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHHH
Disordered Region (DISPRO)
********LIKSSNLPSTTRNLTAVANQISEHTAKWMQDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQ****
Transmembrane Helix (TMHMM)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (HMMTOP)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Transmembrane Helix (MEMSAT)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiii
TM Helix, Signal Peptide (MEMSAT_SVM)
SSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
TM Helix, Signal Peptide (Phobius)
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
Signal Peptide (SignalP HMM Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Signal Peptide (SignalP NN Mode)
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
Coiled Coils (COILS)
MASSLLKILIKSSNLPSTTRNLTAVANQISEHTAKWMQDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHHH
Positional Conservation
no confident homologs detected

---

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query	102	2.2.26 [Sep-21-2011]
Q9M9M6	110	NADH dehydrogenase [ubiqu	yes	no	1.0	0.927	0.736	2e-42
Q0MQH5	124	NADH dehydrogenase [ubiqu	N/A	no	0.617	0.508	0.415	1e-07
Q0MQH7	124	NADH dehydrogenase [ubiqu	yes	no	0.617	0.508	0.415	3e-07
O75380	124	NADH dehydrogenase [ubiqu	yes	no	0.617	0.508	0.415	3e-07
P52503	116	NADH dehydrogenase [ubiqu	yes	no	0.627	0.551	0.409	5e-07
P52504	116	NADH dehydrogenase [ubiqu	yes	no	0.617	0.543	0.4	5e-07
P23934	124	NADH dehydrogenase [ubiqu	yes	no	0.617	0.508	0.384	8e-07
Q0MQH6	124	NADH dehydrogenase [ubiqu	N/A	no	0.617	0.508	0.4	2e-06
Q5AUI1	213	Lactobacillus shifted pro	yes	no	0.549	0.262	0.438	3e-06
Q19724	140	Probable NADH dehydrogena	yes	no	0.598	0.435	0.426	6e-06

>sp|Q9M9M6|NDUS6_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Arabidopsis thaliana GN=At3g03070 PE=3 SV=1

 Score =  170 bits (431), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 81/110 (73%), Positives = 89/110 (80%), Gaps = 8/110 (7%)

Query: 1   MASSLLKILIKSSNLPSTTRNLTAVANQ--------ISEHTAKWMQDVSKKSPMELINEV 52
           MAS+LLK LI+S  LPS+ RN +    Q        +  HTAKWMQD SKKSPMELI+EV
Sbjct: 1   MASNLLKALIRSQILPSSRRNFSVATTQLGIPTDDLVGNHTAKWMQDRSKKSPMELISEV 60

Query: 53  PPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHHH 102
           PPIKV+GRIVACEGD+NPALGHPIEFICLDL EPAICKYCGLRYVQDHHH
Sbjct: 61  PPIKVDGRIVACEGDTNPALGHPIEFICLDLNEPAICKYCGLRYVQDHHH 110

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Arabidopsis thaliana (taxid: 3702)

>sp|Q0MQH5|NDUS6_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Pongo pygmaeus GN=NDUFS6 PE=2 SV=1

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 38  QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
           ++V++   ++LI E P  +VE R++AC+G    ALGHP  +I LD + +   C YCGL++
Sbjct: 61  KEVNENFAIDLIAEQPVSEVETRVIACDG-GGGALGHPKVYINLDKETKTGTCGYCGLQF 119

Query: 97  VQDHH 101
            Q HH
Sbjct: 120 RQHHH 124

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Pongo pygmaeus (taxid: 9600)

>sp|Q0MQH7|NDUS6_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Pan troglodytes GN=NDUFS6 PE=2 SV=1

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 38  QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
           ++V++   ++LI E P  +VE R++AC+G    ALGHP  +I LD + +   C YCGL++
Sbjct: 61  KEVNENFAIDLIAEQPVSEVETRVIACDGGGG-ALGHPKVYINLDKETKTGTCGYCGLQF 119

Query: 97  VQDHH 101
            Q HH
Sbjct: 120 RQHHH 124

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Pan troglodytes (taxid: 9598)

>sp|O75380|NDUS6_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Homo sapiens GN=NDUFS6 PE=1 SV=1

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 38  QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
           ++V++   ++LI E P  +VE R++AC+G    ALGHP  +I LD + +   C YCGL++
Sbjct: 61  KEVNENFAIDLIAEQPVSEVETRVIACDGGGG-ALGHPKVYINLDKETKTGTCGYCGLQF 119

Query: 97  VQDHH 101
            Q HH
Sbjct: 120 RQHHH 124

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Homo sapiens (taxid: 9606)

>sp|P52503|NDUS6_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Mus musculus GN=Ndufs6 PE=1 SV=2

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 37  MQDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLR 95
            ++V++   ++LI + P  +VE RI+AC+G    ALGHP  +I LD + +   C YCGL+
Sbjct: 52  QKEVNENFAIDLIAQQPVNEVEHRIIACDGGGG-ALGHPKVYINLDKETKTGTCGYCGLQ 110

Query: 96  YVQDHH 101
           + Q HH
Sbjct: 111 FKQHHH 116

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Mus musculus (taxid: 10090)

>sp|P52504|NDUS6_RAT NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Rattus norvegicus GN=Ndufs6 PE=3 SV=1

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 38  QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
           ++V++   ++LI + P  +V+ RI+AC+G    ALGHP  +I LD + +   C YCGL++
Sbjct: 53  KEVNENFAIDLIAQQPVNEVDRRIIACDG-GGGALGHPKVYINLDKETKTGTCAYCGLQF 111

Query: 97  VQDHH 101
            Q HH
Sbjct: 112 KQQHH 116

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Rattus norvegicus (taxid: 10116)

>sp|P23934|NDUS6_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Bos taurus GN=NDUFS6 PE=1 SV=2

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 41/65 (63%), Gaps = 2/65 (3%)

Query: 38  QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
           ++V++   ++LI E P  +V  R+++C+G    ALGHP  +I LD + +   C YCGL++
Sbjct: 61  KEVNENFAIDLIAEQPVSQVGSRVISCDGGGG-ALGHPRVYINLDKETKTGTCGYCGLQF 119

Query: 97  VQDHH 101
            Q HH
Sbjct: 120 RQQHH 124

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Bos taurus (taxid: 9913)

>sp|Q0MQH6|NDUS6_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS6 PE=2 SV=1

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 2/65 (3%)

Query: 38  QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
           ++V++   ++LI E P  +VE R++AC+G    ALGHP  +I LD + +   C YCGL++
Sbjct: 61  KEVNENFAIDLIAEQPVSEVETRVIACDGGGG-ALGHPKVYINLDKETKTGTCGYCGLQF 119

Query: 97  VQDHH 101
            Q H 
Sbjct: 120 RQHHR 124

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Gorilla gorilla gorilla (taxid: 9595)

>sp|Q5AUI1|LBSA_EMENI Lactobacillus shifted protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=lbsA PE=1 SV=1

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 46  MELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHHH 102
           +ELI++ P   V+ +IV+C+G   P LGHP  FI  D  E   C YCGL +  +HH 
Sbjct: 120 IELIHKQPVRWVKDKIVSCDGGGGP-LGHPRIFINTDKPEIVPCGYCGLPFAHEHHR 175

Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (taxid: 227321)

>sp|Q19724|NDUS6_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial OS=Caenorhabditis elegans GN=nduf-6 PE=3 SV=1

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 38/68 (55%), Gaps = 7/68 (10%)

Query: 39  DVSKKS-----PMELINEVPPIKV-EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYC 92
           D+SKKS      M LI++ PP    + R+V C+G  +PALGHP  +I LD      C YC
Sbjct: 60  DISKKSVNPNVAMHLIDQRPPEDCGDKRVVFCDG-GHPALGHPKVYINLDKPGVHACGYC 118

Query: 93  GLRYVQDH 100
           G R+   H
Sbjct: 119 GNRFYNSH 126

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Caenorhabditis elegans (taxid: 6239)

---

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Length	Definition	Q cover	H cover	Identity	E-value
Query	102
TAIR|locus:2097810	110	AT3G03070 [Arabidopsis thalian	0.852	0.790	0.747	3.1e-35
DICTYBASE|DDB_G0267552	99	DDB_G0267552 "putative NADH de	0.539	0.555	0.561	4.4e-13
FB|FBgn0031684	126	CG8680 [Drosophila melanogaste	0.607	0.492	0.476	2.5e-10
ZFIN|ZDB-GENE-040912-86	129	ndufs6 "NADH dehydrogenase (ub	0.617	0.488	0.417	2.9e-09
UNIPROTKB|E1BQN0	128	NDUFS6 "Uncharacterized protei	0.617	0.492	0.430	3.6e-09
UNIPROTKB|O75380	124	NDUFS6 "NADH dehydrogenase [ub	0.617	0.508	0.415	7.6e-09
MGI|MGI:107932	116	Ndufs6 "NADH dehydrogenase (ub	0.617	0.543	0.415	1.2e-08
RGD|3156	116	Ndufs6 "NADH dehydrogenase (ub	0.617	0.543	0.4	1.6e-08
UNIPROTKB|P23934	124	NDUFS6 "NADH dehydrogenase [ub	0.617	0.508	0.384	4.2e-08
UNIPROTKB|F1S031	123	NDUFS6 "Uncharacterized protei	0.617	0.512	0.384	5.3e-08

TAIR|locus:2097810 AT3G03070 [Arabidopsis thaliana (taxid:3702)]

 Score = 381 (139.2 bits), Expect = 3.1e-35, P = 3.1e-35
 Identities = 71/95 (74%), Positives = 77/95 (81%)

Query:    16 PSTTRNLTAVANQ--------ISEHTAKWMQDVSKKSPMELINEVPPIKVEGRIVACEGD 67
             PS+ RN +    Q        +  HTAKWMQD SKKSPMELI+EVPPIKV+GRIVACEGD
Sbjct:    16 PSSRRNFSVATTQLGIPTDDLVGNHTAKWMQDRSKKSPMELISEVPPIKVDGRIVACEGD 75

Query:    68 SNPALGHPIEFICLDLKEPAICKYCGLRYVQDHHH 102
             +NPALGHPIEFICLDL EPAICKYCGLRYVQDHHH
Sbjct:    76 TNPALGHPIEFICLDLNEPAICKYCGLRYVQDHHH 110

GO:0005739 "mitochondrion" evidence=ISM;IDA

GO:0006661 "phosphatidylinositol biosynthetic process" evidence=RCA

DICTYBASE|DDB_G0267552 DDB_G0267552 "putative NADH dehydrogenase (ubiquinone)" [Dictyostelium discoideum (taxid:44689)]

 Score = 172 (65.6 bits), Expect = 4.4e-13, P = 4.4e-13
 Identities = 32/57 (56%), Positives = 42/57 (73%)

Query:    47 ELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDH-HH 102
             E+IN+V P+++EG  V C+G + P LGHP+ +I LD KEP  C YCGLR+VQ H HH
Sbjct:    42 EMINKVRPVEIEGSSVGCDGGNGP-LGHPMVYINLDGKEPQPCGYCGLRFVQKHGHH 97

GO:0044351 "macropinocytosis" evidence=RCA

FB|FBgn0031684 CG8680 [Drosophila melanogaster (taxid:7227)]

