Citrus Sinensis ID: 034364

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MAKNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTGMKMASFT
cccccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccEEEccccccHHHHHHHHcccccccccEEEEEEccccccccccccccc
cccHHHHHHccHHHHHHHHHHHHHHcccEEEEEEEEccccccccccccEEEEEcccEHHHHHHHHHHHHccccccccEEEccccccccccEHHHcc
maknsfklehpLERRQAEAARIrdkypdripVIVEraeksdvpeidkkkylvpadltvGQFVYVVRKRIKLSPEKAIFIFVknilpptgmkmasft
maknsfklehplerrqaeaarirdkypdripviveraeksdvpeidkkkylvpadltvgqFVYVVRKRiklspekaififvknilpptgmkmasft
MAKNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTGMKMASFT
****************************RIPVIVE*******PEIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILP**********
***NSFK*EHPLERRQAEAARIRDKYPDRIPVIVERAEKS*VPEIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTGMKMASFT
MAKNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTGMKMASFT
******KLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTGMK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFVKNILPPTGMKMASFT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
Q9SL04120 Autophagy-related protein yes no 0.979 0.783 0.872 7e-41
Q69RC4119 Autophagy-related protein yes no 0.979 0.789 0.840 1e-40
Q2XPP5119 Autophagy-related protein N/A no 0.979 0.789 0.840 1e-40
Q6Z1D5120 Autophagy-related protein no no 0.979 0.783 0.840 3e-40
A2YS06120 Autophagy-related protein N/A no 0.979 0.783 0.840 3e-40
Q8S927119 Autophagy-related protein no no 0.979 0.789 0.829 7e-40
Q7XPR1119 Autophagy-related protein no no 0.979 0.789 0.829 1e-39
A2XXR7119 Autophagy-related protein N/A no 0.979 0.789 0.829 1e-39
Q8VYK7121 Autophagy-related protein no no 0.979 0.776 0.819 1e-38
Q8H715116 Autophagy-related protein N/A no 0.947 0.784 0.769 1e-36
>sp|Q9SL04|ATG8D_ARATH Autophagy-related protein 8d OS=Arabidopsis thaliana GN=ATG8D PE=1 SV=1 Back     alignment and function desciption
 Score =  165 bits (418), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (94%)

Query: 1  MAKNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQ 60
          MA +SFK EHPLE+RQAEAARIR+KYPDRIPVIVERAEKSDVP+ID+KKYLVPADLTVGQ
Sbjct: 1  MAISSFKHEHPLEKRQAEAARIREKYPDRIPVIVERAEKSDVPDIDRKKYLVPADLTVGQ 60

Query: 61 FVYVVRKRIKLSPEKAIFIFVKNILPPTGMKMAS 94
          FVYVVRKRIKLSPEKAIFIFVKNILPPT   M++
Sbjct: 61 FVYVVRKRIKLSPEKAIFIFVKNILPPTAAIMSA 94
Involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. May mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton.
Arabidopsis thaliana (taxid: 3702)
>sp|Q69RC4|ATG8A_ORYSJ Autophagy-related protein 8A OS=Oryza sativa subsp. japonica GN=ATG8A PE=3 SV=1 Back     alignment and function description
>sp|Q2XPP5|ATG8A_ORYSI Autophagy-related protein 8A OS=Oryza sativa subsp. indica GN=ATG8A PE=1 SV=1 Back     alignment and function description
>sp|Q6Z1D5|ATG8C_ORYSJ Autophagy-related protein 8C OS=Oryza sativa subsp. japonica GN=ATG8C PE=2 SV=1 Back     alignment and function description
>sp|A2YS06|ATG8C_ORYSI Autophagy-related protein 8C OS=Oryza sativa subsp. indica GN=ATG8C PE=3 SV=2 Back     alignment and function description
>sp|Q8S927|ATG8C_ARATH Autophagy-related protein 8c OS=Arabidopsis thaliana GN=ATG8C PE=2 SV=1 Back     alignment and function description
>sp|Q7XPR1|ATG8B_ORYSJ Autophagy-related protein 8B OS=Oryza sativa subsp. japonica GN=ATG8B PE=3 SV=2 Back     alignment and function description
>sp|A2XXR7|ATG8B_ORYSI Autophagy-related protein 8B OS=Oryza sativa subsp. indica GN=ATG8B PE=3 SV=1 Back     alignment and function description
>sp|Q8VYK7|ATG8F_ARATH Autophagy-related protein 8f OS=Arabidopsis thaliana GN=ATG8F PE=2 SV=1 Back     alignment and function description
>sp|Q8H715|ATG8_PHYIN Autophagy-related protein 8 OS=Phytophthora infestans GN=ATG8 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
388510670120 unknown [Lotus japonicus] 0.979 0.783 0.914 4e-42
224068998121 predicted protein [Populus trichocarpa] 0.979 0.776 0.904 8e-42
255630111120 unknown [Glycine max] 0.979 0.783 0.904 9e-42
217071444120 unknown [Medicago truncatula] gi|3884984 0.979 0.783 0.914 9e-42
351722749120 ATG8d protein [Glycine max] gi|223019809 0.979 0.783 0.904 1e-41
224128960119 predicted protein [Populus trichocarpa] 0.979 0.789 0.904 2e-41
388498134120 unknown [Medicago truncatula] 0.979 0.783 0.904 2e-41
449468366119 PREDICTED: autophagy-related protein 8c- 0.979 0.789 0.904 2e-41
351723849120 uncharacterized protein LOC100500165 [Gl 0.979 0.783 0.893 4e-41
168008854122 predicted protein [Physcomitrella patens 0.979 0.770 0.872 1e-40
>gi|388510670|gb|AFK43401.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  175 bits (443), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (96%)

