Citrus Sinensis ID: 034353
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 97 | ||||||
| 224105979 | 518 | cytochrome P450 [Populus trichocarpa] gi | 0.948 | 0.177 | 0.619 | 1e-25 | |
| 224119126 | 518 | cytochrome P450 [Populus trichocarpa] gi | 0.948 | 0.177 | 0.608 | 3e-25 | |
| 224113635 | 104 | cytochrome P450 [Populus trichocarpa] gi | 1.0 | 0.932 | 0.578 | 4e-25 | |
| 224119134 | 518 | cytochrome P450 [Populus trichocarpa] gi | 0.948 | 0.177 | 0.608 | 4e-25 | |
| 224119146 | 96 | predicted protein [Populus trichocarpa] | 0.948 | 0.958 | 0.597 | 8e-25 | |
| 359494591 | 391 | PREDICTED: secologanin synthase-like [Vi | 0.948 | 0.235 | 0.554 | 4e-23 | |
| 359494197 | 526 | PREDICTED: secologanin synthase-like [Vi | 0.948 | 0.174 | 0.554 | 5e-23 | |
| 147795635 | 518 | hypothetical protein VITISV_015554 [Viti | 0.876 | 0.164 | 0.564 | 6e-23 | |
| 147858656 | 193 | hypothetical protein VITISV_020336 [Viti | 0.927 | 0.466 | 0.555 | 2e-22 | |
| 359494208 | 515 | PREDICTED: secologanin synthase-like [Vi | 0.927 | 0.174 | 0.555 | 2e-22 |
| >gi|224105979|ref|XP_002333744.1| cytochrome P450 [Populus trichocarpa] gi|222838385|gb|EEE76750.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 120 bits (301), Expect = 1e-25, Method: Compositional matrix adjust.
Identities = 57/92 (61%), Positives = 68/92 (73%)
Query: 1 MELPLKSIALTIVIVTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENS 60
M + + SI ++IV V VL WAWRVLNWVW RPKK+E+ LRQQG G YRLLFGD KENS
Sbjct: 1 MTVTVTSILVSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKENS 60
Query: 61 IELKEAKARPLSLDDNIAIRVNPFLHKLVNDY 92
LKEA+ +P+ L D + RV PFLH+LV DY
Sbjct: 61 DMLKEARTKPIGLSDALLPRVMPFLHQLVKDY 92
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224119126|ref|XP_002331331.1| cytochrome P450 [Populus trichocarpa] gi|222873914|gb|EEF11045.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224113635|ref|XP_002332522.1| cytochrome P450 [Populus trichocarpa] gi|222832634|gb|EEE71111.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224119134|ref|XP_002331333.1| cytochrome P450 [Populus trichocarpa] gi|222873916|gb|EEF11047.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224119146|ref|XP_002331336.1| predicted protein [Populus trichocarpa] gi|222873919|gb|EEF11050.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359494591|ref|XP_003634812.1| PREDICTED: secologanin synthase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359494197|ref|XP_002265784.2| PREDICTED: secologanin synthase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147795635|emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147858656|emb|CAN80407.1| hypothetical protein VITISV_020336 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359494208|ref|XP_002270501.2| PREDICTED: secologanin synthase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 97 | ||||||
| TAIR|locus:2089521 | 512 | CYP72A15 ""cytochrome P450, fa | 0.948 | 0.179 | 0.445 | 4e-18 | |
| TAIR|locus:2089586 | 512 | CYP72A11 ""cytochrome P450, fa | 0.865 | 0.164 | 0.440 | 6.3e-17 | |
| TAIR|locus:2089596 | 512 | CYP72A13 ""cytochrome P450, fa | 0.865 | 0.164 | 0.452 | 2.2e-16 | |
| TAIR|locus:2089561 | 514 | CYP72A10 ""cytochrome P450, fa | 0.855 | 0.161 | 0.457 | 2.8e-16 | |
| TAIR|locus:2089526 | 512 | CYP72A7 ""cytochrome P450, fam | 0.865 | 0.164 | 0.392 | 2.1e-15 | |
| TAIR|locus:2089531 | 515 | CYP72A8 ""cytochrome P450, fam | 0.886 | 0.166 | 0.402 | 7.3e-15 | |
| TAIR|locus:2089546 | 508 | CYP72A9 ""cytochrome P450, fam | 0.896 | 0.171 | 0.408 | 9.1e-15 | |
| TAIR|locus:2089621 | 512 | CYP72A14 ""cytochrome P450, fa | 0.855 | 0.162 | 0.433 | 2.5e-14 | |
| UNIPROTKB|Q69XM6 | 538 | CYP734A4 "Cytochrome P450 734A | 0.927 | 0.167 | 0.326 | 1.2e-06 | |
| TAIR|locus:2041399 | 572 | CYP709B2 ""cytochrome P450, fa | 0.876 | 0.148 | 0.359 | 2.2e-06 |
| TAIR|locus:2089521 CYP72A15 ""cytochrome P450, family 72, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 227 (85.0 bits), Expect = 4.0e-18, P = 4.0e-18
Identities = 41/92 (44%), Positives = 60/92 (65%)
Query: 1 MELPLKSIALTIVIVTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENS 60
ME+ + S+ +++V+ V W WR L WVW +PK LE +LR+QGL G Y L GDLK+N