 Score = 146 (56.5 bits), Expect = 2.5e-10, P = 2.5e-10
 Identities = 31/65 (47%), Positives = 41/65 (63%)

Query:    40 VSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQ- 98
             V++   ++LI EVPP +   R+V C+G   P LGHP  +I LD     IC YCGLR+V+ 
Sbjct:    63 VNENWGIKLIEEVPPKECTERVVFCDGGDGP-LGHPKVYINLDKPGNHICGYCGLRFVKK 121

Query:    99 -DHHH 102
              DHHH
Sbjct:   122 DDHHH 126

GO:0008137 "NADH dehydrogenase (ubiquinone) activity" evidence=ISS

GO:0005747 "mitochondrial respiratory chain complex I" evidence=ISS

ZFIN|ZDB-GENE-040912-86 ndufs6 "NADH dehydrogenase (ubiquinone) Fe-S protein 6" [Danio rerio (taxid:7955)]

 Score = 136 (52.9 bits), Expect = 2.9e-09, P = 2.9e-09
 Identities = 28/67 (41%), Positives = 42/67 (62%)

Query:    38 QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAI--CKYCGLR 95
             ++V++   + L+ E P   VE R+V+C+G    ALGHP  +I LD K+  +  C YCGL+
Sbjct:    65 KEVNENFAINLVAEEPVTHVESRVVSCDGGGG-ALGHPKVYINLD-KDTRVGTCGYCGLQ 122

Query:    96 YVQDHHH 102
             + Q HHH
Sbjct:   123 FKQTHHH 129

GO:0003674 "molecular_function" evidence=ND

UNIPROTKB|E1BQN0 NDUFS6 "Uncharacterized protein" [Gallus gallus (taxid:9031)]

 Score = 135 (52.6 bits), Expect = 3.6e-09, P = 3.6e-09
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query:    38 QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
             ++V+K   ++LI E P  +VE RI++C+G    ALGHP  +I LD   +   C YCGL++
Sbjct:    65 KEVNKNFAIDLIAEQPVSEVESRIISCDGGGG-ALGHPKVYINLDKDTKTGTCGYCGLQF 123

Query:    97 VQDHH 101
              Q HH
Sbjct:   124 KQKHH 128

GO:0005747 "mitochondrial respiratory chain complex I" evidence=IEA

UNIPROTKB|O75380 NDUFS6 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial" [Homo sapiens (taxid:9606)]

 Score = 132 (51.5 bits), Expect = 7.6e-09, P = 7.6e-09
 Identities = 27/65 (41%), Positives = 42/65 (64%)

Query:    38 QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
             ++V++   ++LI E P  +VE R++AC+G    ALGHP  +I LD + +   C YCGL++
Sbjct:    61 KEVNENFAIDLIAEQPVSEVETRVIACDGGGG-ALGHPKVYINLDKETKTGTCGYCGLQF 119

Query:    97 VQDHH 101
              Q HH
Sbjct:   120 RQHHH 124

GO:0006120 "mitochondrial electron transport, NADH to ubiquinone" evidence=NAS

GO:0009055 "electron carrier activity" evidence=NAS

GO:0008137 "NADH dehydrogenase (ubiquinone) activity" evidence=NAS

GO:0005747 "mitochondrial respiratory chain complex I" evidence=IDA;NAS

GO:0005743 "mitochondrial inner membrane" evidence=TAS

GO:0022904 "respiratory electron transport chain" evidence=TAS

GO:0044281 "small molecule metabolic process" evidence=TAS

MGI|MGI:107932 Ndufs6 "NADH dehydrogenase (ubiquinone) Fe-S protein 6" [Mus musculus (taxid:10090)]

 Score = 130 (50.8 bits), Expect = 1.2e-08, P = 1.2e-08
 Identities = 27/65 (41%), Positives = 42/65 (64%)

Query:    38 QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
             ++V++   ++LI + P  +VE RI+AC+G    ALGHP  +I LD + +   C YCGL++
Sbjct:    53 KEVNENFAIDLIAQQPVNEVEHRIIACDGGGG-ALGHPKVYINLDKETKTGTCGYCGLQF 111

Query:    97 VQDHH 101
              Q HH
Sbjct:   112 KQHHH 116

GO:0003674 "molecular_function" evidence=ND

GO:0005739 "mitochondrion" evidence=IDA

GO:0005743 "mitochondrial inner membrane" evidence=IEA

GO:0005747 "mitochondrial respiratory chain complex I" evidence=ISO

GO:0006631 "fatty acid metabolic process" evidence=IMP

GO:0006810 "transport" evidence=IEA

GO:0006936 "muscle contraction" evidence=IMP

GO:0010259 "multicellular organismal aging" evidence=IMP

GO:0016020 "membrane" evidence=IEA

GO:0022900 "electron transport chain" evidence=IEA

GO:0022904 "respiratory electron transport chain" evidence=IMP

GO:0035264 "multicellular organism growth" evidence=IMP

GO:0061458 "reproductive system development" evidence=IMP

GO:0070469 "respiratory chain" evidence=IEA

GO:0070584 "mitochondrion morphogenesis" evidence=IMP

GO:0072358 "cardiovascular system development" evidence=IMP

RGD|3156 Ndufs6 "NADH dehydrogenase (ubiquinone) Fe-S protein 6" [Rattus norvegicus (taxid:10116)]

 Score = 129 (50.5 bits), Expect = 1.6e-08, P = 1.6e-08
 Identities = 26/65 (40%), Positives = 42/65 (64%)

Query:    38 QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
             ++V++   ++LI + P  +V+ RI+AC+G    ALGHP  +I LD + +   C YCGL++
Sbjct:    53 KEVNENFAIDLIAQQPVNEVDRRIIACDGGGG-ALGHPKVYINLDKETKTGTCAYCGLQF 111

Query:    97 VQDHH 101
              Q HH
Sbjct:   112 KQQHH 116

GO:0003674 "molecular_function" evidence=ND

GO:0005575 "cellular_component" evidence=ND

GO:0005739 "mitochondrion" evidence=ISO

GO:0005743 "mitochondrial inner membrane" evidence=IEA

GO:0005747 "mitochondrial respiratory chain complex I" evidence=ISO

GO:0006631 "fatty acid metabolic process" evidence=ISO

GO:0006936 "muscle contraction" evidence=ISO

GO:0008150 "biological_process" evidence=ND

GO:0010259 "multicellular organismal aging" evidence=ISO

GO:0022900 "electron transport chain" evidence=IEA

GO:0022904 "respiratory electron transport chain" evidence=ISO

GO:0035264 "multicellular organism growth" evidence=ISO

GO:0061458 "reproductive system development" evidence=ISO

GO:0070469 "respiratory chain" evidence=IEA

GO:0070584 "mitochondrion morphogenesis" evidence=ISO

GO:0072358 "cardiovascular system development" evidence=ISO

UNIPROTKB|P23934 NDUFS6 "NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial" [Bos taurus (taxid:9913)]

 Score = 125 (49.1 bits), Expect = 4.2e-08, P = 4.2e-08
 Identities = 25/65 (38%), Positives = 41/65 (63%)

Query:    38 QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
             ++V++   ++LI E P  +V  R+++C+G    ALGHP  +I LD + +   C YCGL++
Sbjct:    61 KEVNENFAIDLIAEQPVSQVGSRVISCDGGGG-ALGHPRVYINLDKETKTGTCGYCGLQF 119

Query:    97 VQDHH 101
              Q HH
Sbjct:   120 RQQHH 124

GO:0005743 "mitochondrial inner membrane" evidence=IEA

GO:0070469 "respiratory chain" evidence=IEA

GO:0022900 "electron transport chain" evidence=IEA

UNIPROTKB|F1S031 NDUFS6 "Uncharacterized protein" [Sus scrofa (taxid:9823)]

 Score = 124 (48.7 bits), Expect = 5.3e-08, P = 5.3e-08
 Identities = 25/65 (38%), Positives = 41/65 (63%)

Query:    38 QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRY 96
             ++V++   ++LI E P  +V  R+++C+G    ALGHP  +I LD + +   C YCGL++
Sbjct:    60 KEVNENFAIDLIAEQPVSEVGSRVISCDGGGG-ALGHPRVYINLDKETKTGTCGYCGLQF 118

Query:    97 VQDHH 101
              Q HH
Sbjct:   119 RQPHH 123

GO:0005747 "mitochondrial respiratory chain complex I" evidence=IEA

---

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9M9M6	NDUS6_ARATH	No assigned EC number	0.7363	1.0	0.9272	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

---

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00014036001	SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (102 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	nad9	SubName- Full=Chromosome undetermined scaffold_79, whole genome shotgun sequence;; Core subunit [...] (190 aa)				•		•	•		0.648
	GSVIVG00030686001	SubName- Full=Putative uncharacterized protein (Chromosome chr1 scaffold_5, whole genome shotgu [...] (100 aa)				•		•			0.593
	GSVIVG00032166001	SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (209 aa)				•		•	•		0.576
	GSVIVG00036386001	SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (223 aa)				•		•	•		0.554
	GSVIVG00023838001	SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (254 aa)				•		•	•		0.550
	GSVIVG00022315001	RecName- Full=NADH-ubiquinone oxidoreductase 75 kDa subunit; EC=1.6.5.3; (746 aa)				•		•	•		0.520
	GSVIVG00030884001	SubName- Full=Chromosome undetermined scaffold_53, whole genome shotgun sequence; (133 aa)				•		•	•		0.514
	GSVIVG00025731001	SubName- Full=Chromosome chr19 scaffold_35, whole genome shotgun sequence; (475 aa)				•		•	•		0.455
	GSVIVG00032598001	SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (122 aa)				•		•			0.448
	GSVIVG00014042001	SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (158 aa)				•		•			0.440

---

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Length	Definition	E-value
Query	102
pfam10276	40	pfam10276, zf-CHCC, Zinc-finger domain	1e-13
COG4391	62	COG4391, COG4391, Uncharacterized protein conserve	0.003

>gnl|CDD|204429 pfam10276, zf-CHCC, Zinc-finger domain

 Score = 58.8 bits (143), Expect = 1e-13
 Identities = 20/41 (48%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 58 EGRIVACEGDSNPALGHPIEFICLDL-KEPAICKYCGLRYV 97
           GR V+C+G     LGHP  +I LD    P  C YCGLR+V
Sbjct: 1  GGRRVSCDGG-GGPLGHPRVYINLDDEPGPVECPYCGLRFV 40

This is a short zinc-finger domain conserved from fungi to humans. It is Cx8Hx14Cx2C. Length = 40

>gnl|CDD|226826 COG4391, COG4391, Uncharacterized protein conserved in bacteria [Function unknown]

 Score = 32.9 bits (75), Expect = 0.003
 Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 1/43 (2%)

Query: 55 IKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYV 97
          I++    + C G   P   HP  F+ +  +   +C YC  RY 
Sbjct: 18 IEIGDLPLMCPG-PEPPNDHPRVFLDMGDEGEVVCPYCSTRYR 59