Query: 1  MAKNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQ 60
          MAK+SFK+EHPLERRQAEAARIR+KYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQ
Sbjct: 1  MAKSSFKMEHPLERRQAEAARIREKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQ 60

Query: 61 FVYVVRKRIKLSPEKAIFIFVKNILPPTGMKMAS 94
          FVYVVRKRIKLSPEKAIFIFVKNILPPT   M++
Sbjct: 61 FVYVVRKRIKLSPEKAIFIFVKNILPPTAAMMSA 94

Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224068998|ref|XP_002302875.1| predicted protein [Populus trichocarpa] gi|118485794|gb|ABK94745.1| unknown [Populus trichocarpa] gi|222844601|gb|EEE82148.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255630111|gb|ACU15409.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|217071444|gb|ACJ84082.1| unknown [Medicago truncatula] gi|388498482|gb|AFK37307.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|351722749|ref|NP_001235975.1| ATG8d protein [Glycine max] gi|223019809|dbj|BAH22449.1| GmATG8d [Glycine max] Back     alignment and taxonomy information
>gi|224128960|ref|XP_002320465.1| predicted protein [Populus trichocarpa] gi|222861238|gb|EEE98780.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388498134|gb|AFK37133.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449468366|ref|XP_004151892.1| PREDICTED: autophagy-related protein 8c-like [Cucumis sativus] gi|449523930|ref|XP_004168976.1| PREDICTED: autophagy-related protein 8c-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|351723849|ref|NP_001237805.1| uncharacterized protein LOC100500165 [Glycine max] gi|255629510|gb|ACU15101.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|168008854|ref|XP_001757121.1| predicted protein [Physcomitrella patens subsp. patens] gi|162691619|gb|EDQ77980.1| predicted protein [Physcomitrella patens subsp. patens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
TAIR|locus:2058939164 ATG8D [Arabidopsis thaliana (t 0.864 0.506 0.879 5.1e-37
TAIR|locus:2130759121 ATG8F "AT4G16520" [Arabidopsis 0.979 0.776 0.819 8e-37
TAIR|locus:2120618137 APG8A "AT4G21980" [Arabidopsis 0.979 0.686 0.755 4.6e-34
TAIR|locus:2055537122 ATG8E "AUTOPHAGY 8E" [Arabidop 0.979 0.770 0.757 1.5e-33
TAIR|locus:2125791122 ATG8B "AT4G04620" [Arabidopsis 0.979 0.770 0.744 2e-33
TAIR|locus:2101816121 ATG8G "AUTOPHAGY 8G" [Arabidop 0.979 0.776 0.712 1.1e-32
UNIPROTKB|Q51MW4123 ATG8 "Autophagy-related protei 0.958 0.747 0.739 6e-32
ASPGD|ASPL0000029812118 atgH [Emericella nidulans (tax 0.958 0.779 0.739 7.7e-32
SGD|S000000174117 ATG8 "Component of autophagoso 0.958 0.786 0.684 2.3e-30
CGD|CAF0006954135 AUT7 [Candida albicans (taxid: 0.895 0.637 0.720 6.2e-30
TAIR|locus:2058939 ATG8D [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 371 (135.7 bits), Expect = 5.1e-37, Sum P(2) = 5.1e-37
 Identities = 73/83 (87%), Positives = 80/83 (96%)

Query:    12 LERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFVYVVRKRIKL 71
             L++RQAEAARIR+KYPDRIPVIVERAEKSDVP+ID+KKYLVPADLTVGQFVYVVRKRIKL
Sbjct:    56 LKKRQAEAARIREKYPDRIPVIVERAEKSDVPDIDRKKYLVPADLTVGQFVYVVRKRIKL 115