Sbjct: 1 MEISVASVTISVVLAVVSWWIWRTLQWVWFKPKMLEHYLRRQGLAGTPYTPLVGDLKKNF 60
Query: 61 IELKEAKARPLSLDDNIAIRVNPFLHKLVNDY 92
L EA+++PL L D+I+ RV P+ ++ Y
Sbjct: 61 TMLSEARSKPLKLTDDISPRVVPYPLQMFKTY 92
|
|
| TAIR|locus:2089586 CYP72A11 ""cytochrome P450, family 72, subfamily A, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089596 CYP72A13 ""cytochrome P450, family 72, subfamily A, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089561 CYP72A10 ""cytochrome P450, family 72, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089526 CYP72A7 ""cytochrome P450, family 72, subfamily A, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089531 CYP72A8 ""cytochrome P450, family 72, subfamily A, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089546 CYP72A9 ""cytochrome P450, family 72, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089621 CYP72A14 ""cytochrome P450, family 72, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q69XM6 CYP734A4 "Cytochrome P450 734A4" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2041399 CYP709B2 ""cytochrome P450, family 709, subfamily B, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 97 | |||
| PLN02290 | 516 | PLN02290, PLN02290, cytokinin trans-hydroxylase | 3e-05 |
| >gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
Score = 40.6 bits (95), Expect = 3e-05
Identities = 18/75 (24%), Positives = 44/75 (58%), Gaps = 1/75 (1%)
Query: 10 LTIVIVTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKAR 69
L I + +L A+ ++ +L P++++K + +QG++G R L G++ + S + ++ ++
Sbjct: 10 LVIFLTLLLRVAYDTISCYFLTPRRIKKIMERQGVRGPKPRPLTGNILDVSALVSQSTSK 69
Query: 70 PL-SLDDNIAIRVNP 83
+ S+ +I R+ P
Sbjct: 70 DMDSIHHDIVGRLLP 84
|
Length = 516 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 97 | |||
| PLN02290 | 516 | cytokinin trans-hydroxylase | 99.37 | |
| PTZ00404 | 482 | cytochrome P450; Provisional | 97.54 | |
| KOG0157 | 497 | consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami | 97.33 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 96.89 | |
| KOG0158 | 499 | consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf | 96.64 | |
| PLN00168 | 519 | Cytochrome P450; Provisional | 96.36 | |
| KOG0156 | 489 | consensus Cytochrome P450 CYP2 subfamily [Secondar | 96.24 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 96.16 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 96.07 | |
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 95.93 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 95.47 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 95.42 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 95.4 | |
| PLN02774 | 463 | brassinosteroid-6-oxidase | 94.97 | |
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 94.96 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 94.61 | |
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 94.43 | |
| PLN02971 | 543 | tryptophan N-hydroxylase | 93.08 | |
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 91.69 | |
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 91.63 | |
| PLN02500 | 490 | cytochrome P450 90B1 | 91.24 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 91.03 | |
| PF07219 | 108 | HemY_N: HemY protein N-terminus; InterPro: IPR0108 | 90.29 | |
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 89.71 | |
| PLN02655 | 466 | ent-kaurene oxidase | 89.66 | |
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 88.39 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 88.24 |
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
Probab=99.37 E-value=7.4e-12 Score=99.19 Aligned_cols=80 Identities=20% Similarity=0.436 Sum_probs=67.9
Q ss_pred HHHHHHHHHHHHHhchHHHHHHHHHcCCCCCCCcCCCCCHHHHHHHHHHhhcCCCC-CCCccccccchHHHHHHHhcCCC
Q 034353 17 VLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLS-LDDNIAIRVNPFLHKLVNDYEPL 95 (97)
Q Consensus 17 ~~~~~~~~~~~~w~rP~rl~~~lr~QGI~Gpp~~~l~Gn~~e~~~~~~~a~s~~~~-~shdi~~rv~P~~~~w~k~YGk~ 95 (97)
+.-.+++.+..+.+.|++++++++++|++||++.+++||+.++.....++..++++ ..+|+..+..+++.+|.++||++
T Consensus 17 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGP~~~P~iGnl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yG~i 96 (516)