Length = 62

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Length	Definition	Probability
Query	102
KOG3456	120	consensus NADH:ubiquinone oxidoreductase, NDUFS6/1	100.0
PF10276	40	zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Z	99.8
COG4391	62	Uncharacterized protein conserved in bacteria [Fun	99.72
PLN02294	174	cytochrome c oxidase subunit Vb	98.34
cd00924	97	Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.	98.16
PF01215	136	COX5B: Cytochrome c oxidase subunit Vb This family	98.12
PTZ00043	268	cytochrome c oxidase subunit; Provisional	97.9
KOG3352	153	consensus Cytochrome c oxidase, subunit Vb/COX4 [E	97.64
PF09538	108	FYDLN_acid: Protein of unknown function (FYDLN_aci	96.61
TIGR02300	129	FYDLN_acid conserved hypothetical protein TIGR0230	94.73
PRK00398	46	rpoP DNA-directed RNA polymerase subunit P; Provis	93.45
COG4530	129	Uncharacterized protein conserved in bacteria [Fun	90.05
PF13465	26	zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A	89.77
PF00096	23	zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070	89.14
PF13913	25	zf-C2HC_2: zinc-finger of a C2HC-type	87.79
smart00659	44	RPOLCX RNA polymerase subunit CX. present in RNA p	87.32
COG1996	49	RPC10 DNA-directed RNA polymerase, subunit RPC10 (	85.79
PF13878	41	zf-C2H2_3: zinc-finger of acetyl-transferase ESCO	84.81
PF13894	24	zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP	84.75
PF02892	45	zf-BED: BED zinc finger; InterPro: IPR003656 Zinc	84.02
PF08792	33	A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I	80.72

>KOG3456 consensus NADH:ubiquinone oxidoreductase, NDUFS6/13 kDa subunit [Energy production and conversion]

Probab=100.00  E-value=3.1e-37  Score=219.32  Aligned_cols=99  Identities=56%  Similarity=0.974  Sum_probs=87.2

Q ss_pred             hhhHHHHHHHhcCCCCC-----cceeeeeecccc--cccceeee--------------ccCCCChhhhhccCCCEEecCe
Q 034182            2 ASSLLKILIKSSNLPST-----TRNLTAVANQIS--EHTAKWMQ--------------DVSKKSPMELINEVPPIKVEGR   60 (102)
Q Consensus         2 ~~~~l~~~~r~~~~~~~-----~r~~~~~~~~~~--~ht~~~~~--------------~~~~~~a~elI~e~p~i~V~~~   60 (102)
                      ||++|+++++...+|+.     +|+|++++ +..  +||+|.+|              +-|+++||+||.|+||++|++|
T Consensus         1 as~~l~~~lsr~~l~~rs~pl~~r~~~~r~-~~ekvThtGq~~D~~Dyr~~rf~~~kk~vn~n~~m~LI~e~Pp~e~d~R   79 (120)
T KOG3456|consen    1 ASNLLKALLSRQGLPSRSTPLTRRNFSVRT-QFEKVTHTGQVTDQSDYRGNRFVKWKKDVNENSAMELISEVPPIEVDGR   79 (120)
T ss_pred             CchHHHHHHhcCCCcccccccccccceeec-ccceeeecCcccchHHHhHHHHHhhhhhcCccchhhhhhcCChhhccce
Confidence            78999999888877665     99999987 322  46665554              4489999999999999999999


Q ss_pred             EEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccccCC
Q 034182           61 IVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHHH  102 (102)
Q Consensus        61 ~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~hh  102 (102)
                      +|+|||+++ |||||+||||||+++...|+|||+||+++|||
T Consensus        80 VV~CdGg~~-aLGHPkvyInLDk~~~~~CgYCGlrf~~dHhh  120 (120)
T KOG3456|consen   80 VVACDGGTP-ALGHPKVYINLDKPGPHICGYCGLRFVQDHHH  120 (120)
T ss_pred             EEEecCCCC-CCCCCeEEEEcCCCCCcccccchhhhhhhhcC
Confidence            999999985 89999999999999999999999999999998

>PF10276 zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule

Probab=99.80  E-value=3.7e-20  Score=110.82  Aligned_cols=39  Identities=51%  Similarity=1.140  Sum_probs=34.2

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCC-CceecCCCCcccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRYV   97 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~-~~~~CpYCG~ry~   97 (102)
                      ++++|+|||+++ ++|||||||+|+++ +++.|||||++|+
T Consensus         1 ~~~~v~CdG~~~-~lgHPrVyl~l~~~~~~~~CpYCg~~yv   40 (40)
T PF10276_consen    1 DGRRVSCDGGGG-ALGHPRVYLNLDDEPGPVVCPYCGTRYV   40 (40)
T ss_dssp             -SSEEEEEESST-TSCCCCEEEE-TTTTCEEEETTTTEEEE
T ss_pred             CCcEEEeCCCCC-CCCCCeEEEecCCCCCeEECCCCCCEEC
Confidence            478999999988 59999999999996 6799999999996

Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.

>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]

Probab=99.72  E-value=5.1e-18  Score=109.98  Aligned_cols=47  Identities=26%  Similarity=0.573  Sum_probs=42.9

Q ss_pred             CCCEEecCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccc
Q 034182           52 VPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        52 ~p~i~V~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      ...|.+++++++|+|.++| ++||||||+|.++++++|||||++|++.
T Consensus        15 ~~~I~~~~~~l~C~g~~~p-~~HPrV~L~mg~~gev~CPYC~t~y~l~   61 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPP-NDHPRVFLDMGDEGEVVCPYCSTRYRLN   61 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCC-CCCCEEEEEcCCCCcEecCccccEEEec
Confidence            3467789999999999985 9999999999999999999999999874

>PLN02294 cytochrome c oxidase subunit Vb

Probab=98.34  E-value=7.1e-07  Score=67.91  Aligned_cols=41  Identities=22%  Similarity=0.481  Sum_probs=37.3

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      +.|+|.|.|+.+ ...|-.+|+.|.+..+.+||.||..|+++
T Consensus       114 d~RiVGCtg~~~-eDsh~v~Wf~L~kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        114 DKRIVGCPGGEG-EDEHDVVWFWLEKGKSFECPVCTQYFELE  154 (174)
T ss_pred             CceEEeeCCCCC-CCCceeEEEEecCCCceeCCCCCCEEEEE
Confidence            699999999654 57999999999999999999999999986

>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb

Probab=98.16  E-value=3.1e-06  Score=58.80  Aligned_cols=41  Identities=24%  Similarity=0.543  Sum_probs=37.5

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccccC
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHH  101 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~h  101 (102)
                      +.|+|.|.|..+   .|-.+|+.|.+..+.+|+.||.-|+++++
T Consensus        54 ~~RiVGC~g~~~---~h~v~W~~l~~g~~~rC~eCG~~fkL~~v   94 (97)
T cd00924          54 DKRIVGCICEPD---SHDVIWMWLEKGKPKRCPECGHVFKLVDV   94 (97)
T ss_pred             CCeEEeeeCCCC---CceEEEEEEeCCCceeCCCCCcEEEEEEC
Confidence            699999999843   89999999999999999999999999865

Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes. It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane. The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome. Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region. Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A. The abnormally extended conformation is stable only in the CcO assembly.

>PF01215 COX5B: Cytochrome c oxidase subunit Vb This family consists of chains F and S ; InterPro: IPR002124 Cytochrome c oxidase (1

Probab=98.12  E-value=2.8e-06  Score=62.34  Aligned_cols=40  Identities=28%  Similarity=0.633  Sum_probs=35.0

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      +.|+|.|.|..+  ..|-.+|+.|.+..+.+||.||.-|+++
T Consensus        86 ~~RiVGC~g~~~--~sH~v~W~~l~~g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen   86 DERIVGCTGEPD--DSHDVIWFWLHKGKPQRCPECGQVFKLK  125 (136)
T ss_dssp             SCEEEEESSSTT---SSS-EEEEEETTSEEEETTTEEEEEEE
T ss_pred             CceEEeeccCCC--CcceeEEEEEeCCCccCCCCCCeEEEEE
Confidence            799999999854  6999999999998899999999999985

9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane. In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....

>PTZ00043 cytochrome c oxidase subunit; Provisional

Probab=97.90  E-value=1.4e-05  Score=63.86  Aligned_cols=43  Identities=16%  Similarity=0.226  Sum_probs=38.1

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccccC
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHH  101 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~h  101 (102)
                      +.|+|.|.|+.+ ...|-.+|+.+.+..+.+||.||..|+++++
T Consensus       154 deRyVGCTGg~~-EDeH~VvWFwLrEGkpqRCpECGqVFKLVr~  196 (268)
T PTZ00043        154 TERVVGCTGGTG-EHEHVPLWFRCREGFLYRCGECDQIFMLVRV  196 (268)
T ss_pred             CceEEeccCCCc-cCCceeEEEEecCCCCccCCCCCcEEEEEEE
Confidence            689999999755 4689999999998889999999999998763

>KOG3352 consensus Cytochrome c oxidase, subunit Vb/COX4 [Energy production and conversion]

Probab=97.64  E-value=5.2e-05  Score=56.81  Aligned_cols=40  Identities=28%  Similarity=0.528  Sum_probs=35.1

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCccccccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDH  100 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~  100 (102)
                      +-|+|.| |.+  ...|+.+|+-|.|.+..+||.||.-|+++.
T Consensus       108 d~RiVGC-~c~--eD~~~V~Wmwl~Kge~~rc~eCG~~fkL~~  147 (153)
T KOG3352|consen  108 DKRIVGC-GCE--EDSHAVVWMWLEKGETQRCPECGHYFKLVP  147 (153)
T ss_pred             CceEEee-ccc--CCCcceEEEEEEcCCcccCCcccceEEeee
Confidence            6899999 443  479999999999999999999999999874

>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues

Probab=96.61  E-value=0.00083  Score=47.35  Aligned_cols=21  Identities=29%  Similarity=0.819  Sum_probs=18.7

Q ss_pred             EEEcCCCCceecCCCCcccccc
Q 034182           78 FICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        78 yI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      |+.|++ .+++|||||+.|...
T Consensus        19 FYDLnk-~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   19 FYDLNK-DPIVCPKCGTEFPPE   39 (108)
T ss_pred             hccCCC-CCccCCCCCCccCcc
Confidence            999998 899999999999653

The function of members of this family is unknown.

>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300

Probab=94.73  E-value=0.013  Score=42.93  Aligned_cols=20  Identities=30%  Similarity=0.597  Sum_probs=17.8

Q ss_pred             EEEcCCCCceecCCCCccccc
Q 034182           78 FICLDLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        78 yI~Ld~~~~~~CpYCG~ry~~   98 (102)
                      |+.|++ .+++|||||..|..
T Consensus        19 FYDLnk-~p~vcP~cg~~~~~   38 (129)
T TIGR02300        19 FYDLNR-RPAVSPYTGEQFPP   38 (129)
T ss_pred             ccccCC-CCccCCCcCCccCc
Confidence            999997 79999999999854

Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.