Query:    72 SPEKAIFIFVKNILPPTGMKMAS 94
             SPEKAIFIFVKNILPPT   M++
Sbjct:   116 SPEKAIFIFVKNILPPTAAIMSA 138
GO:0005634 "nucleus" evidence=ISM
GO:0006914 "autophagy" evidence=ISS
GO:0008017 "microtubule binding" evidence=ISS
TAIR|locus:2130759 ATG8F "AT4G16520" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120618 APG8A "AT4G21980" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2055537 ATG8E "AUTOPHAGY 8E" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125791 ATG8B "AT4G04620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101816 ATG8G "AUTOPHAGY 8G" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q51MW4 ATG8 "Autophagy-related protein 8" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000029812 atgH [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000000174 ATG8 "Component of autophagosomes and Cvt vesicles" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAF0006954 AUT7 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A7E8H4ATG8_SCLS1No assigned EC number0.72820.95830.7479N/Ano
Q51MW4ATG8_MAGO7No assigned EC number0.73910.95830.7479N/Ano
P0CO55ATG8_CRYNBNo assigned EC number0.74460.97910.7460N/Ano
P0CO54ATG8_CRYNJNo assigned EC number0.74460.97910.7460yesno
Q2XPP5ATG8A_ORYSINo assigned EC number0.84040.97910.7899N/Ano
Q69RC4ATG8A_ORYSJNo assigned EC number0.84040.97910.7899yesno
Q755X2ATG8_ASHGONo assigned EC number0.66290.92700.7416yesno
Q8J282ATG8_PODASNo assigned EC number0.73910.95830.7603yesno
Q8NJJ4ATG8_PICPANo assigned EC number0.68130.94790.728yesno
Q5BIZ2GBRL1_XENTRNo assigned EC number0.57600.95830.7863yesno
A6RPU4ATG8_BOTFBNo assigned EC number0.72820.95830.7479N/Ano
Q1E4K5ATG8_COCIMNo assigned EC number0.73910.95830.7863N/Ano
Q6FXR8ATG8_CANGANo assigned EC number0.69230.94790.7711yesno
A1D3N4ATG8_NEOFINo assigned EC number0.73910.95830.7796N/Ano
Q4WJ27ATG8_ASPFUNo assigned EC number0.73910.95830.7796yesno
A2YS06ATG8C_ORYSINo assigned EC number0.84040.97910.7833N/Ano
Q6BT31ATG8_DEBHANo assigned EC number0.64130.95830.6764yesno
A1CQS1ATG8_ASPCLNo assigned EC number0.73910.95830.7796N/Ano
O94272ATG8_SCHPONo assigned EC number0.66300.95830.7603yesno
Q5B2U9ATG8_EMENINo assigned EC number0.73910.95830.7796yesno
Q8H715ATG8_PHYINNo assigned EC number0.76920.94790.7844N/Ano
A2QPN1ATG8_ASPNCNo assigned EC number0.73910.95830.7796yesno
Q6CMF8ATG8_KLULANo assigned EC number0.66300.95830.7419yesno
A2XXR7ATG8B_ORYSINo assigned EC number0.82970.97910.7899N/Ano
Q0V3Y9ATG8_PHANONo assigned EC number0.73910.95830.7731N/Ano
Q9SL04ATG8D_ARATHNo assigned EC number0.87230.97910.7833yesno
Q8WZY7ATG8_NEUCRNo assigned EC number0.73910.95830.7603N/Ano
A3GFU8ATG8_PICSTNo assigned EC number0.65210.95830.6618yesno
Q2UBH5ATG8_ASPORNo assigned EC number0.73910.95830.7796yesno
P38182ATG8_YEASTNo assigned EC number0.68470.95830.7863yesno
Q2GVL1ATG8_CHAGBNo assigned EC number0.72820.95830.7603N/Ano
Q6C794ATG8_YARLINo assigned EC number0.71730.95830.7419yesno
Q0C804ATG8_ASPTNNo assigned EC number0.73910.95830.7796N/Ano
A4LA70ATG8_COLLNNo assigned EC number0.73910.95830.7603N/Ano
A7KAL9ATG8_PENCWNo assigned EC number0.73910.95830.7796yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
cd01611112 cd01611, GABARAP, Ubiquitin domain of GABA-recepto 1e-50
pfam02991104 pfam02991, Atg8, Autophagy protein Atg8 ubiquitin 4e-42
PTZ00380121 PTZ00380, PTZ00380, microtubule-associated protein 4e-07
>gnl|CDD|176355 cd01611, GABARAP, Ubiquitin domain of GABA-receptor-associated protein Back     alignment and domain information 
 Score =  154 bits (391), Expect = 1e-50
 Identities = 62/89 (69%), Positives = 74/89 (83%)