T PLN02290 17 LLRVAYDTISCYFLTPRRIKKIMERQGVRGPKPRPLTGNILDVSALVSQSTSKDMDSIHHDIVGRLLPHYVAWSKQYGKR 96 (516)
T ss_pred HHHHHHHHHHHHhccHHHHHHHHHHcCCCCCCCCcCCCCHHHHHHHHHHhhcCCCCCCCcccccccchHHHHHHHHhCCe
Confidence 33456788899999999999999999999999999999999998766666666665 46777778888999999999997
Q ss_pred C
Q 034353 96 M 96 (97)
Q Consensus 96 ~ 96 (97)
|
T Consensus 97 ~ 97 (516)
T PLN02290 97 F 97 (516)
T ss_pred E
Confidence 6
|
|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >PF07219 HemY_N: HemY protein N-terminus; InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 97 | |||
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 97.56 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 96.64 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 94.97 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 94.17 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 94.08 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 93.74 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 93.52 | |
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 93.22 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 93.09 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 92.57 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 92.5 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 92.12 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 92.07 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 91.38 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 90.86 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 90.47 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 89.92 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 89.44 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 89.33 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 89.19 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 87.67 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 85.92 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 85.56 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 85.29 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 85.23 |
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
Probab=97.56 E-value=2.4e-05 Score=58.99 Aligned_cols=43 Identities=12% Similarity=0.212 Sum_probs=33.9
Q ss_pred HHHHHHcCCCCCCCcCCCCCHHHHHHHHHHhhcCCCCCCCccccccchHHHHHHHhcCCCC
Q 034353 36 EKFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLSLDDNIAIRVNPFLHKLVNDYEPLM 96 (97)
Q Consensus 36 ~~~lr~QGI~Gpp~~~l~Gn~~e~~~~~~~a~s~~~~~shdi~~rv~P~~~~w~k~YGk~~ 96 (97)
..+++++|++||++..++||+.++. ....-++.+|.++||++|
T Consensus 8 ~~~~k~~~~PGP~~~PliGn~~~~~------------------~~~~~~~~~~~~~yG~i~ 50 (485)
T 3nxu_A 8 HGLFKKLGIPGPTPLPFLGNILSYH------------------KGFCMFDMECHKKYGKVW 50 (485)
T ss_dssp TTHHHHHTCCCCCCBTTTBTGGGGG------------------GCHHHHHHHHHHHHCSEE
T ss_pred chHHhhCCCCCCCCcCeecCcHHhh------------------cChHHHHHHHHHHcCCeE
Confidence 3688999999999999999985542 222346789999999876
|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 97 | |||
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 97.26 | |
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 94.34 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 92.94 | |
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 90.62 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 85.34 |
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome P450 3a4 species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.26 E-value=5.6e-05 Score=54.25 Aligned_cols=42 Identities=12% Similarity=0.214 Sum_probs=33.2
Q ss_pred HHHHHcCCCCCCCcCCCCCHHHHHHHHHHhhcCCCCCCCccccccchHHHHHHHhcCCCC
Q 034353 37 KFLRQQGLKGNSYRLLFGDLKENSIELKEAKARPLSLDDNIAIRVNPFLHKLVNDYEPLM 96 (97)
Q Consensus 37 ~~lr~QGI~Gpp~~~l~Gn~~e~~~~~~~a~s~~~~~shdi~~rv~P~~~~w~k~YGk~~ 96 (97)
..++|.||+||++-.++||+-++.+ ...-++.+|.++||++|
T Consensus 4 ~~~~~~~iPGP~~~P~iG~~~~~~~------------------~~~~~~~~~~~kyG~i~ 45 (472)
T d1tqna_ 4 GLFKKLGIPGPTPLPFLGNILSYHK------------------GFCMFDMECHKKYGKVW 45 (472)
T ss_dssp THHHHTTCCCCCCBTTTBTGGGGGG------------------CHHHHHHHHHHHHCSEE
T ss_pred cchhhcCCCCCCCcCceeEHHHhhC------------------CHHHHHHHHHHHhCCEE
Confidence 3688999999999889999865532 22347889999999876
|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|