>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional

Probab=93.45  E-value=0.063  Score=31.75  Aligned_cols=21  Identities=33%  Similarity=0.588  Sum_probs=15.1

Q ss_pred             EcCCCC-ceecCCCCccccccc
Q 034182           80 CLDLKE-PAICKYCGLRYVQDH  100 (102)
Q Consensus        80 ~Ld~~~-~~~CpYCG~ry~~~~  100 (102)
                      .++... ...|||||.++..++
T Consensus        14 ~~~~~~~~~~Cp~CG~~~~~~~   35 (46)
T PRK00398         14 ELDEYGTGVRCPYCGYRILFKE   35 (46)
T ss_pred             EECCCCCceECCCCCCeEEEcc
Confidence            344433 789999999987654

>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]

Probab=90.05  E-value=0.12  Score=37.68  Aligned_cols=21  Identities=29%  Similarity=0.627  Sum_probs=17.2

Q ss_pred             eEEEcCCCCceecCCCCccccc
Q 034182           77 EFICLDLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        77 VyI~Ld~~~~~~CpYCG~ry~~   98 (102)
                      -|++|++ .+++|||||..|-+
T Consensus        18 KFYDLNr-dPiVsPytG~s~P~   38 (129)
T COG4530          18 KFYDLNR-DPIVSPYTGKSYPR   38 (129)
T ss_pred             hhhccCC-CccccCcccccchH
Confidence            4888885 58999999999953

>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A

Probab=89.77  E-value=0.22  Score=26.33  Aligned_cols=15  Identities=33%  Similarity=0.999  Sum_probs=12.6

Q ss_pred             CCceecCCCCccccc
Q 034182           84 KEPAICKYCGLRYVQ   98 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~   98 (102)
                      +.+-.|++||..|..
T Consensus        12 ~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen   12 EKPYKCPYCGKSFSN   26 (26)
T ss_dssp             SSSEEESSSSEEESS
T ss_pred             CCCCCCCCCcCeeCc
Confidence            567899999999963

...

>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule

Probab=89.14  E-value=0.16  Score=25.29  Aligned_cols=12  Identities=25%  Similarity=0.797  Sum_probs=10.2

Q ss_pred             ecCCCCcccccc
Q 034182           88 ICKYCGLRYVQD   99 (102)
Q Consensus        88 ~CpYCG~ry~~~   99 (102)
                      .|++||..|...
T Consensus         2 ~C~~C~~~f~~~   13 (23)
T PF00096_consen    2 KCPICGKSFSSK   13 (23)
T ss_dssp             EETTTTEEESSH
T ss_pred             CCCCCCCccCCH
Confidence            699999999753

Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....

>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type

Probab=87.79  E-value=0.21  Score=26.52  Aligned_cols=12  Identities=25%  Similarity=0.805  Sum_probs=10.3

Q ss_pred             eecCCCCccccc
Q 034182           87 AICKYCGLRYVQ   98 (102)
Q Consensus        87 ~~CpYCG~ry~~   98 (102)
                      ..||+||++|..
T Consensus         3 ~~C~~CgR~F~~   14 (25)
T PF13913_consen    3 VPCPICGRKFNP   14 (25)
T ss_pred             CcCCCCCCEECH
Confidence            579999999964

>smart00659 RPOLCX RNA polymerase subunit CX

Probab=87.32  E-value=0.44  Score=28.60  Aligned_cols=19  Identities=26%  Similarity=0.592  Sum_probs=14.0

Q ss_pred             EcCCCCceecCCCCccccc
Q 034182           80 CLDLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        80 ~Ld~~~~~~CpYCG~ry~~   98 (102)
                      +++....+.|||||-+-..
T Consensus        13 ~~~~~~~irC~~CG~rIly   31 (44)
T smart00659       13 EIKSKDVVRCRECGYRILY   31 (44)
T ss_pred             ecCCCCceECCCCCceEEE
Confidence            4555678999999987543

present in RNA polymerase I, II and III

>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]

Probab=85.79  E-value=0.52  Score=29.37  Aligned_cols=16  Identities=31%  Similarity=0.665  Sum_probs=12.0

Q ss_pred             CCCceecCCCCccccc
Q 034182           83 LKEPAICKYCGLRYVQ   98 (102)
Q Consensus        83 ~~~~~~CpYCG~ry~~   98 (102)
                      ......|||||-+-..
T Consensus        21 ~~~~irCp~Cg~rIl~   36 (49)
T COG1996          21 ETRGIRCPYCGSRILV   36 (49)
T ss_pred             ccCceeCCCCCcEEEE
Confidence            3458899999987543

>PF13878 zf-C2H2_3: zinc-finger of acetyl-transferase ESCO

Probab=84.81  E-value=0.71  Score=27.14  Aligned_cols=21  Identities=29%  Similarity=0.653  Sum_probs=16.9

Q ss_pred             EEEcCCCC--ceecCCCCccccc
Q 034182           78 FICLDLKE--PAICKYCGLRYVQ   98 (102)
Q Consensus        78 yI~Ld~~~--~~~CpYCG~ry~~   98 (102)
                      .|+++...  ..+|+-||..|..
T Consensus         3 ~Ld~gq~~~~~~~C~~CgM~Y~~   25 (41)
T PF13878_consen    3 ILDLGQKSFGATTCPTCGMLYSP   25 (41)
T ss_pred             EEeCCCCccCCcCCCCCCCEECC
Confidence            57777654  7899999999974

>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A

Probab=84.75  E-value=0.48  Score=22.86  Aligned_cols=11  Identities=27%  Similarity=0.830  Sum_probs=7.8

Q ss_pred             ecCCCCccccc
Q 034182           88 ICKYCGLRYVQ   98 (102)
Q Consensus        88 ~CpYCG~ry~~   98 (102)
                      .|++||..|..
T Consensus         2 ~C~~C~~~~~~   12 (24)
T PF13894_consen    2 QCPICGKSFRS   12 (24)
T ss_dssp             E-SSTS-EESS
T ss_pred             CCcCCCCcCCc
Confidence            69999999975

...

>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule

Probab=84.02  E-value=0.72  Score=26.44  Aligned_cols=17  Identities=41%  Similarity=0.647  Sum_probs=10.6

Q ss_pred             CCCceecCCCCcccccc
Q 034182           83 LKEPAICKYCGLRYVQD   99 (102)
Q Consensus        83 ~~~~~~CpYCG~ry~~~   99 (102)
                      .+..+.|.||+..|...
T Consensus        13 ~~~~a~C~~C~~~~~~~   29 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYS   29 (45)
T ss_dssp             CSS-EEETTTTEE----
T ss_pred             CcCeEEeCCCCeEEeeC
Confidence            46789999999998753

Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target. This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.

>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []

Probab=80.72  E-value=1.7  Score=24.70  Aligned_cols=24  Identities=17%  Similarity=0.382  Sum_probs=18.4

Q ss_pred             CCCCceEEEcCCCCceecCCCCcccc
Q 034182           72 LGHPIEFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        72 lGHPrVyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      -+|+.||.  .+++.-.|+-||..|.
T Consensus         9 C~~~~i~~--~~~~~~~C~~Cg~~~~   32 (33)
T PF08792_consen    9 CGGNGIVN--KEDDYEVCIFCGSSFP   32 (33)
T ss_pred             CCCCeEEE--ecCCeEEcccCCcEee
Confidence            36777776  4456899999999885

---

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Length	Definition	E-value
Query	102
2jvm_A	80	Uncharacterized protein; alpha+beta, structural ge	7e-16
2jrr_A	67	Uncharacterized protein; solution structure, SIR90	6e-09
2jz8_A	87	Uncharacterized protein BH09830; zinc binding, str	6e-07

>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} Length = 80

 Score = 65.4 bits (159), Expect = 7e-16
 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 10/74 (13%)

Query: 38  QDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEP-AICKYCGLRY 96
               ++S    I     + V    VAC+G    ALGHP  ++ +  +     C YC  RY
Sbjct: 5   PKTRQESARMSIEAPETVVVSTWKVACDGG-EGALGHPRVWLSIPHETGFVECGYCDRRY 63

Query: 97  V--------QDHHH 102
           +         +HHH
Sbjct: 64  IHESFAAAKLEHHH 77

>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Length = 67

 Score = 47.3 bits (112), Expect = 6e-09
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 10/57 (17%)

Query: 55  IKVEGRIVACEGDSNPALGHPIEFICLDLKEPAI-CKYCGLRYVQ--------DHHH 102
             V+   VAC+G    ALGHP  ++ +      + C YC  +YV         +HHH
Sbjct: 9   KIVDKSRVACDGG-EGALGHPRVWLQIPEDTGWVECPYCDCKYVLKGSKADALEHHH 64

>2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str} Length = 87

 Score = 42.7 bits (100), Expect = 6e-07
 Identities = 13/49 (26%), Positives = 19/49 (38%), Gaps = 1/49 (2%)

Query: 52  VPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDH 100
              I++  +   C G +     HP  FI +   +  IC YC   Y  D 
Sbjct: 15  YKIIEIGVKEFMCVG-ATQPFDHPHIFIDMGSTDEKICPYCSTLYRYDP 62

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Length	Definition	Probability
Query	102
2jvm_A	80	Uncharacterized protein; alpha+beta, structural ge	99.87
2jz8_A	87	Uncharacterized protein BH09830; zinc binding, str	99.84
2jrr_A	67	Uncharacterized protein; solution structure, SIR90	99.83
2y69_F	129	Cytochrome C oxidase subunit 5B; electron transpor	98.66
2odx_A	80	Cytochrome C oxidase polypeptide IV; all beta-prot	98.39
1v54_F	98	VI, cytochrome C oxidase polypeptide VB; oxidoredu	98.37
2kvh_A	27	Zinc finger and BTB domain-containing protein 32;	88.5
2kvg_A	27	Zinc finger and BTB domain-containing protein 32;	87.38
2els_A	36	Zinc finger protein 406; ZFAT zinc finger 1, struc	87.38
1fv5_A	36	First zinc finger of U-shaped; CCHC, protein inter	86.88
2m0d_A	30	Zinc finger and BTB domain-containing protein 17;	86.49
2kvf_A	28	Zinc finger and BTB domain-containing protein 32;	86.36
1srk_A	35	Zinc finger protein ZFPM1; classical zinc finger,	86.13
2elp_A	37	Zinc finger protein 406; ZFAT zinc finger 1, struc	85.75
2elx_A	35	Zinc finger protein 406; ZFAT zinc finger 1, struc	85.71
1p7a_A	37	BF3, BKLF, kruppel-like factor 3; classical zinc f	85.51
2elt_A	36	Zinc finger protein 406; ZFAT zinc finger 1, struc	85.51
2lvu_A	26	Zinc finger and BTB domain-containing protein 17;	85.66
2lvr_A	30	Zinc finger and BTB domain-containing protein 17;	85.06
2m0f_A	29	Zinc finger and BTB domain-containing protein 17;	84.6
2elq_A	36	Zinc finger protein 406; ZFAT zinc finger 1, struc	84.5
1rik_A	29	E6APC1 peptide; E6-binding domain, zinc finger, hu	84.41
2elo_A	37	Zinc finger protein 406; ZFAT zinc finger 1, struc	84.18
1znf_A	27	31ST zinc finger from XFIN; zinc finger DNA bindin	83.95
1klr_A	30	Zinc finger Y-chromosomal protein; transcription;	83.45
2m0e_A	29	Zinc finger and BTB domain-containing protein 17;	83.05
2elm_A	37	Zinc finger protein 406; ZFAT zinc finger 1, struc	82.62
2elv_A	36	Zinc finger protein 406; ZFAT zinc finger 1, struc	82.47
2elr_A	36	Zinc finger protein 406; ZFAT zinc finger 1, struc	81.94
1ard_A	29	Yeast transcription factor ADR1; transcription reg	81.62
2yu5_A	44	Zinc finger protein 473; ZF-C2H2 domain, structura	81.35
2en2_A	42	B-cell lymphoma 6 protein; ZF-C2H2, structural gen	81.34
2lvt_A	29	Zinc finger and BTB domain-containing protein 17;	82.22
2djr_A	76	Zinc finger BED domain-containing protein 2; C2H2	81.24
1njq_A	39	Superman protein; zinc-finger, peptide-zinc comple	80.79
4ayb_P	48	DNA-directed RNA polymerase; transferase, multi-su	80.75
2ept_A	41	Zinc finger protein 32; C2H2, zinc finger domain,	80.46
2eox_A	44	Zinc finger protein 473; ZF-C2H2, structural genom	80.4
1paa_A	30	Yeast transcription factor ADR1; transcription reg	80.31
2el5_A	42	Zinc finger protein 268; alternative splicing, DNA	80.29
2epv_A	44	Zinc finger protein 268; C2H2, zinc finger domain,	80.2
3h0g_L	63	DNA-directed RNA polymerases I, II, and III subuni	80.19
2eoz_A	46	Zinc finger protein 473; ZF-C2H2, structural genom	80.16
2en3_A	46	ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s	80.05