Query: 6  FKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFVYVV 65
          FK  HP E+R+AE  RIR KYPDRIPVIVER  KSD+P++DKKKYLVP+DLTVGQFVY++
Sbjct: 1  FKERHPFEKRKAEVERIRAKYPDRIPVIVERYPKSDLPDLDKKKYLVPSDLTVGQFVYII 60

Query: 66 RKRIKLSPEKAIFIFVKNILPPTGMKMAS 94
          RKRI+L PEKA+F+FV N LPPT   M+ 
Sbjct: 61 RKRIQLRPEKALFLFVNNSLPPTSATMSQ 89

GABARAP (GABA-receptor-associated protein) belongs ot a large family of proteins that mediate intracellular membrane trafficking and/or fusion. GABARAP binds not only to GABA, type A but also to tubulin, gephrin, and ULK1. Orthologues of GABARAP include Gate-16 (golgi-associated ATPase enhancer), LC3 (microtubule-associated protein light chain 3), and ATG8 (autophagy protein 8). ATG8 is a ubiquitin-like protein that is conjugated to the membrane phospholipid, phosphatidylethanolamine as part of a ubiquitin-like conjugation system essential for autophagosome-formation. Length = 112
>gnl|CDD|111837 pfam02991, Atg8, Autophagy protein Atg8 ubiquitin like Back     alignment and domain information
>gnl|CDD|173572 PTZ00380, PTZ00380, microtubule-associated protein (MAP); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
KOG1654116 consensus Microtubule-associated anchor protein in 100.0
cd01611112 GABARAP Ubiquitin domain of GABA-receptor-associat 100.0
PTZ00380121 microtubule-associated protein (MAP); Provisional 100.0
PF02991104 Atg8: Autophagy protein Atg8 ubiquitin like; Inter 100.0
cd0161287 APG12_C Ubiquitin-like domain of APG12. APG12_C Th 99.81
KOG3439116 consensus Protein conjugation factor involved in a 99.54
PF0411087 APG12: Ubiquitin-like autophagy protein Apg12 ; In 99.48
PF11816331 DUF3337: Domain of unknown function (DUF3337); Int 91.77
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 89.93
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 89.06
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 88.57
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 88.54
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 85.34
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 83.45
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 82.05
cd0177687 Rin1_RA Ubiquitin domain of RIN1 RAS effector. Rin 80.38
>KOG1654 consensus Microtubule-associated anchor protein involved in autophagy and membrane trafficking [Cytoskeleton] Back     alignment and domain information 
Probab=100.00  E-value=1.7e-42  Score=232.33  Aligned_cols=94  Identities=65%  Similarity=1.090  Sum_probs=91.5

Q ss_pred             CCCcccccCCHHHHHHHHHHHHhhCCCcccEEEEccCCCCCCCcceeeEEecCCCchHhHHHHHhhhhcCCCCCeEEEEE
Q 034364            2 AKNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFV   81 (96)
Q Consensus         2 ~~~~fK~~~~~e~R~~e~~~ir~kyP~kIpVIvEr~~~~~lp~l~k~KflVp~~~tv~~f~~~irk~l~l~~~~alfl~V   81 (96)
                      |+++||++|+||+|++|+.+||+|||+|||||||+++++++|+|||+|||||.++|||||+++||+||+|+|++||||||
T Consensus         1 ~~~~FK~~~~fe~R~~E~~~Ir~kyP~riPVIvEk~~~~~lp~lDK~KyLVP~dltvgqfi~iIRkRiqL~~~kA~flfV   80 (116)
T KOG1654|consen    1 MKSSFKERHPFEKRKAEVRRIREKYPDRIPVIVEKAGKSQLPDLDKKKYLVPDDLTVGQFIKIIRKRIQLSPEKAFFLFV   80 (116)
T ss_pred             CcchhhccCCHHHHHHHHHHHHHHCCCCCcEEEEecccccCcccccceeeccccccHHHHHHHHHHHhccChhHeEEEEE
Confidence            56899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCccCCCCcccccC
Q 034364           82 KNILPPTGMKMASF   95 (96)
Q Consensus        82 nn~lp~~~~~m~~l   95 (96)
                      ||.+|+++++||+|
T Consensus        81 n~~~p~ts~~ms~~   94 (116)
T KOG1654|consen   81 NNTSPPTSATMSAL   94 (116)
T ss_pred             cCcCCcchhhHHHH
Confidence            99999999999875