>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2}

Probab=99.87  E-value=1.8e-22  Score=135.35  Aligned_cols=55  Identities=31%  Similarity=0.646  Sum_probs=45.4

Q ss_pred             ChhhhhccCC-CEEecCeEEeecCCCCCCCCCCceEEEc-CCCCceecCCCCcccccc
Q 034182           44 SPMELINEVP-PIKVEGRIVACEGDSNPALGHPIEFICL-DLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        44 ~a~elI~e~p-~i~V~~~~v~CdG~~~palGHPrVyI~L-d~~~~~~CpYCG~ry~~~   99 (102)
                      .+.++..+.| +|+|++++|+|||+++ +||||||||+| ++++++.|||||++|+++
T Consensus        10 ~~a~m~~~apevI~V~~~~V~CdGg~g-~LGHPrVyL~ld~~~g~~~CpYCg~~f~l~   66 (80)
T 2jvm_A           10 ESARMSIEAPETVVVSTWKVACDGGEG-ALGHPRVWLSIPHETGFVECGYCDRRYIHE   66 (80)
T ss_dssp             CCCCCCCSCCSEEEESCSEEEECCCST-TCCCCCEEEECCTTTCEEECSSSSCEEEEH
T ss_pred             hccccccCCCCeEEECCcEEEcCCCCC-CCCCCEEEEEccCCCCeEECCCCCCEEEec
Confidence            3434444445 5679999999999998 59999999999 477899999999999974

>2jz8_A Uncharacterized protein BH09830; zinc binding, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Bartonella henselae str}

Probab=99.84  E-value=9.4e-22  Score=133.65  Aligned_cols=51  Identities=27%  Similarity=0.507  Sum_probs=47.3

Q ss_pred             hccCCCEEecCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCccccccc
Q 034182           49 INEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDH  100 (102)
Q Consensus        49 I~e~p~i~V~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~  100 (102)
                      .+++++|+|+.+.|+|||++++ ||||||||+|++++++.|||||++|+++.
T Consensus        12 ~~~~~~IeV~~~~v~CdG~~~p-lgHPrVyL~i~~~g~~~CpYCg~~y~~~~   62 (87)
T 2jz8_A           12 DLGYKIIEIGVKEFMCVGATQP-FDHPHIFIDMGSTDEKICPYCSTLYRYDP   62 (87)
T ss_dssp             SSCCSEEECSCSEEECCCSSCS-SSSSSCEEECTTCCEECCTTTCCEEECCT
T ss_pred             CCCCCeEEEcCcEEEcCCCCCC-CCCCEEEEEcCCCCeEECCCCCCEeEcCC
Confidence            3478999999999999999985 99999999999999999999999999865

>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi}

Probab=99.83  E-value=1.1e-21  Score=127.71  Aligned_cols=46  Identities=33%  Similarity=0.600  Sum_probs=41.4

Q ss_pred             CCEEecCeEEeecCCCCCCCCCCceEEEcC-CCCceecCCCCcccccc
Q 034182           53 PPIKVEGRIVACEGDSNPALGHPIEFICLD-LKEPAICKYCGLRYVQD   99 (102)
Q Consensus        53 p~i~V~~~~v~CdG~~~palGHPrVyI~Ld-~~~~~~CpYCG~ry~~~   99 (102)
                      ++|+|++++|+|||+++ +||||||||+|| +++++.|||||++|+++
T Consensus         7 e~i~v~~r~v~CdGg~g-~lgHPrVyl~ld~~~g~~~CpYCg~~f~l~   53 (67)
T 2jrr_A            7 ETKIVDKSRVACDGGEG-ALGHPRVWLQIPEDTGWVECPYCDCKYVLK   53 (67)
T ss_dssp             EEEEESSSEEEEEESST-TSEEEEEEEECCTTTSEEEETTTTEEEEET
T ss_pred             ceEEECCCEEEeCCCCC-CCCCCEEEEEccCCCCeEECCCCCCEEEEC
Confidence            45679999999999998 599999999995 67899999999999975

>2y69_F Cytochrome C oxidase subunit 5B; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus}

Probab=98.66  E-value=2.5e-08  Score=71.57  Aligned_cols=47  Identities=28%  Similarity=0.434  Sum_probs=40.3

Q ss_pred             CCCEEe----cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccccC
Q 034182           52 VPPIKV----EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHH  101 (102)
Q Consensus        52 ~p~i~V----~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~h  101 (102)
                      .-||.|    +.|+|.|.|.   ...|-.+|+.|.+..+.+||.||.-|++++|
T Consensus        75 edP~lVpS~~d~RiVGC~~~---~Dsh~v~Wf~L~kg~p~RCpeCG~~fkL~~~  125 (129)
T 2y69_F           75 EDPNLVPSITNKRIVGCICE---EDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH  125 (129)
T ss_dssp             SSCEEEEESSSEEEEEECCS---TTCSCCEEEEEESSSCEECTTTCCEEEEEEC
T ss_pred             cCCeEeecCCCCeEEeecCC---CCCceeEEEEEeCCCceeCCCCCeEEEEeee
Confidence            345555    6899999985   3699999999999889999999999999875

>2odx_A Cytochrome C oxidase polypeptide IV; all beta-protein, metallo-protein, oxidoreductase; NMR {Saccharomyces cerevisiae}

Probab=98.39  E-value=3.3e-07  Score=60.78  Aligned_cols=40  Identities=35%  Similarity=0.591  Sum_probs=36.6

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      +.|+|.|.|.  |...|-.+|+.|.+..+.+||.||..|+++
T Consensus        30 ~~RiVGC~g~--p~d~h~v~W~~l~~g~~~RC~eCG~~fkL~   69 (80)
T 2odx_A           30 DYRYVGCTGS--PAGSHTIMWLKPTVNEVARCWECGSVYKLN   69 (80)
T ss_dssp             SSCCEEESSS--TTCCSCCEEECCCTTCEEECSSSCCEEEEC
T ss_pred             CCeEEeeeCC--CCCcceEEEEEecCCCCeECCCCCeEEEEE
Confidence            6999999998  357999999999999899999999999975

>1v54_F VI, cytochrome C oxidase polypeptide VB; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: g.41.5.3 PDB: 1oco_F* 1occ_F* 1ocz_F* 1ocr_F* 1v55_F* 2dyr_F* 2dys_F* 2eij_F* 2eik_F* 2eil_F* 2eim_F* 2ein_F* 2occ_F* 2ybb_Q* 2zxw_F* 3abk_F* 3abl_F* 3abm_F* 3ag1_F* 3ag2_F* ...

Probab=98.37  E-value=4.6e-07  Score=62.06  Aligned_cols=46  Identities=28%  Similarity=0.457  Sum_probs=39.6

Q ss_pred             CCEEe----cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccccC
Q 034182           53 PPIKV----EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHH  101 (102)
Q Consensus        53 p~i~V----~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~h  101 (102)
                      -|+.|    +.|+|.|.+.   ...|-.+|+.|.+..+.+||.||.-|++++|
T Consensus        45 ~P~lVpS~~~~RiVGC~~~---~D~h~v~W~~l~~g~~~RC~eCG~~fkL~~~   94 (98)
T 1v54_F           45 DPNLVPSITNKRIVGCICE---EDNSTVIWFWLHKGEAQRCPSCGTHYKLVPH   94 (98)
T ss_dssp             SCEEEECSSSEEEEEECCS---TTCSCCEEEEEESSSCEECTTTCCEEEEECC
T ss_pred             CCeEeecCCCCeEEeecCC---CCCceeEEEEEeCCCceECCCCCeEEEEeee
Confidence            35555    6899999986   3699999999999889999999999999875

>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}

Probab=88.50  E-value=0.22  Score=23.24  Aligned_cols=15  Identities=27%  Similarity=0.485  Sum_probs=12.1

Q ss_pred             CceecCCCCcccccc
Q 034182           85 EPAICKYCGLRYVQD   99 (102)
Q Consensus        85 ~~~~CpYCG~ry~~~   99 (102)
                      .+-.|++||..|...
T Consensus         2 k~~~C~~C~k~f~~~   16 (27)
T 2kvh_A            2 KPFSCSLCPQRSRDF   16 (27)
T ss_dssp             CCEECSSSSCEESSH
T ss_pred             cCccCCCcChhhCCH
Confidence            356899999999753

>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}

Probab=87.38  E-value=0.22  Score=23.51  Aligned_cols=15  Identities=20%  Similarity=0.359  Sum_probs=12.0

Q ss_pred             CceecCCCCcccccc
Q 034182           85 EPAICKYCGLRYVQD   99 (102)
Q Consensus        85 ~~~~CpYCG~ry~~~   99 (102)
                      .+-.|++||..|...
T Consensus         2 k~~~C~~C~k~f~~~   16 (27)
T 2kvg_A            2 APYRCPLCRAGCPSL   16 (27)
T ss_dssp             CTEEETTTTEEESCH
T ss_pred             cCcCCCCCCcccCCH
Confidence            356899999999753

>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}

Probab=87.38  E-value=0.25  Score=24.65  Aligned_cols=16  Identities=19%  Similarity=0.505  Sum_probs=12.8

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (36)
T 2els_A            7 GKIFTCEYCNKVFKFK   22 (36)
T ss_dssp             CCCEECTTTCCEESSH
T ss_pred             CCCEECCCCCceeCCH
Confidence            3567899999999753

>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B

Probab=86.88  E-value=0.17  Score=27.69  Aligned_cols=19  Identities=21%  Similarity=0.471  Sum_probs=15.4