>cd01611 GABARAP Ubiquitin domain of GABA-receptor-associated protein Back     alignment and domain information
>PTZ00380 microtubule-associated protein (MAP); Provisional Back     alignment and domain information
>PF02991 Atg8: Autophagy protein Atg8 ubiquitin like; InterPro: IPR004241 Autophagy is generally known as a process involved in the degradation of bulk cytoplasmic components that are non-specifically sequestered into an autophagosome, where they are sequestered into double-membrane vesicles and delivered to the degradative organelle, the lysosome/vacuole, for breakdown and eventual recycling of the resulting macromolecules Back     alignment and domain information
>cd01612 APG12_C Ubiquitin-like domain of APG12 Back     alignment and domain information
>KOG3439 consensus Protein conjugation factor involved in autophagy [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04110 APG12: Ubiquitin-like autophagy protein Apg12 ; InterPro: IPR007242 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF11816 DUF3337: Domain of unknown function (DUF3337); InterPro: IPR021772 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01776 Rin1_RA Ubiquitin domain of RIN1 RAS effector Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
2kwc_A116 The Nmr Structure Of The Autophagy-Related Protein 2e-33
2li5_A117 Nmr Structure Of Atg8-Atg7c30 Complex Length = 117 2e-33
3vh3_B119 Crystal Structure Of Atg7ctd-Atg8 Complex Length = 2e-33
3rui_B118 Crystal Structure Of Atg7c-Atg8 Complex Length = 11 1e-32
2kq7_A119 Solution Structure Of The Autophagy-Related Protein 1e-32
2zpn_A119 The Crystal Structure Of Saccharomyces Cerevisiae A 1e-32
3m95_A125 Crystal Structure Of Autophagy-Related Protein Atg8 6e-28
2l8j_A119 Gabarapl-1 Nbr1-Lir Complex Structure Length = 119 2e-27
2r2q_A110 Crystal Structure Of Human Gamma-Aminobutyric Acid 3e-27
1kot_A119 Solution Structure Of Human Gaba Receptor Associate 4e-27
1kjt_A119 Crystal Structure Of The Gaba(A) Receptor Associate 5e-27
1gnu_A117 Gaba(a) Receptor Associated Protein Gabarap Length 5e-27
1eo6_A117 Crystal Structure Of Gate-16 Length = 117 6e-25
3h9d_A119 Crystal Structure Of Trypanosoma Brucei Atg8 Length 6e-24
4eoy_A128 Plasmodium Falciparum Atg8 In Complex With Plasmodi 3e-19
3vvw_B128 Ndp52 In Complex With Lc3c Length = 128 3e-12
3eci_A122 Microtubule-Associated Protein 1 Light Chain 3 Alph 1e-10
2zjd_A130 Crystal Structure Of Lc3-P62 Complex Length = 130 1e-09
2z0e_B129 The Crystal Structure Of Human Atg4b- Lc3(1-124) Co 1e-09
1ugm_A125 Crystal Structure Of Lc3 Length = 125 1e-09
2k6q_A121 Lc3 P62 Complex Structure Length = 121 1e-09
1v49_A120 Solution Structure Of Microtubule-Associated Protei 1e-09
>pdb|2KWC|A Chain A, The Nmr Structure Of The Autophagy-Related Protein Atg8 Length = 116 Back     alignment and structure 
Iteration: 1