Q ss_pred             cCCCCceecCCCCcccccc
Q 034182           81 LDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        81 Ld~~~~~~CpYCG~ry~~~   99 (102)
                      +..+.+-.|+.||+.|...
T Consensus         3 ~~gekp~~C~~CgK~F~~~   21 (36)
T 1fv5_A            3 LLKPARFMCLPCGIAFSSP   21 (36)
T ss_dssp             SSSCCCCEETTTTEECSCH
T ss_pred             CCCccCeECCCCCCccCCH
Confidence            3456788999999999864

>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}

Probab=86.49  E-value=0.32  Score=22.58  Aligned_cols=14  Identities=36%  Similarity=1.075  Sum_probs=11.6

Q ss_pred             CceecCCCCccccc
Q 034182           85 EPAICKYCGLRYVQ   98 (102)
Q Consensus        85 ~~~~CpYCG~ry~~   98 (102)
                      .+-.|++||..|..
T Consensus         2 k~~~C~~C~~~f~~   15 (30)
T 2m0d_A            2 KPYQCDYCGRSFSD   15 (30)
T ss_dssp             CCEECTTTCCEESC
T ss_pred             cCccCCCCCcccCC
Confidence            45689999999975

>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus}

Probab=86.36  E-value=0.3  Score=22.74  Aligned_cols=15  Identities=33%  Similarity=0.849  Sum_probs=12.0

Q ss_pred             CceecCCCCcccccc
Q 034182           85 EPAICKYCGLRYVQD   99 (102)
Q Consensus        85 ~~~~CpYCG~ry~~~   99 (102)
                      .+-.|++||..|...
T Consensus         2 k~~~C~~C~k~f~~~   16 (28)
T 2kvf_A            2 RPYSCSVCGKRFSLK   16 (28)
T ss_dssp             CSEECSSSCCEESCH
T ss_pred             cCccCCCCCcccCCH
Confidence            356899999999753

>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1

Probab=86.13  E-value=0.32  Score=23.95  Aligned_cols=16  Identities=25%  Similarity=0.739  Sum_probs=12.9

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         5 ~k~~~C~~C~k~f~~~   20 (35)
T 1srk_A            5 KRPFVCRICLSAFTTK   20 (35)
T ss_dssp             CSCEECSSSCCEESSH
T ss_pred             CcCeeCCCCCcccCCH
Confidence            4567899999999753

>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}

Probab=85.75  E-value=0.42  Score=23.88  Aligned_cols=16  Identities=19%  Similarity=0.785  Sum_probs=13.2

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (37)
T 2elp_A            7 GRAMKCPYCDFYFMKN   22 (37)
T ss_dssp             CCCEECSSSSCEECSS
T ss_pred             CCCeECCCCChhhccC
Confidence            4567999999999865

>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}

Probab=85.71  E-value=0.36  Score=23.57  Aligned_cols=16  Identities=19%  Similarity=0.575  Sum_probs=12.9

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         5 ~k~~~C~~C~k~f~~~   20 (35)
T 2elx_A            5 SSGYVCALCLKKFVSS   20 (35)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CCCeECCCCcchhCCH
Confidence            4567899999999763

>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A

Probab=85.51  E-value=0.32  Score=24.24  Aligned_cols=16  Identities=19%  Similarity=0.540  Sum_probs=12.9

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         9 ~k~~~C~~C~k~f~~~   24 (37)
T 1p7a_A            9 IKPFQCPDCDRSFSRS   24 (37)
T ss_dssp             SSSBCCTTTCCCBSSH
T ss_pred             CCCccCCCCCcccCcH
Confidence            4577899999999753

>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}

Probab=85.51  E-value=0.38  Score=23.74  Aligned_cols=16  Identities=19%  Similarity=0.432  Sum_probs=13.0

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (36)
T 2elt_A            7 GKPYKCPQCSYASAIK   22 (36)
T ss_dssp             CCSEECSSSSCEESSH
T ss_pred             CCCCCCCCCCcccCCH
Confidence            4578999999999753

>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}

Probab=85.66  E-value=0.16  Score=23.52  Aligned_cols=14  Identities=50%  Similarity=1.232  Sum_probs=11.2

Q ss_pred             ceecCCCCcccccc
Q 034182           86 PAICKYCGLRYVQD   99 (102)
Q Consensus        86 ~~~CpYCG~ry~~~   99 (102)
                      +-.|++||..|...
T Consensus         2 p~~C~~C~k~f~~~   15 (26)
T 2lvu_A            2 PYVCERCGKRFVQS   15 (26)
Confidence            34799999999864

>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens}

Probab=85.06  E-value=0.18  Score=23.68  Aligned_cols=14  Identities=21%  Similarity=0.736  Sum_probs=11.3

Q ss_pred             ceecCCCCcccccc
Q 034182           86 PAICKYCGLRYVQD   99 (102)
Q Consensus        86 ~~~CpYCG~ry~~~   99 (102)
                      +-.|++||..|...
T Consensus         3 ~~~C~~C~k~f~~~   16 (30)
T 2lvr_A            3 PYVCIHCQRQFADP   16 (30)
Confidence            45799999999753

>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}

Probab=84.60  E-value=0.41  Score=22.06  Aligned_cols=13  Identities=31%  Similarity=0.984  Sum_probs=10.8

Q ss_pred             ceecCCCCccccc
Q 034182           86 PAICKYCGLRYVQ   98 (102)
Q Consensus        86 ~~~CpYCG~ry~~   98 (102)
                      +-.|++||..|..
T Consensus         2 ~~~C~~C~k~f~~   14 (29)
T 2m0f_A            2 PLKCRECGKQFTT   14 (29)
T ss_dssp             CEECTTTSCEESC
T ss_pred             CccCCCCCCccCC
Confidence            4579999999974

>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}

Probab=84.50  E-value=0.44  Score=23.63  Aligned_cols=16  Identities=19%  Similarity=0.455  Sum_probs=13.0

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (36)
T 2elq_A            7 GKPFKCSLCEYATRSK   22 (36)
T ss_dssp             CCSEECSSSSCEESCH
T ss_pred             CCCccCCCCCchhCCH
Confidence            4578999999999753

>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A

Probab=84.41  E-value=0.46  Score=22.04  Aligned_cols=14  Identities=21%  Similarity=0.612  Sum_probs=11.3

Q ss_pred             ceecCCCCcccccc
Q 034182           86 PAICKYCGLRYVQD   99 (102)
Q Consensus        86 ~~~CpYCG~ry~~~   99 (102)
                      +-.|++||..|...
T Consensus         2 ~~~C~~C~k~f~~~   15 (29)
T 1rik_A            2 KFACPECPKRFMRS   15 (29)
T ss_dssp             CEECSSSSCEESCS
T ss_pred             CccCCCCCchhCCH
Confidence            35799999999754

>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}

Probab=84.18  E-value=0.37  Score=23.99  Aligned_cols=16  Identities=19%  Similarity=0.509  Sum_probs=12.9

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (37)
T 2elo_A            7 GRSYSCPVCEKSFSED   22 (37)
T ss_dssp             CCCCEETTTTEECSSH
T ss_pred             CCCcCCCCCCCccCCH
Confidence            4567899999999764

>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1

Probab=83.95  E-value=0.32  Score=22.33  Aligned_cols=13  Identities=23%  Similarity=0.644  Sum_probs=10.5

Q ss_pred             eecCCCCcccccc
Q 034182           87 AICKYCGLRYVQD   99 (102)
Q Consensus        87 ~~CpYCG~ry~~~   99 (102)
                      -.|++||..|...
T Consensus         2 ~~C~~C~k~f~~~   14 (27)
T 1znf_A            2 YKCGLCERSFVEK   14 (27)
T ss_dssp             CBCSSSCCBCSSH
T ss_pred             ccCCCCCCcCCCH
Confidence            3699999999753

>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A

Probab=83.45  E-value=0.42  Score=22.11  Aligned_cols=13  Identities=31%  Similarity=0.864  Sum_probs=10.8

Q ss_pred             eecCCCCcccccc
Q 034182           87 AICKYCGLRYVQD   99 (102)
Q Consensus        87 ~~CpYCG~ry~~~   99 (102)
                      -.|++||..|...
T Consensus         3 ~~C~~C~k~f~~~   15 (30)
T 1klr_A            3 YQCQYCEFRSADS   15 (30)
T ss_dssp             CCCSSSSCCCSCS
T ss_pred             ccCCCCCCccCCH
Confidence            4799999999753

>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens}

Probab=83.05  E-value=0.43  Score=21.88  Aligned_cols=14  Identities=21%  Similarity=0.482  Sum_probs=11.0

Q ss_pred             ceecCCCCcccccc
Q 034182           86 PAICKYCGLRYVQD   99 (102)
Q Consensus        86 ~~~CpYCG~ry~~~   99 (102)
                      +-.|++||..|...
T Consensus         2 ~~~C~~C~~~f~~~   15 (29)
T 2m0e_A            2 EHKCPHCDKKFNQV   15 (29)
T ss_dssp             CCCCSSCCCCCCTT
T ss_pred             CCcCCCCCcccCCH
Confidence            35799999999753

>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}

Probab=82.62  E-value=0.51  Score=23.86  Aligned_cols=16  Identities=13%  Similarity=0.326  Sum_probs=13.1

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (37)
T 2elm_A            7 GHLYYCSQCHYSSITK   22 (37)
T ss_dssp             SCEEECSSSSCEEECH
T ss_pred             CcCeECCCCCcccCCH
Confidence            4578899999999764

>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}

Probab=82.47  E-value=0.59  Score=23.13  Aligned_cols=16  Identities=13%  Similarity=0.360  Sum_probs=12.9

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         7 ~k~~~C~~C~k~f~~~   22 (36)
T 2elv_A            7 GLLYDCHICERKFKNE   22 (36)
T ss_dssp             CCCEECSSSCCEESSH
T ss_pred             CCCeECCCCCCccCCH
Confidence            3567899999999753

>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}

Probab=81.94  E-value=0.53  Score=23.16  Aligned_cols=16  Identities=19%  Similarity=0.767  Sum_probs=12.8

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         7 ~~~~~C~~C~k~f~~~   22 (36)
T 2elr_A            7 GKTHLCDMCGKKFKSK   22 (36)
T ss_dssp             CSSCBCTTTCCBCSSH
T ss_pred             CCCeecCcCCCCcCch
Confidence            3567899999999753

>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A

Probab=81.62  E-value=0.43  Score=22.08  Aligned_cols=13  Identities=15%  Similarity=0.708  Sum_probs=10.7

Q ss_pred             eecCCCCcccccc
Q 034182           87 AICKYCGLRYVQD   99 (102)
Q Consensus        87 ~~CpYCG~ry~~~   99 (102)
                      -.|++||..|...
T Consensus         3 ~~C~~C~~~f~~~   15 (29)
T 1ard_A            3 FVCEVCTRAFARQ   15 (29)
T ss_dssp             CBCTTTCCBCSSH
T ss_pred             eECCCCCcccCCH
Confidence            5799999999753

>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}

Probab=81.35  E-value=0.79  Score=23.77  Aligned_cols=16  Identities=25%  Similarity=0.619  Sum_probs=13.3

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (44)
T 2yu5_A           10 ENPFKCSKCDRVFTQR   25 (44)
T ss_dssp             CCSEECSSSSCEESSS
T ss_pred             CCCeECCCCCchhCCH
Confidence            4578999999999864

>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1

Probab=81.34  E-value=0.61  Score=23.90  Aligned_cols=16  Identities=44%  Similarity=0.966  Sum_probs=13.1

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         9 ~k~~~C~~C~k~f~~~   24 (42)
T 2en2_A            9 EKPYKCETCGARFVQV   24 (42)
T ss_dssp             SCSEECTTTCCEESSH
T ss_pred             CCCEeCCCcChhhCCH
Confidence            4578999999999753

>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens}

Probab=82.22  E-value=0.3  Score=22.94  Aligned_cols=13  Identities=31%  Similarity=0.797  Sum_probs=10.7

Q ss_pred             eecCCCCcccccc
Q 034182           87 AICKYCGLRYVQD   99 (102)
Q Consensus        87 ~~CpYCG~ry~~~   99 (102)
                      -.|++||..|...
T Consensus         3 ~~C~~C~k~f~~~   15 (29)
T 2lvt_A            3 CQCVMCGKAFTQA   15 (29)
Confidence            4799999999753

>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}

Probab=81.24  E-value=0.72  Score=29.74  Aligned_cols=13  Identities=31%  Similarity=0.766  Sum_probs=11.5

Q ss_pred             CceecCCCCcccc
Q 034182           85 EPAICKYCGLRYV   97 (102)
Q Consensus        85 ~~~~CpYCG~ry~   97 (102)
                      ..++|.||+..|.
T Consensus        27 ~~A~Ck~C~k~ls   39 (76)
T 2djr_A           27 QYATCRLCGRQVS   39 (76)
T ss_dssp             SCEEESSSCCBCC
T ss_pred             CEEECCCCCCccC
Confidence            4799999999986

>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A

Probab=80.79  E-value=0.66  Score=23.55  Aligned_cols=16  Identities=13%  Similarity=0.536  Sum_probs=12.8

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         4 ~k~~~C~~C~k~f~~~   19 (39)
T 1njq_A            4 PRSYTCSFCKREFRSA   19 (39)
T ss_dssp             SSSEECTTTCCEESSH
T ss_pred             CCceECCCCCcccCCH
Confidence            3567899999999753

>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X

Probab=80.75  E-value=0.42  Score=28.96  Aligned_cols=13  Identities=31%  Similarity=0.961  Sum_probs=10.1

Q ss_pred             CceecCCCCcccc
Q 034182           85 EPAICKYCGLRYV   97 (102)
Q Consensus        85 ~~~~CpYCG~ry~   97 (102)
                      -.+.|||||-+-.
T Consensus        22 P~IrCpyCGyrii   34 (48)
T 4ayb_P           22 PGVRCPYCGYKII   34 (48)
T ss_dssp             SSSCCTTTCCSCE
T ss_pred             CCcccCccCcEEE
Confidence            3688999997754

>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}

Probab=80.46  E-value=0.75  Score=23.49  Aligned_cols=16  Identities=25%  Similarity=0.576  Sum_probs=12.9

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         8 ~k~~~C~~C~k~f~~~   23 (41)
T 2ept_A            8 QRVYECQECGKSFRQK   23 (41)
T ss_dssp             CCCEECSSSCCEESSH
T ss_pred             CCCeECCCCCCCcCCH
Confidence            4577899999999753

>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1

Probab=80.40  E-value=0.79  Score=23.77  Aligned_cols=16  Identities=19%  Similarity=0.511  Sum_probs=13.2

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus        10 ~~~~~C~~C~k~F~~~   25 (44)
T 2eox_A           10 SKSYNCNECGKAFTRI   25 (44)
T ss_dssp             CCCEEETTTTEEESSS
T ss_pred             CCCeECcccCcccCCH
Confidence            4578999999999764

>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1

Probab=80.31  E-value=0.6  Score=21.81  Aligned_cols=13  Identities=15%  Similarity=0.585  Sum_probs=10.7

Q ss_pred             eecCCCCcccccc
Q 034182           87 AICKYCGLRYVQD   99 (102)
Q Consensus        87 ~~CpYCG~ry~~~   99 (102)
                      -.|++||..|...
T Consensus         3 ~~C~~C~k~f~~~   15 (30)
T 1paa_A            3 YACGLCNRAFTRR   15 (30)
T ss_dssp             SBCTTTCCBCSSS
T ss_pred             cCCcccCcccCCh
Confidence            4799999999753

>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A

Probab=80.29  E-value=0.75  Score=23.54  Aligned_cols=16  Identities=25%  Similarity=0.708  Sum_probs=13.0

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus         8 ~k~~~C~~C~k~f~~~   23 (42)
T 2el5_A            8 ENPYECSECGKAFNRK   23 (42)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CCCccCCCcChhhCCH
Confidence            4578999999999753

>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1

Probab=80.20  E-value=0.77  Score=23.99  Aligned_cols=16  Identities=25%  Similarity=0.752  Sum_probs=13.1

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (44)
T 2epv_A           10 EKPYECNECGKAFIWK   25 (44)
T ss_dssp             CCSEECSSSCCEESSH
T ss_pred             CcCeECCCCCcccCch
Confidence            4578999999999753

>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe}

Probab=80.19  E-value=0.54  Score=29.60  Aligned_cols=17  Identities=35%  Similarity=0.634  Sum_probs=13.1

Q ss_pred             CCCceecCCCCcccccc
Q 034182           83 LKEPAICKYCGLRYVQD   99 (102)
Q Consensus        83 ~~~~~~CpYCG~ry~~~   99 (102)
                      ......|||||-|...+
T Consensus        35 ~~~~iRC~~CG~RILyK   51 (63)
T 3h0g_L           35 AKEVIRCRECGHRVMYK   51 (63)
T ss_dssp             SSSCCCCSSSCCCCCBC
T ss_pred             CCCceECCCCCcEEEEE
Confidence            34579999999887654

>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1

Probab=80.16  E-value=0.67  Score=24.38  Aligned_cols=16  Identities=31%  Similarity=0.833  Sum_probs=13.2

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus        10 ~k~~~C~~C~k~f~~~   25 (46)
T 2eoz_A           10 EKPYSCNVCGKAFVLS   25 (46)
T ss_dssp             CCSEEETTTTEEESSH
T ss_pred             CCCeECcccChhhCCH
Confidence            4578999999999864

>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1

Probab=80.05  E-value=0.91  Score=23.74  Aligned_cols=16  Identities=31%  Similarity=0.852  Sum_probs=13.2

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|...
T Consensus        10 ~k~~~C~~C~k~F~~~   25 (46)
T 2en3_A           10 EKPFQCKECGMNFSWS   25 (46)
T ss_dssp             CCSEECSSSCCEESSS
T ss_pred             CCCeeCcccChhhCCH
Confidence            4578999999999754

---

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Length	Definition	Probability
Query	102
d1v54f_	98	Cytochrome c oxidase Subunit F {Cow (Bos taurus) [	98.57
d1wjpa2	26	Zinc finger protein 295, ZNF295 {Human (Homo sapie	96.41
d1a1ia2	28	ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	91.94
d2ct1a2	36	Transcriptional repressor CTCF {Human (Homo sapien	91.1
d2adra1	29	ADR1 {Synthetic, based on Saccharomyces cerevisiae	90.62
d1srka_	35	Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc	90.44
d1sp1a_	29	Transcription factor sp1 {Human (Homo sapiens) [Ta	89.81
d1x6ea1	33	Zinc finger protein 24 {Human (Homo sapiens) [TaxI	88.09
d2epqa1	32	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	87.32
d2cota2	38	Zinc finger and SCAN domain-containing protein 16,	85.3
d1x6ha2	36	Transcriptional repressor CTCF {Human (Homo sapien	84.98
d1p7aa_	37	Kruppel-like factor 3, Bklf {Mouse (Mus musculus)	84.9
d1vq0a2	57	HSP33, C-terminal domain {Thermotoga maritima [Tax	82.83
d2epsa1	39	PATZ1 {Human (Homo sapiens) [TaxId: 9606]}	82.34
d1ncsa_	47	SWI5 zinc-finger domains {Baker's yeast (Saccharom	82.12
d1xjha_	62	HSP33, C-terminal domain {Escherichia coli [TaxId:	81.43
d1zfda_	32	SWI5 zinc-finger domains {Baker's yeast (Saccharom	81.29
d1bboa1	28	Enhancer binding protein {Human (Homo sapiens) [Ta	81.05
d2glia3	30	Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960	80.93
d1a1ia3	28	ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}	80.28

>d1v54f_ g.41.5.3 (F:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}

class: Small proteins
fold: Rubredoxin-like
superfamily: Rubredoxin-like
family: Cytochrome c oxidase Subunit F
domain: Cytochrome c oxidase Subunit F
species: Cow (Bos taurus) [TaxId: 9913]

Probab=98.57  E-value=3.5e-08  Score=66.24  Aligned_cols=42  Identities=26%  Similarity=0.468  Sum_probs=38.1

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccccCC
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHHH  102 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~hh  102 (102)
                      +.|+|.|.++   ..+|..+|+.|.+..+.+|+.||.-|++++|+
T Consensus        54 ~~RiVGC~~~---~D~h~v~W~~l~~g~p~RC~eCG~~fkL~~~~   95 (98)
T d1v54f_          54 NKRIVGCICE---EDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQ   95 (98)
T ss_dssp             SEEEEEECCS---TTCSCCEEEEEESSSCEECTTTCCEEEEECCC
T ss_pred             CceEEeecCC---CCCceeEEEEEeCCCCcccCCCCcEEEEeecc
Confidence            6899999984   37999999999998899999999999999874

>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 295, ZNF295
species: Human (Homo sapiens) [TaxId: 9606]

Probab=96.41  E-value=0.00036  Score=36.14  Aligned_cols=12  Identities=50%  Similarity=1.392  Sum_probs=10.2

Q ss_pred             eecCCCCccccc
Q 034182           87 AICKYCGLRYVQ   98 (102)
Q Consensus        87 ~~CpYCG~ry~~   98 (102)
                      ++||||++||-.
T Consensus         1 avcpycslrf~s   12 (26)
T d1wjpa2           1 AVCPYCSLRFFS   12 (26)
T ss_dssp             BCCTTTCCCBSS
T ss_pred             CCCCcceeeeCC
Confidence            479999999964

>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: ZIF268
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=91.94  E-value=0.018  Score=29.66  Aligned_cols=17  Identities=18%  Similarity=0.632  Sum_probs=13.8

Q ss_pred             CCceecCCCCccccccc
Q 034182           84 KEPAICKYCGLRYVQDH  100 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~~  100 (102)
                      +.+-.|++||+.|.+..
T Consensus         1 EKPy~C~~C~k~F~~~~   17 (28)
T d1a1ia2           1 QKPFQCRICMRNFSRSD   17 (28)
T ss_dssp             CCCEECTTTCCEESCHH
T ss_pred             CcCccCCCCcCEecccc
Confidence            35678999999998754

>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=91.10  E-value=0.027  Score=30.22  Aligned_cols=17  Identities=29%  Similarity=0.614  Sum_probs=14.2

Q ss_pred             CCCceecCCCCcccccc
Q 034182           83 LKEPAICKYCGLRYVQD   99 (102)
Q Consensus        83 ~~~~~~CpYCG~ry~~~   99 (102)
                      .+.+-.|++||..|.+.
T Consensus         5 gekP~~C~~C~k~F~~~   21 (36)
T d2ct1a2           5 GEKPYECYICHARFTQS   21 (36)
T ss_dssp             CCCSEECTTTCCEESCH
T ss_pred             CCCCEeCCCCcccccch
Confidence            35688999999999864

>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: ADR1
species: Synthetic, based on Saccharomyces cerevisiae sequence

Probab=90.62  E-value=0.024  Score=29.25  Aligned_cols=15  Identities=13%  Similarity=0.631  Sum_probs=12.3

Q ss_pred             ceecCCCCccccccc
Q 034182           86 PAICKYCGLRYVQDH  100 (102)
Q Consensus        86 ~~~CpYCG~ry~~~~  100 (102)
                      +-.|++||+.|.+..
T Consensus         2 p~~C~~C~k~F~~~~   16 (29)
T d2adra1           2 SFVCEVCTRAFARQE   16 (29)
T ss_dssp             CBCCTTTCCCBSCHH
T ss_pred             cCCCCCCCCCCCCch
Confidence            457999999998754

>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein ZFPM1 (FOG-1)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=90.44  E-value=0.034  Score=29.85  Aligned_cols=16  Identities=25%  Similarity=0.739  Sum_probs=13.9

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||+.|.+.
T Consensus         5 ekPy~C~~C~k~F~~~   20 (35)
T d1srka_           5 KRPFVCRICLSAFTTK   20 (35)
T ss_dssp             CSCEECSSSCCEESSH
T ss_pred             CccccCCCCCCcccCh
Confidence            5688999999999875

>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcription factor sp1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=89.81  E-value=0.029  Score=28.99  Aligned_cols=15  Identities=20%  Similarity=0.580  Sum_probs=12.2

Q ss_pred             ceecCCCCccccccc
Q 034182           86 PAICKYCGLRYVQDH  100 (102)
Q Consensus        86 ~~~CpYCG~ry~~~~  100 (102)
                      +-.|++||+.|.+..
T Consensus         2 py~C~~C~k~F~~~s   16 (29)
T d1sp1a_           2 KFACPECPKRFMRSD   16 (29)
T ss_dssp             CSCCTTTTCCCSCSH
T ss_pred             CEECCcCCCeecchH
Confidence            347999999998764

>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]

Probab=88.09  E-value=0.098  Score=27.61  Aligned_cols=17  Identities=24%  Similarity=0.540  Sum_probs=14.2

Q ss_pred             CCCceecCCCCcccccc
Q 034182           83 LKEPAICKYCGLRYVQD   99 (102)
Q Consensus        83 ~~~~~~CpYCG~ry~~~   99 (102)
                      .+.+-.|++||+.|.+.
T Consensus         4 gekpy~C~~Cgk~F~~~   20 (33)
T d1x6ea1           4 GEKPYGCVECGKAFSRS   20 (33)
T ss_dssp             TCCCEECSSSCCEESSH
T ss_pred             CCCCeeCCCCCCEeCch
Confidence            35688999999999864

>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=87.32  E-value=0.075  Score=28.25  Aligned_cols=16  Identities=38%  Similarity=0.982  Sum_probs=13.4

Q ss_pred             CceecCCCCccccccc
Q 034182           85 EPAICKYCGLRYVQDH  100 (102)
Q Consensus        85 ~~~~CpYCG~ry~~~~  100 (102)
                      ++-.||-|+.||+.++
T Consensus         2 kp~~cpic~qrfkrkd   17 (32)
T d2epqa1           2 KPYSCPVCGLRFKRKD   17 (32)
T ss_dssp             CSSEETTTTEECSCHH
T ss_pred             CCcccchHHHHhhccc
Confidence            4678999999999764

>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger and SCAN domain-containing protein 16, ZSCAN16
species: Human (Homo sapiens) [TaxId: 9606]

Probab=85.30  E-value=0.16  Score=27.11  Aligned_cols=16  Identities=19%  Similarity=0.600  Sum_probs=13.6

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||+.|...
T Consensus        10 ekpy~C~~CgK~F~~~   25 (38)
T d2cota2          10 RRRYKCDECGKSFSHS   25 (38)
T ss_dssp             SCSSBCSSSCCBCSCH
T ss_pred             CCCEecCCCCceeeCH
Confidence            5688999999999864

>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=84.98  E-value=0.12  Score=27.34  Aligned_cols=16  Identities=25%  Similarity=0.667  Sum_probs=13.8

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|.+||..|.+.
T Consensus         6 ekPy~C~~C~k~F~~~   21 (36)
T d1x6ha2           6 EKPYACSHCDKTFRQK   21 (36)
T ss_dssp             CCCEECSSSSCEESSH
T ss_pred             CCCEECCCCCCCcCCH
Confidence            5688999999999864

>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Kruppel-like factor 3, Bklf
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=84.90  E-value=0.099  Score=27.86  Aligned_cols=16  Identities=19%  Similarity=0.540  Sum_probs=13.8

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|++||..|.+.
T Consensus         9 eKPy~C~~C~k~F~~~   24 (37)
T d1p7aa_           9 IKPFQCPDCDRSFSRS   24 (37)
T ss_dssp             SSSBCCTTTCCCBSSH
T ss_pred             ccCeEeCCCCCEecCH
Confidence            5688999999999865

>d1vq0a2 g.81.1.1 (A:231-287) HSP33, C-terminal domain {Thermotoga maritima [TaxId: 2336]}

class: Small proteins
fold: HSP33 redox switch-like
superfamily: HSP33 redox switch-like
family: HSP33 redox switch-like
domain: HSP33, C-terminal domain
species: Thermotoga maritima [TaxId: 2336]

Probab=82.83  E-value=0.19  Score=29.05  Aligned_cols=14  Identities=43%  Similarity=1.092  Sum_probs=12.3

Q ss_pred             ceecCCCCcccccc
Q 034182           86 PAICKYCGLRYVQD   99 (102)
Q Consensus        86 ~~~CpYCG~ry~~~   99 (102)
                      .++|.|||++|...
T Consensus        30 ev~C~FC~~~Y~f~   43 (57)
T d1vq0a2          30 EVVCKWCNTRYVFS   43 (57)
T ss_dssp             EEECTTTCCEEEEC
T ss_pred             EEEeECCCCEEEEC
Confidence            78999999999864

>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=82.34  E-value=0.16  Score=27.57  Aligned_cols=16  Identities=31%  Similarity=0.843  Sum_probs=13.2

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|.+||+.|...
T Consensus         3 ~Kpy~C~~Cgk~F~~~   18 (39)
T d2epsa1           3 GKPYICQSCGKGFSRP   18 (39)
T ss_dssp             SCCEECSSSCCEESSH
T ss_pred             CCCccCCCCCCCcCCh
Confidence            3578999999999864

>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: SWI5 zinc-finger domains
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=82.12  E-value=0.31  Score=27.19  Aligned_cols=23  Identities=9%  Similarity=0.222  Sum_probs=17.3

Q ss_pred             EEcCCCCceecCC--CCcccccccC
Q 034182           79 ICLDLKEPAICKY--CGLRYVQDHH  101 (102)
Q Consensus        79 I~Ld~~~~~~CpY--CG~ry~~~~h  101 (102)
                      +.-..+.+-.|+|  ||..|....|
T Consensus        11 ~~h~gekpy~C~~~~C~k~F~~~~~   35 (47)
T d1ncsa_          11 VKEMPDKTFECLFPGCTKTFKRRYN   35 (47)
T ss_dssp             CEEETTTEEECCCTTCCCEECSSSS
T ss_pred             hhccCCCCeECCcCCCCccccCchH
Confidence            3344567899999  9999987643

>d1xjha_ g.81.1.1 (A:) HSP33, C-terminal domain {Escherichia coli [TaxId: 562]}

class: Small proteins
fold: HSP33 redox switch-like
superfamily: HSP33 redox switch-like
family: HSP33 redox switch-like
domain: HSP33, C-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=81.43  E-value=0.21  Score=29.11  Aligned_cols=14  Identities=36%  Similarity=0.978  Sum_probs=12.2

Q ss_pred             ceecCCCCcccccc
Q 034182           86 PAICKYCGLRYVQD   99 (102)
Q Consensus        86 ~~~CpYCG~ry~~~   99 (102)
                      .++|.|||+.|...
T Consensus        37 ev~C~fC~~~Y~f~   50 (62)
T d1xjha_          37 DMHCDYCGNHYLFN   50 (62)
T ss_dssp             EEECTTTCCEEEEE
T ss_pred             EEEeeCCCCEEEEC
Confidence            68999999999864

>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: SWI5 zinc-finger domains
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=81.29  E-value=0.19  Score=26.29  Aligned_cols=16  Identities=31%  Similarity=0.852  Sum_probs=12.9

Q ss_pred             CceecCC--CCccccccc
Q 034182           85 EPAICKY--CGLRYVQDH  100 (102)
Q Consensus        85 ~~~~CpY--CG~ry~~~~  100 (102)
                      .+-.|+|  ||+.|...+
T Consensus         2 rP~~C~~pgC~k~F~r~~   19 (32)
T d1zfda_           2 RPYSCDHPGCDKAFVRNH   19 (32)
T ss_dssp             CSBCCCCTTCCCCBSSSH
T ss_pred             cCeECcCCCCCCeeCCHH
Confidence            4678999  999998654

>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Enhancer binding protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=81.05  E-value=0.22  Score=25.78  Aligned_cols=10  Identities=50%  Similarity=1.188  Sum_probs=8.5

Q ss_pred             ecCCCCcccc
Q 034182           88 ICKYCGLRYV   97 (102)
Q Consensus        88 ~CpYCG~ry~   97 (102)
                      +|+|||.+-.
T Consensus         3 vC~~Cg~~C~   12 (28)
T d1bboa1           3 ICEECGIRAK   12 (28)
T ss_dssp             BCTTTCCBCS
T ss_pred             cccccCcccC
Confidence            7999998764

>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Five-finger GLI1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=80.93  E-value=0.15  Score=26.41  Aligned_cols=15  Identities=27%  Similarity=0.762  Sum_probs=12.1

Q ss_pred             ceecCC--CCccccccc
Q 034182           86 PAICKY--CGLRYVQDH  100 (102)
Q Consensus        86 ~~~CpY--CG~ry~~~~  100 (102)
                      +-.|+|  ||+.|....
T Consensus         2 p~~C~~~gCgk~F~~~~   18 (30)
T d2glia3           2 PHKCTFEGCRKSYSRLE   18 (30)
T ss_dssp             CCCCCSTTCCCCCSSHH
T ss_pred             CeeCCCCCCCceECChh
Confidence            457999  999998754

>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]}

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: ZIF268
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=80.28  E-value=0.28  Score=25.37  Aligned_cols=16  Identities=25%  Similarity=0.916  Sum_probs=12.9

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +.+-.|..||++|...
T Consensus         1 EkPf~C~~CgrkFArs   16 (28)
T d1a1ia3           1 EKPFACDICGRKFARS   16 (28)
T ss_dssp             CCCEECTTTCCEESSH
T ss_pred             CCCcccchhhhhhhcc
Confidence            3567899999999864