 Score =  137 bits (345), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 64/92 (69%), Positives = 80/92 (86%)
Query: 3  KNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFV 62
          K++FK E+P E+R+AE+ RI D++P+RIPVI E+AEKSD+PEIDK+KYLVPADLTVGQFV
Sbjct: 2  KSTFKSEYPFEKRKAESERIADRFPNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFV 61
Query: 63 YVVRKRIKLSPEKAIFIFVKNILPPTGMKMAS 94
          YV+RKRI L PEKAIFIFV + LPPT   M++
Sbjct: 62 YVIRKRIMLPPEKAIFIFVNDTLPPTAALMSA 93
>pdb|2LI5|A Chain A, Nmr Structure Of Atg8-Atg7c30 Complex Length = 117 Back     alignment and structure
>pdb|3VH3|B Chain B, Crystal Structure Of Atg7ctd-Atg8 Complex Length = 119 Back     alignment and structure
>pdb|3RUI|B Chain B, Crystal Structure Of Atg7c-Atg8 Complex Length = 118 Back     alignment and structure
>pdb|2KQ7|A Chain A, Solution Structure Of The Autophagy-Related Protein Atg8 Length = 119 Back     alignment and structure
>pdb|2ZPN|A Chain A, The Crystal Structure Of Saccharomyces Cerevisiae Atg8- Atg19(412-415) Complex Length = 119 Back     alignment and structure
>pdb|3M95|A Chain A, Crystal Structure Of Autophagy-Related Protein Atg8 From The Silkworm Bombyx Mori Length = 125 Back     alignment and structure
>pdb|2L8J|A Chain A, Gabarapl-1 Nbr1-Lir Complex Structure Length = 119 Back     alignment and structure
>pdb|2R2Q|A Chain A, Crystal Structure Of Human Gamma-Aminobutyric Acid Receptor- Associated Protein-Like 1 (Gabarap1), Isoform Cra_a Length = 110 Back     alignment and structure
>pdb|1KOT|A Chain A, Solution Structure Of Human Gaba Receptor Associated Protein Gabarap Length = 119 Back     alignment and structure
>pdb|1KJT|A Chain A, Crystal Structure Of The Gaba(A) Receptor Associated Protein, Gabarap Length = 119 Back     alignment and structure
>pdb|1GNU|A Chain A, Gaba(a) Receptor Associated Protein Gabarap Length = 117 Back     alignment and structure
>pdb|1EO6|A Chain A, Crystal Structure Of Gate-16 Length = 117 Back     alignment and structure
>pdb|3H9D|A Chain A, Crystal Structure Of Trypanosoma Brucei Atg8 Length = 119 Back     alignment and structure
>pdb|4EOY|A Chain A, Plasmodium Falciparum Atg8 In Complex With Plasmodium Falciparum Atg3 Peptide Length = 128 Back     alignment and structure
>pdb|3VVW|B Chain B, Ndp52 In Complex With Lc3c Length = 128 Back     alignment and structure
>pdb|3ECI|A Chain A, Microtubule-Associated Protein 1 Light Chain 3 Alpha Isoform A (Map1alc3) Length = 122 Back     alignment and structure
>pdb|2ZJD|A Chain A, Crystal Structure Of Lc3-P62 Complex Length = 130 Back     alignment and structure
>pdb|2Z0E|B Chain B, The Crystal Structure Of Human Atg4b- Lc3(1-124) Complex Length = 129 Back     alignment and structure
>pdb|1UGM|A Chain A, Crystal Structure Of Lc3 Length = 125 Back     alignment and structure
>pdb|2K6Q|A Chain A, Lc3 P62 Complex Structure Length = 121 Back     alignment and structure
>pdb|1V49|A Chain A, Solution Structure Of Microtubule-Associated Protein Light Chain-3 Length = 120 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
1eo6_A117 GATE-16, golgi-associated ATPase enhancer of 16 KD 2e-36
3rui_B118 Autophagy-related protein 8; autophagosome formati 6e-36
3m95_A125 Autophagy related protein ATG8; alpha slash beta, 5e-35
2r2q_A110 Gamma-aminobutyric acid receptor-associated protei 2e-34
3h9d_A119 ATG8, microtubule-associated protein 1A/1B, light 1e-33
2zjd_A130 Microtubule-associated proteins 1A/1B light chain 4e-30
>1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 Length = 117 Back     alignment and structure
 Score =  118 bits (297), Expect = 2e-36
 Identities = 49/92 (53%), Positives = 68/92 (73%)

Query: 3  KNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFV 62
          K  FK +H LE R  E+A+IR KYPDR+PVIVE+   S + +IDK+KYLVP+D+TV QF+
Sbjct: 2  KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFM 61

Query: 63 YVVRKRIKLSPEKAIFIFVKNILPPTGMKMAS 94
          +++RKRI+L  EKAIF+FV   +P + + M  
Sbjct: 62 WIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQ 93
>3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 2kq7_A 2zpn_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* Length = 118 Back     alignment and structure
>3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} Length = 125 Back     alignment and structure
>2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A Length = 110 Back     alignment and structure
>3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} Length = 119 Back     alignment and structure
>2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
3rui_B118 Autophagy-related protein 8; autophagosome formati 100.0
3m95_A125 Autophagy related protein ATG8; alpha slash beta, 100.0
3h9d_A119 ATG8, microtubule-associated protein 1A/1B, light 100.0
2zjd_A130 Microtubule-associated proteins 1A/1B light chain 100.0
1eo6_A117 GATE-16, golgi-associated ATPase enhancer of 16 KD 100.0
2r2q_A110 Gamma-aminobutyric acid receptor-associated protei 100.0
4gdk_A91 Ubiquitin-like protein ATG12; protein-protein conj 99.85
1wz3_A96 Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, pla 99.82
3w1s_C91 Ubiquitin-like protein ATG12; ubiquitin fold, E3-l 99.79
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 95.57
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 89.4
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 89.33
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 89.31
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 88.65
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 88.52
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 87.56
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 86.69
1we6_A111 Splicing factor, putative; structural genomics, ub 86.56
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 85.96
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 85.79
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 85.59
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 85.51
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 85.34
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 85.3
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 85.14
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 84.74
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 84.51
3v6c_B91 Ubiquitin; structural genomics, structural genomic 84.3
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 83.92
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 83.41
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 83.39
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 83.24
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 82.78
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 82.68
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 82.33
3m62_B106 UV excision repair protein RAD23; armadillo-like r 82.31
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 81.68
>3rui_B Autophagy-related protein 8; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} SCOP: d.15.1.3 PDB: 2kq7_A 2zpn_A 3vxw_A 2kwc_A 2li5_A 3vh3_B 3vh4_B* Back     alignment and structure
Probab=100.00  E-value=2.6e-42  Score=233.67  Aligned_cols=94  Identities=67%  Similarity=1.094  Sum_probs=89.8

Q ss_pred             CCCcccccCCHHHHHHHHHHHHhhCCCcccEEEEccCCCCCCCcceeeEEecCCCchHhHHHHHhhhhcCCCCCeEEEEE
Q 034364            2 AKNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIFV   81 (96)
Q Consensus         2 ~~~~fK~~~~~e~R~~e~~~ir~kyP~kIpVIvEr~~~~~lp~l~k~KflVp~~~tv~~f~~~irk~l~l~~~~alfl~V   81 (96)
                      |+++||++||||+|++|+++||+|||+|||||||+++++++|+||++|||||.++||+||+.+||++|+|++++||||||
T Consensus         3 m~~~fK~~~~~e~R~~e~~~ir~kyP~riPVIvE~~~~~~~P~ldk~KflVp~~~tv~qf~~~iRkrl~l~~~~alFl~V   82 (118)
T 3rui_B            3 MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFV   82 (118)
T ss_dssp             ---CCTTSSCHHHHHHHHHHHHHHCSSEEEEEEEECTTCCSCCCSCCEEEEETTSBHHHHHHHHHHHTTCCTTCCEEEEB
T ss_pred             CcchhhccCCHHHHHHHHHHHHHhCCCceEEEEEeCCCCCCCccccceEEcCCCCCHHHHHHHHHHHhCcCCCccEEEEE
Confidence            77999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCccCCCCcccccC
Q 034364           82 KNILPPTGMKMASF   95 (96)
Q Consensus        82 nn~lp~~~~~m~~l   95 (96)
                      ||++|++|++||+|
T Consensus        83 n~~~p~~~~~m~~l   96 (118)
T 3rui_B           83 NDTLPPTAALMSAI   96 (118)
T ss_dssp             TTBCCCTTSBHHHH
T ss_pred             CCccCCccchHHHH
Confidence            99999999999986
>3m95_A Autophagy related protein ATG8; alpha slash beta, receptor, transport protein; 2.40A {Bombyx mori} SCOP: d.15.1.3 Back     alignment and structure
>3h9d_A ATG8, microtubule-associated protein 1A/1B, light chain putative; autophagy, lipidation, ubiquitin-like, S protein; 2.30A {Trypanosoma brucei} SCOP: d.15.1.0 Back     alignment and structure
>2zjd_A Microtubule-associated proteins 1A/1B light chain 3B precursor; autophagy, LC3, microtubule-associated protein 1 light chain 3, cytoplasm, cytoplasmic vesicle, lipoprotein; 1.56A {Homo sapiens} SCOP: d.15.1.3 PDB: 2z0e_B 2zzp_B 2z0d_B 1ugm_A 1v49_A 2k6q_A 3eci_A Back     alignment and structure
>1eo6_A GATE-16, golgi-associated ATPase enhancer of 16 KD; ubiquitin fold, protein binding; 1.80A {Bos taurus} SCOP: d.15.1.3 Back     alignment and structure
>2r2q_A Gamma-aminobutyric acid receptor-associated protein-like 1; autophagy, ubiquitin homolog, structural genomics consortium, SGC, microtubule; 1.65A {Homo sapiens} PDB: 2l8j_A 1kjt_A 1kot_A 3d32_A 3dow_A 1gnu_A 1klv_A 1km7_A Back     alignment and structure
>4gdk_A Ubiquitin-like protein ATG12; protein-protein conjugate, protein-protein complex, ubiquiti protein, E3 ligase, ubiquitin-like fold; 2.70A {Homo sapiens} PDB: 4gdl_A Back     alignment and structure
>1wz3_A Autophagy 12B, ATG12B, APG12B; ubiquitin-fold, plant protein; 1.80A {Arabidopsis thaliana} SCOP: d.15.1.7 Back     alignment and structure
>3w1s_C Ubiquitin-like protein ATG12; ubiquitin fold, E3-like, ATG3 binding, isopeptide bond betwe Gly186 and ATG5 Lys149, ligase; 2.60A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d1eo6a_116 d.15.1.3 (A:) Golgi-associated ATPase enhancer of 3e-42
d3d32a1118 d.15.1.3 (A:1-118) GABA(A) receptor associated pro 2e-40
d2zjda1119 d.15.1.3 (A:2-120) Microtubule-associated proteins 5e-35
>d1eo6a_ d.15.1.3 (A:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]} Length = 116 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: GABARAP-like
domain: Golgi-associated ATPase enhancer of 16 kD, Gate-16
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  132 bits (333), Expect = 3e-42
 Identities = 49/92 (53%), Positives = 68/92 (73%)

Query: 3  KNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFV 62
          K  FK +H LE R  E+A+IR KYPDR+PVIVE+   S + +IDK+KYLVP+D+TV QF+
Sbjct: 2  KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFM 61

Query: 63 YVVRKRIKLSPEKAIFIFVKNILPPTGMKMAS 94
          +++RKRI+L  EKAIF+FV   +P + + M  
Sbjct: 62 WIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQ 93
>d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2zjda1 d.15.1.3 (A:2-120) Microtubule-associated proteins 1A/1B light chain 3B {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d3d32a1118 GABA(A) receptor associated protein GABARAP {Human 100.0
d1eo6a_116 Golgi-associated ATPase enhancer of 16 kD, Gate-16 100.0
d2zjda1119 Microtubule-associated proteins 1A/1B light chain 100.0
d1wz3a184 Autophagy-related protein 12b (APG12b) {Thale cres 99.34
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 91.61
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 89.39
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 88.91
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 88.57
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 88.54
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 87.99
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 87.68
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 87.66
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 87.28
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 86.0
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 85.8
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 84.83
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 84.77
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 84.04
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 83.32
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 82.29
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 82.09
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 81.99
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 81.04
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 80.39
>d3d32a1 d.15.1.3 (A:1-118) GABA(A) receptor associated protein GABARAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: GABARAP-like
domain: GABA(A) receptor associated protein GABARAP
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.3e-42  Score=230.55  Aligned_cols=95  Identities=55%  Similarity=0.989  Sum_probs=93.2

Q ss_pred             CCCCcccccCCHHHHHHHHHHHHhhCCCcccEEEEccCCCCCCCcceeeEEecCCCchHhHHHHHhhhhcCCCCCeEEEE
Q 034364            1 MAKNSFKLEHPLERRQAEAARIRDKYPDRIPVIVERAEKSDVPEIDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFIF   80 (96)
Q Consensus         1 ~~~~~fK~~~~~e~R~~e~~~ir~kyP~kIpVIvEr~~~~~lp~l~k~KflVp~~~tv~~f~~~irk~l~l~~~~alfl~   80 (96)
                      ||+++||++||||+|++|+++|++|||+|||||||+++++++|+||++|||||+++|||||+++||+||+|++++|||||
T Consensus         2 ~m~~~fk~~~s~e~R~~es~~i~~KyPdriPVIve~~~~s~lp~ldk~KflVp~d~tv~qf~~~iRkrl~l~~~~alflf   81 (118)
T d3d32a1           2 SMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFF   81 (118)
T ss_dssp             CSCCHHHHHSCHHHHHHHHHHHHHHCTTEEEEEEEECTTCCSCCCSCSEEEEETTCBHHHHHHHHHHHHTCCTTSCCEEE
T ss_pred             CccchhcccCCHHHHHHHHHHHHHHCCCCceEEEEEcCCCCCcccccceEEecCCccHHHHHHHHHHHhCCCccceEEEE
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EcCccCCCCcccccC
Q 034364           81 VKNILPPTGMKMASF   95 (96)
Q Consensus        81 Vnn~lp~~~~~m~~l   95 (96)
                      |||.+|+++++||+|
T Consensus        82 vn~~~~~~~~ti~~l   96 (118)
T d3d32a1          82 VNNVIPPTSATMGQL   96 (118)
T ss_dssp             BTTBCCCTTCBHHHH
T ss_pred             ECCcccCccccHHHH
Confidence            999999999999976
>d1eo6a_ d.15.1.3 (A:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zjda1 d.15.1.3 (A:2-120) Microtubule-associated proteins 1A/1B light chain 3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wz3a1 d.15.1.7 (A:10-93) Autophagy-related protein 12b (APG12b) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure