Citrus Sinensis ID: 034377

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90------

MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED

ccccccEEEEEcccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccEEEEEEcHHHHHHHHHHHHHHccccccccccc

cccccEEEEEEcccccHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHEEEccccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccc

MQDVKNVVVhnlspgmvttdllmsgattKQAKFFINVLAEPADVVAECLVPKIRsiaasgstkptYLRFLTGVKAYSQIFSRIAfgarrnryiled

mqdvknvvvhnlspgmvTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIrsiaasgstkptyLRFLTGVKaysqifsriafgarrnryiled

MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED

******VVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYI***

****KNV*VHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIR***********YLRFLTGVKAYSQIFSRIAFGARR*R*****

MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED

**DVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYI***

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASGSTKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		96	2.2.26 [Sep-21-2011]
Q8LEU3		348	Chlorophyll(ide) b reduct	yes	no	1.0	0.275	0.833	5e-43
Q84ST4		343	Chlorophyll(ide) b reduct	yes	no	1.0	0.279	0.781	1e-39
Q93ZA0		496	Probable chlorophyll(ide)	no	no	0.562	0.108	0.454	3e-07
Q5N800		504	Probable chlorophyll(ide)	no	no	0.854	0.162	0.344	8e-07

>sp\|Q8LEU3\|NOL_ARATH Chlorophyll(ide) b reductase NOL, chloroplastic OS=Arabidopsis thaliana GN=NOL PE=2 SV=1	Back alignment and function desciption

 Score =  172 bits (436), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 90/96 (93%)

Query: 1   MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASG 60
           MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPA+VVAE LVP IR+I ASG
Sbjct: 253 MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG 312

Query: 61  STKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED 96
           S KPTY+RFLTG+KAY++IFSR+A GAR+NRY+ E+
Sbjct: 313 SMKPTYIRFLTGIKAYTKIFSRVALGARKNRYVTEE 348

Required for chlorophyll b degradation. Chlorophyll b, chlorophyllide b, pheophorbide b and pheophytin b can be used as substrates.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 9EC: 4

>sp\|Q84ST4\|NOL_ORYSJ Chlorophyll(ide) b reductase NOL, chloroplastic OS=Oryza sativa subsp. japonica GN=NOL PE=1 SV=1	Back alignment and function description

>sp\|Q93ZA0\|NYC1_ARATH Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Arabidopsis thaliana GN=NYC1 PE=1 SV=1	Back alignment and function description

>sp\|Q5N800\|NYC1_ORYSJ Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Oryza sativa subsp. japonica GN=NYC1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		96
225424993		345	PREDICTED: chlorophyll(ide) b reductase	1.0	0.278	0.895	9e-44
356556680		349	PREDICTED: chlorophyll(ide) b reductase	1.0	0.275	0.875	5e-43
449446317		352	PREDICTED: chlorophyll(ide) b reductase	1.0	0.272	0.864	4e-42
18414726		348	chlorophyll(ide) b reductase NOL [Arabid	1.0	0.275	0.833	2e-41
297806477		349	short-chain dehydrogenase/reductase fami	1.0	0.275	0.833	3e-41
345846651		178	chlorophyll(ide) b reductase [Pyrus x br	0.947	0.511	0.868	2e-39
75298085		343	RecName: Full=Chlorophyll(ide) b reducta	1.0	0.279	0.781	6e-38
326519666		346	predicted protein [Hordeum vulgare subsp	1.0	0.277	0.781	9e-38
226532277		341	short-chain dehydrogenase/reductase SDR	1.0	0.281	0.760	4e-37
238013532		341	unknown [Zea mays] gi\|413933565\|gb\|AFW68	1.0	0.281	0.75	2e-36

>gi\|225424993\|ref\|XP_002266979.1\| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic [Vitis vinifera] gi\|297738201\|emb\|CBI27402.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score =  180 bits (457), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 86/96 (89%), Positives = 91/96 (94%)

Query: 1   MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASG 60
           MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPA+VVAE LVP IRSI  +G
Sbjct: 250 MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRSIPVNG 309

Query: 61  STKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED 96
           STKPTY+RFLTG+KAYSQIFSR AFGARRNRY+LED
Sbjct: 310 STKPTYIRFLTGLKAYSQIFSRFAFGARRNRYLLED 345

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356556680\|ref\|XP_003546651.1\| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi\|449446317\|ref\|XP_004140918.1\| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like [Cucumis sativus] gi\|449494121\|ref\|XP_004159455.1\| PREDICTED: chlorophyll(ide) b reductase NOL, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|18414726|ref|NP_568145.1| chlorophyll(ide) b reductase NOL [Arabidopsis thaliana] gi|75301367|sp|Q8LEU3.1|NOL_ARATH RecName: Full=Chlorophyll(ide) b reductase NOL, chloroplastic; AltName: Full=Protein NON-YELLOW COLORING 1-LIKE; Short=AtNOL; Short=Protein NYC1-LIKE; AltName: Full=Short-chain dehydrogenase/reductase NOL; Flags: Precursor gi|21553369|gb|AAM62462.1| unknown [Arabidopsis thaliana] gi|94442407|gb|ABF18991.1| At5g04900 [Arabidopsis thaliana] gi|134254417|dbj|BAF49742.1| short-chain dehydrogenase/reductase AtNOL1 [Arabidopsis thaliana] gi|332003419|gb|AED90802.1| chlorophyll(ide) b reductase NOL [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297806477\|ref\|XP_002871122.1\| short-chain dehydrogenase/reductase family protein [Arabidopsis lyrata subsp. lyrata] gi\|297316959\|gb\|EFH47381.1\| short-chain dehydrogenase/reductase family protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|345846651\|gb\|AEO19897.1\| chlorophyll(ide) b reductase [Pyrus x bretschneideri]	Back alignment and taxonomy information

>gi|75298085|sp|Q84ST4.1|NOL_ORYSJ RecName: Full=Chlorophyll(ide) b reductase NOL, chloroplastic; AltName: Full=Protein NON-YELLOW COLORING 1-LIKE; Short=OsNOL; Short=Protein NYC1-LIKE; AltName: Full=Short-chain dehydrogenase/reductase NOL; Flags: Precursor gi|29244639|gb|AAO73232.1| putative oxidoreductase protein [Oryza sativa Japonica Group] gi|50582763|gb|AAT78833.1| putative short chain dehydrogenase (having alternative splicing products) [Oryza sativa Japonica Group] gi|134254415|dbj|BAF49741.1| short-chain dehydrogenase/reductase NOL1 [Oryza sativa Japonica Group] gi|218193420|gb|EEC75847.1| hypothetical protein OsI_12846 [Oryza sativa Indica Group] gi|222625482|gb|EEE59614.1| hypothetical protein OsJ_11943 [Oryza sativa Japonica Group]

Back alignment and taxonomy information

>gi\|326519666\|dbj\|BAK00206.1\| predicted protein [Hordeum vulgare subsp. vulgare]	Back alignment and taxonomy information

>gi\|226532277\|ref\|NP_001146883.1\| short-chain dehydrogenase/reductase SDR [Zea mays] gi\|195604660\|gb\|ACG24160.1\| short-chain dehydrogenase/reductase SDR [Zea mays]	Back alignment and taxonomy information

>gi\|238013532\|gb\|ACR37801.1\| unknown [Zea mays] gi\|413933565\|gb\|AFW68116.1\| short-chain dehydrogenase/reductase SDR [Zea mays]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		96
TAIR\|locus:2175254		348	NOL "NYC1-like" [Arabidopsis t	1.0	0.275	0.833	9.9e-39
UNIPROTKB\|Q84ST4		343	NOL "Chlorophyll(ide) b reduct	1.0	0.279	0.781	4.4e-36
TAIR\|locus:2119330		496	NYC1 "NON-YELLOW COLORING 1" [	0.562	0.108	0.454	5.2e-07
UNIPROTKB\|Q5N800		504	NYC1 "Probable chlorophyll(ide	0.854	0.162	0.344	6.9e-07

TAIR\|locus:2175254 NOL "NYC1-like" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 414 (150.8 bits), Expect = 9.9e-39, P = 9.9e-39
 Identities = 80/96 (83%), Positives = 90/96 (93%)

Query:     1 MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSIAASG 60
             MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPA+VVAE LVP IR+I ASG
Sbjct:   253 MQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASG 312

Query:    61 STKPTYLRFLTGVKAYSQIFSRIAFGARRNRYILED 96
             S KPTY+RFLTG+KAY++IFSR+A GAR+NRY+ E+
Sbjct:   313 SMKPTYIRFLTGIKAYTKIFSRVALGARKNRYVTEE 348

GO:0000166 "nucleotide binding" evidence=IEA

GO:0008152 "metabolic process" evidence=IEA

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0016491 "oxidoreductase activity" evidence=IEA;ISS

GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=TAS

GO:0015996 "chlorophyll catabolic process" evidence=IDA

GO:0034256 "chlorophyll(ide) b reductase activity" evidence=IDA

GO:0005515 "protein binding" evidence=IPI

UNIPROTKB\|Q84ST4 NOL "Chlorophyll(ide) b reductase NOL, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

TAIR\|locus:2119330 NYC1 "NON-YELLOW COLORING 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5N800 NYC1 "Probable chlorophyll(ide) b reductase NYC1, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q84ST4	NOL_ORYSJ	1, ., 1, ., 1, ., 2, 9, 4	0.7812	1.0	0.2798	yes	no
Q8LEU3	NOL_ARATH	1, ., 1, ., 1, ., 2, 9, 4	0.8333	1.0	0.2758	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		96
PRK05599		246	hypothetical protein; Provisional	94.78
PRK05855		582	short chain dehydrogenase; Validated	94.5
TIGR01500		256	sepiapter_red sepiapterin reductase. This model de	94.5
PRK08177		225	short chain dehydrogenase; Provisional	93.71
PRK07832		272	short chain dehydrogenase; Provisional	93.33
PF13561		241	adh_short_C2: Enoyl-(Acyl carrier protein) reducta	93.2
PRK06463		255	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	92.82
PRK12481		251	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	92.81
PRK06139		330	short chain dehydrogenase; Provisional	92.53
PRK12747		252	short chain dehydrogenase; Provisional	92.49
PRK07035		252	short chain dehydrogenase; Provisional	92.42
PRK06940		275	short chain dehydrogenase; Provisional	92.18
COG4221		246	Short-chain alcohol dehydrogenase of unknown speci	92.16
PRK07478		254	short chain dehydrogenase; Provisional	92.13
PRK06841		255	short chain dehydrogenase; Provisional	92.04
PRK06172		253	short chain dehydrogenase; Provisional	91.93
PRK08416		260	7-alpha-hydroxysteroid dehydrogenase; Provisional	91.62
PRK06947		248	glucose-1-dehydrogenase; Provisional	91.62
PRK06079		252	enoyl-(acyl carrier protein) reductase; Provisiona	91.37
PRK12937		245	short chain dehydrogenase; Provisional	91.31
PLN00015		308	protochlorophyllide reductase	91.27
PRK07889		256	enoyl-(acyl carrier protein) reductase; Provisiona	91.26
PRK06603		260	enoyl-(acyl carrier protein) reductase; Provisiona	91.23
PRK08690		261	enoyl-(acyl carrier protein) reductase; Provisiona	91.05
TIGR01289		314	LPOR light-dependent protochlorophyllide reductase	90.71
PRK06114		254	short chain dehydrogenase; Provisional	90.69
PRK08642		253	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	90.64
PRK12428		241	3-alpha-hydroxysteroid dehydrogenase; Provisional	90.6
PRK07904		253	short chain dehydrogenase; Provisional	90.13
PRK07533		258	enoyl-(acyl carrier protein) reductase; Provisiona	90.1
PRK05650		270	short chain dehydrogenase; Provisional	89.88
PLN02780		320	ketoreductase/ oxidoreductase	89.8
PRK07831		262	short chain dehydrogenase; Provisional	89.46
PRK06505		271	enoyl-(acyl carrier protein) reductase; Provisiona	89.39
PRK06113		255	7-alpha-hydroxysteroid dehydrogenase; Validated	89.34
PRK07063		260	short chain dehydrogenase; Provisional	89.29
PRK08594		257	enoyl-(acyl carrier protein) reductase; Provisiona	89.23
PRK08226		263	short chain dehydrogenase; Provisional	89.22
PRK06997		260	enoyl-(acyl carrier protein) reductase; Provisiona	89.02
TIGR01832		248	kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod	88.95
PRK08339		263	short chain dehydrogenase; Provisional	88.91
PRK05693		274	short chain dehydrogenase; Provisional	88.32
PRK09009		235	C factor cell-cell signaling protein; Provisional	88.25
PRK07024		257	short chain dehydrogenase; Provisional	88.07
PRK05866		293	short chain dehydrogenase; Provisional	87.86
PRK07985		294	oxidoreductase; Provisional	87.74
PRK06125		259	short chain dehydrogenase; Provisional	87.57
PRK07984		262	enoyl-(acyl carrier protein) reductase; Provisiona	87.54
PRK12939		250	short chain dehydrogenase; Provisional	87.52
PRK05867		253	short chain dehydrogenase; Provisional	87.23
KOG1611		249	consensus Predicted short chain-type dehydrogenase	87.2
PRK08993		253	2-deoxy-D-gluconate 3-dehydrogenase; Validated	87.13
KOG1199		260	consensus Short-chain alcohol dehydrogenase/3-hydr	87.08
PLN02730		303	enoyl-[acyl-carrier-protein] reductase	87.06
PRK08159		272	enoyl-(acyl carrier protein) reductase; Provisiona	87.03
PRK06924		251	short chain dehydrogenase; Provisional	86.97
PRK07231		251	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	86.5
PRK06179		270	short chain dehydrogenase; Provisional	86.32
PRK05993		277	short chain dehydrogenase; Provisional	86.24
PRK06182		273	short chain dehydrogenase; Validated	86.19
PRK07069		251	short chain dehydrogenase; Validated	86.11
PRK08415		274	enoyl-(acyl carrier protein) reductase; Provisiona	86.02
PRK07062		265	short chain dehydrogenase; Provisional	85.9
PRK07856		252	short chain dehydrogenase; Provisional	85.89
PRK08936		261	glucose-1-dehydrogenase; Provisional	85.68
PRK12827		249	short chain dehydrogenase; Provisional	85.56
PRK05565		247	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	85.35
PRK05872		296	short chain dehydrogenase; Provisional	84.87
KOG1201		300	consensus Hydroxysteroid 17-beta dehydrogenase 11	84.86
PRK06398		258	aldose dehydrogenase; Validated	84.55
PRK06701		290	short chain dehydrogenase; Provisional	84.41
PRK08589		272	short chain dehydrogenase; Validated	84.34
PRK07577		234	short chain dehydrogenase; Provisional	84.17
PRK06550		235	fabG 3-ketoacyl-(acyl-carrier-protein) reductase;	83.62
PRK06484		520	short chain dehydrogenase; Validated	83.49
PRK06128		300	oxidoreductase; Provisional	83.48
TIGR01831		239	fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas	83.42
PRK06101		240	short chain dehydrogenase; Provisional	83.32
PRK08085		254	gluconate 5-dehydrogenase; Provisional	83.11
KOG1204		253	consensus Predicted dehydrogenase [Secondary metab	82.99
PRK09072		263	short chain dehydrogenase; Provisional	82.87
PRK07814		263	short chain dehydrogenase; Provisional	82.84
PRK08265		261	short chain dehydrogenase; Provisional	82.7
COG0300		265	DltE Short-chain dehydrogenases of various substra	82.36
PRK07201		657	short chain dehydrogenase; Provisional	82.26
PRK05876		275	short chain dehydrogenase; Provisional	82.01
PRK07060		245	short chain dehydrogenase; Provisional	81.77
PRK06935		258	2-deoxy-D-gluconate 3-dehydrogenase; Provisional	81.7
PRK08251		248	short chain dehydrogenase; Provisional	80.91
PRK06949		258	short chain dehydrogenase; Provisional	80.74

>PRK05599 hypothetical protein; Provisional	Back alignment and domain information

Probab=94.78  E-value=0.082  Score=38.75  Aligned_cols=45  Identities=20%  Similarity=0.159  Sum_probs=32.5

Q ss_pred             CceeEEeecCcchhhhhhhhcCCChHHHHHHHHHhCCchHhHHHHHHHHHHhh
Q 034377            4 VKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPADVVAECLVPKIRSI   56 (96)
Q Consensus         4 ~~~V~Vh~LSPGMV~TdLL~~~a~~~~~k~f~nilaE~petVA~~Lv~ri~~~   56 (96)
                      -++|.|..++||+|.|++.... .+.      . +..+||.+|+.++--+...
T Consensus       170 ~~~I~v~~v~PG~v~T~~~~~~-~~~------~-~~~~pe~~a~~~~~~~~~~  214 (246)
T PRK05599        170 GSHVRLIIARPGFVIGSMTTGM-KPA------P-MSVYPRDVAAAVVSAITSS  214 (246)
T ss_pred             CCCceEEEecCCcccchhhcCC-CCC------C-CCCCHHHHHHHHHHHHhcC
Confidence            3579999999999999985332 111      0 1257999999998877664

>PRK05855 short chain dehydrogenase; Validated	Back alignment and domain information

>TIGR01500 sepiapter_red sepiapterin reductase	Back alignment and domain information

>PRK08177 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07832 short chain dehydrogenase; Provisional	Back alignment and domain information

>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B	Back alignment and domain information

>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK06139 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK12747 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07035 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06940 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only]	Back alignment and domain information

>PRK07478 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06841 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06172 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional	Back alignment and domain information

>PRK06947 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK12937 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN00015 protochlorophyllide reductase	Back alignment and domain information

>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>TIGR01289 LPOR light-dependent protochlorophyllide reductase	Back alignment and domain information

>PRK06114 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional	Back alignment and domain information

>PRK07904 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK05650 short chain dehydrogenase; Provisional	Back alignment and domain information

>PLN02780 ketoreductase/ oxidoreductase	Back alignment and domain information

>PRK07831 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated	Back alignment and domain information

>PRK07063 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK08226 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase	Back alignment and domain information

>PRK08339 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05693 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK09009 C factor cell-cell signaling protein; Provisional	Back alignment and domain information

>PRK07024 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05866 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07985 oxidoreductase; Provisional	Back alignment and domain information

>PRK06125 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK12939 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05867 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only]	Back alignment and domain information

>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated	Back alignment and domain information

>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PLN02730 enoyl-[acyl-carrier-protein] reductase	Back alignment and domain information

>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK06924 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06179 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05993 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06182 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK07069 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional	Back alignment and domain information

>PRK07062 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07856 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08936 glucose-1-dehydrogenase; Provisional	Back alignment and domain information

>PRK12827 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK05872 short chain dehydrogenase; Provisional	Back alignment and domain information

>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK06398 aldose dehydrogenase; Validated	Back alignment and domain information

>PRK06701 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08589 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK07577 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional	Back alignment and domain information

>PRK06484 short chain dehydrogenase; Validated	Back alignment and domain information

>PRK06128 oxidoreductase; Provisional	Back alignment and domain information

>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative	Back alignment and domain information

>PRK06101 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08085 gluconate 5-dehydrogenase; Provisional	Back alignment and domain information

>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>PRK09072 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07814 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK08265 short chain dehydrogenase; Provisional	Back alignment and domain information

>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only]	Back alignment and domain information

>PRK07201 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK05876 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK07060 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional	Back alignment and domain information

>PRK08251 short chain dehydrogenase; Provisional	Back alignment and domain information

>PRK06949 short chain dehydrogenase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		96
4fgs_A		273	Probable dehydrogenase protein; PSI-biology, nysgr	95.27
3u5t_A		267	3-oxoacyl-[acyl-carrier-protein] reductase; struct	94.77
4fs3_A		256	Enoyl-[acyl-carrier-protein] reductase [NADPH] FA;	94.52
4fn4_A		254	Short chain dehydrogenase; NADH-binding, rossmann	94.45
4b79_A		242	PA4098, probable short-chain dehydrogenase; oxidor	94.39
3ek2_A		271	Enoyl-(acyl-carrier-protein) reductase (NADH); ssg	94.32
3tjr_A		301	Short chain dehydrogenase; structural genomics, se	94.28
3icc_A		255	Putative 3-oxoacyl-(acyl carrier protein) reducta;	94.18
4h15_A		261	Short chain alcohol dehydrogenase-related dehydro;	94.1
3ezl_A		256	Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA	94.08
4g81_D		255	Putative hexonate dehydrogenase; enzyme function i	93.99
3oig_A		266	Enoyl-[acyl-carrier-protein] reductase [NADH]; fat	93.93
3tl3_A		257	Short-chain type dehydrogenase/reductase; ssgcid,	93.74
3tzq_B		271	Short-chain type dehydrogenase/reductase; ssgcid,	93.73
4e3z_A		272	Putative oxidoreductase protein; PSI-biology, stru	93.69
3rd5_A		291	Mypaa.01249.C; ssgcid, structural genomics, seattl	93.67
3ksu_A		262	3-oxoacyl-acyl carrier protein reductase; structur	93.64
3o38_A		266	Short chain dehydrogenase; tuberculosis, ortholog	93.54
4hp8_A		247	2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi	93.37
1zmo_A		244	Halohydrin dehalogenase; haloalcohol dehalogenase,	93.06
3edm_A		259	Short chain dehydrogenase; structural genomics, ox	92.99
3guy_A		230	Short-chain dehydrogenase/reductase SDR; structura	92.97
4eso_A		255	Putative oxidoreductase; NADP, structural genomics	92.96
1sny_A		267	Sniffer CG10964-PA; alpha and beta protein, rossma	92.82
3ppi_A		281	3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de	92.75
3rwb_A		247	TPLDH, pyridoxal 4-dehydrogenase; short chain dehy	92.65
3lf2_A		265	Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross	92.51
3oid_A		258	Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa	92.44
3ijr_A		291	Oxidoreductase, short chain dehydrogenase/reducta;	92.43
3lyl_A		247	3-oxoacyl-(acyl-carrier-protein) reductase; alpha	92.41
4egf_A		266	L-xylulose reductase; structural genomics, ssgcid,	92.32
3is3_A		270	17BETA-hydroxysteroid dehydrogenase; short chain d	92.31
3gaf_A		256	7-alpha-hydroxysteroid dehydrogenase; seattle stru	92.3
3kzv_A		254	Uncharacterized oxidoreductase YIR035C; cytoplasmi	92.2
3nrc_A		280	Enoyl-[acyl-carrier-protein] reductase (NADH); ros	92.17
4imr_A		275	3-oxoacyl-(acyl-carrier-protein) reductase; oxidor	92.15
3qiv_A		253	Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR	92.14
3op4_A		248	3-oxoacyl-[acyl-carrier protein] reductase; 3-keto	92.07
3i1j_A		247	Oxidoreductase, short chain dehydrogenase/reducta;	91.93
3grk_A		293	Enoyl-(acyl-carrier-protein) reductase (NADH); ssg	91.82
3orf_A		251	Dihydropteridine reductase; alpha-beta-alpha sandw	91.81
3lt0_A		329	Enoyl-ACP reductase; triclosan, triclosan variant,	91.74
3p19_A		266	BFPVVD8, putative blue fluorescent protein; rossma	91.71
3s55_A		281	Putative short-chain dehydrogenase/reductase; stru	91.66
4ibo_A		271	Gluconate dehydrogenase; enzyme function initiativ	91.64
3n74_A		261	3-ketoacyl-(acyl-carrier-protein) reductase; seatt	91.45
3svt_A		281	Short-chain type dehydrogenase/reductase; ssgcid,	91.43
3uve_A		286	Carveol dehydrogenase ((+)-trans-carveol dehydrog;	91.39
2pd4_A		275	Enoyl-[acyl-carrier-protein] reductase [NADH]; ant	91.31
4iiu_A		267	3-oxoacyl-[acyl-carrier protein] reductase; struct	91.28
3uf0_A		273	Short-chain dehydrogenase/reductase SDR; gluconate	91.22
3pk0_A		262	Short-chain dehydrogenase/reductase SDR; ssgcid, s	91.17
3i4f_A		264	3-oxoacyl-[acyl-carrier protein] reductase; struct	91.14
3tfo_A		264	Putative 3-oxoacyl-(acyl-carrier-protein) reducta;	91.07
3osu_A		246	3-oxoacyl-[acyl-carrier-protein] reductase; struct	91.01
2ae2_A		260	Protein (tropinone reductase-II); oxidoreductase,	90.99
3tox_A		280	Short chain dehydrogenase; structural genomics, PS	90.94
2jah_A		247	Clavulanic acid dehydrogenase; short-chain dehydro	90.76
3gk3_A		269	Acetoacetyl-COA reductase; acetoacetyl-CO reductas	90.76
3oec_A		317	Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO;	90.76
4gkb_A		258	3-oxoacyl-[acyl-carrier protein] reductase; putati	90.75
1uls_A		245	Putative 3-oxoacyl-acyl carrier protein reductase;	90.73
3f9i_A		249	3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto	90.64
4dqx_A		277	Probable oxidoreductase protein; structural genomi	90.62
3sx2_A		278	Putative 3-ketoacyl-(acyl-carrier-protein) reduct;	90.6
3ioy_A		319	Short-chain dehydrogenase/reductase SDR; structura	90.59
3uce_A		223	Dehydrogenase; rossmann fold, oxidoreductase; HET:	90.56
3t4x_A		267	Oxidoreductase, short chain dehydrogenase/reducta;	90.52
1wma_A		276	Carbonyl reductase [NADPH] 1; oxidoreductase; HET:	90.48
1oaa_A		259	Sepiapterin reductase; tetrahydrobiopterin, oxidor	90.47
3rkr_A		262	Short chain oxidoreductase; rossmann fold; HET: NA	90.45
1jtv_A		327	17 beta-hydroxysteroid dehydrogenase type 1; stero	90.39
2o2s_A		315	Enoyl-acyl carrier reductase; enoyl reductase, tri	90.35
2ptg_A		319	Enoyl-acyl carrier reductase; apicomplexa, enoyl (	90.17
3e9n_A		245	Putative short-chain dehydrogenase/reductase; stru	90.07
3vtz_A		269	Glucose 1-dehydrogenase; rossmann fold, oxidoreduc	90.0
2x9g_A		288	PTR1, pteridine reductase; short chain dehydrogena	89.95
1e7w_A		291	Pteridine reductase; dihydrofolate reductase, shor	89.84
3grp_A		266	3-oxoacyl-(acyl carrierprotein) reductase; structu	89.82
1yo6_A		250	Putative carbonyl reductase sniffer; tyrosine-depe	89.82
2uvd_A		246	3-oxoacyl-(acyl-carrier-protein) reductase; beta-k	89.8
3l77_A		235	Short-chain alcohol dehydrogenase; oxidoreductase;	89.65
3nyw_A		250	Putative oxidoreductase; fatty acid synthesis,3-ox	89.45
3rku_A		287	Oxidoreductase YMR226C; substrate fingerprint, sho	89.45
3k31_A		296	Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI	89.44
1sby_A		254	Alcohol dehydrogenase; ternary complex, NAD, trifl	89.43
4e4y_A		244	Short chain dehydrogenase family protein; structur	89.22
2wyu_A		261	Enoyl-[acyl carrier protein] reductase; oxidoreduc	89.2
3o26_A		311	Salutaridine reductase; short chain dehydrogenase/	89.16
3l6e_A		235	Oxidoreductase, short-chain dehydrogenase/reducta;	89.1
1fmc_A		255	7 alpha-hydroxysteroid dehydrogenase; short-chain	88.94
1ae1_A		273	Tropinone reductase-I; oxidoreductase, tropane alk	88.91
3ftp_A		270	3-oxoacyl-[acyl-carrier protein] reductase; ssgcid	88.8
1ooe_A		236	Dihydropteridine reductase; structural genomics, P	88.75
3imf_A		257	Short chain dehydrogenase; structural genomics, in	88.68
3h7a_A		252	Short chain dehydrogenase; oxidoreductase, PSI-2,	88.61
4da9_A		280	Short-chain dehydrogenase/reductase; structural ge	88.6
3ucx_A		264	Short chain dehydrogenase; ssgcid, seattle structu	88.57
2cfc_A		250	2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor	88.51
2gdz_A		267	NAD+-dependent 15-hydroxyprostaglandin dehydrogen;	88.38
3gdg_A		267	Probable NADP-dependent mannitol dehydrogenase; ro	88.26
1uay_A		242	Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid	88.24
2a4k_A		263	3-oxoacyl-[acyl carrier protein] reductase; reduct	88.22
2ekp_A		239	2-deoxy-D-gluconate 3-dehydrogenase; structural ge	88.16
3t7c_A		299	Carveol dehydrogenase; structural genomics, seattl	88.13
3uxy_A		266	Short-chain dehydrogenase/reductase SDR; structura	87.89
3sju_A		279	Keto reductase; short-chain dehydrogenase, oxidore	87.82
1zem_A		262	Xylitol dehydrogenase; rossmann fold, dinucleotide	87.8
1dhr_A		241	Dihydropteridine reductase; oxidoreductase(acting	87.72
2qhx_A		328	Pteridine reductase 1; oxidoreductase, short-chain	87.68
4fc7_A		277	Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman	87.63
2o23_A		265	HADH2 protein; HSD17B10, schad, ERAB, type II HADH	87.6
3tpc_A		257	Short chain alcohol dehydrogenase-related dehydro;	87.6
3a28_C		258	L-2.3-butanediol dehydrogenase; chiral substrate r	87.55
3v2g_A		271	3-oxoacyl-[acyl-carrier-protein] reductase; struct	87.47
1qsg_A		265	Enoyl-[acyl-carrier-protein] reductase; enoyl redu	87.32
1d7o_A		297	Enoyl-[acyl-carrier protein] reductase (NADH) PRE;	87.02
3f1l_A		252	Uncharacterized oxidoreductase YCIK; E. coli, NADP	87.01
3v8b_A		283	Putative dehydrogenase, possibly 3-oxoacyl-[acyl-	86.85
1h5q_A		265	NADP-dependent mannitol dehydrogenase; oxidoreduct	86.74
4dyv_A		272	Short-chain dehydrogenase/reductase SDR; structura	86.65
2wsb_A		254	Galactitol dehydrogenase; oxidoreductase, SDR, ros	86.63
1zmt_A		254	Haloalcohol dehalogenase HHEC; halohydrin dehaloge	86.52
3ged_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	86.47
3dii_A		247	Short-chain dehydrogenase/reductase SDR; SCOR, ros	86.39
1geg_A		256	Acetoin reductase; SDR family, oxidoreductase; HET	86.3
1iy8_A		267	Levodione reductase; oxidoreductase; HET: NAD; 1.6	86.18
3asu_A		248	Short-chain dehydrogenase/reductase SDR; SDR famil	86.08
3pgx_A		280	Carveol dehydrogenase; structural genomics, seattl	86.02
2nm0_A		253	Probable 3-oxacyl-(acyl-carrier-protein) reductas;	85.82
4iin_A		271	3-ketoacyl-acyl carrier protein reductase (FABG);	85.76
2c07_A		285	3-oxoacyl-(acyl-carrier protein) reductase; oxidor	85.61
2z1n_A		260	Dehydrogenase; reductase, SDR, oxidoreductase; 1.8	85.6
1uzm_A		247	3-oxoacyl-[acyl-carrier protein] reductase; beta-k	85.57
3awd_A		260	GOX2181, putative polyol dehydrogenase; oxidoreduc	85.56
1xu9_A		286	Corticosteroid 11-beta-dehydrogenase, isozyme 1; h	85.47
1o5i_A		249	3-oxoacyl-(acyl carrier protein) reductase; TM1169	85.44
2ph3_A		245	3-oxoacyl-[acyl carrier protein] reductase; TTHA04	85.32
3ctm_A		279	Carbonyl reductase; alcohol dehydrogenase, short-c	85.27
1fjh_A		257	3alpha-hydroxysteroid dehydrogenase/carbonyl reduc	85.24
2p91_A		285	Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD	85.07
3e03_A		274	Short chain dehydrogenase; structural genomics, PS	85.03
3d3w_A		244	L-xylulose reductase; uronate cycle, short-chain d	84.96
1g0o_A		283	Trihydroxynaphthalene reductase; protein-NADPH-act	84.95
3r3s_A		294	Oxidoreductase; structural genomics, csgid, center	84.94
1mxh_A		276	Pteridine reductase 2; SDR topology, protein-subst	84.86
1vl8_A		267	Gluconate 5-dehydrogenase; TM0441, structural geno	84.86
3cxt_A		291	Dehydrogenase with different specificities; rossma	84.74
4e6p_A		259	Probable sorbitol dehydrogenase (L-iditol 2-dehyd;	84.73
2fwm_X		250	2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e	84.73
2zat_A		260	Dehydrogenase/reductase SDR family member 4; alpha	84.62
2hq1_A		247	Glucose/ribitol dehydrogenase; CTH-1438, structura	84.37
1x1t_A		260	D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S	83.96
1edo_A		244	Beta-keto acyl carrier protein reductase; nucleoti	83.82
2d1y_A		256	Hypothetical protein TT0321; strucrtural genomics,	83.81
2nwq_A		272	Probable short-chain dehydrogenase; oxidoreductase	83.57
1xq1_A		266	Putative tropinone reducatse; structural genomics,	83.51
1yb1_A		272	17-beta-hydroxysteroid dehydrogenase type XI; shor	83.35
1zk4_A		251	R-specific alcohol dehydrogenase; short chain redu	83.14
3rih_A		293	Short chain dehydrogenase or reductase; structural	83.09
1cyd_A		244	Carbonyl reductase; short-chain dehydrogenase, oxi	82.96
2bgk_A		278	Rhizome secoisolariciresinol dehydrogenase; oxidor	82.66
1gee_A		261	Glucose 1-dehydrogenase; short-chain dehydrogenase	82.43
2rhc_B		277	Actinorhodin polyketide ketoreductase; oxidoreduct	82.41
2dtx_A		264	Glucose 1-dehydrogenase related protein; rossmann	82.39
2ag5_A		246	DHRS6, dehydrogenase/reductase (SDR family) member	82.2
3r1i_A		276	Short-chain type dehydrogenase/reductase; structur	81.82
3ak4_A		263	NADH-dependent quinuclidinone reductase; SDR, (R)-	81.74
2b4q_A		276	Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier	81.26
3un1_A		260	Probable oxidoreductase; structural genomics, PSI-	81.12
4dmm_A		269	3-oxoacyl-[acyl-carrier-protein] reductase; rossma	80.63
2pnf_A		248	3-oxoacyl-[acyl-carrier-protein] reductase; short	80.59
1yde_A		270	Retinal dehydrogenase/reductase 3; oxidoreductase,	80.11
3ai3_A		263	NADPH-sorbose reductase; rossmann-fold, NADPH-depe	80.03

>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli}	Back alignment and structure

Probab=95.27  E-value=0.011  Score=44.61  Aligned_cols=23  Identities=26%  Similarity=0.349  Sum_probs=15.4

Q ss_pred             CCceeEEeecCcchhhhhhhhcC
Q 034377            3 DVKNVVVHNLSPGMVTTDLLMSG   25 (96)
Q Consensus         3 ~~~~V~Vh~LSPGMV~TdLL~~~   25 (96)
                      +-.+|.|..++||.|.||++.+-
T Consensus       192 a~~gIrVN~V~PG~i~T~~~~~~  214 (273)
T 4fgs_A          192 KDRGIRINTLSPGPTETTGLVEL  214 (273)
T ss_dssp             TTSCEEEEEEEECSBCC------
T ss_pred             cccCeEEEEEeeCCCCChhHHHh
Confidence            45689999999999999998664

PyMOL of 4fgs

>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti}	Back alignment and structure

>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A	Back alignment and structure

>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius}	Back alignment and structure

>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1}	Back alignment and structure

>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2	Back alignment and structure

>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp}	Back alignment and structure

>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str}	Back alignment and structure

>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A*	Back alignment and structure

>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0	Back alignment and structure

>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp}	Back alignment and structure

>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A*	Back alignment and structure

>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans}	Back alignment and structure

>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0	Back alignment and structure

>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli}	Back alignment and structure

>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis}	Back alignment and structure

>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1}	Back alignment and structure

>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis}	Back alignment and structure

>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens}	Back alignment and structure

>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP}	Back alignment and structure

>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str}	Back alignment and structure

>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus}	Back alignment and structure

>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A	Back alignment and structure

>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2	Back alignment and structure

>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium}	Back alignment and structure

>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A*	Back alignment and structure

>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A*	Back alignment and structure

>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A*	Back alignment and structure

>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A*	Back alignment and structure

>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2	Back alignment and structure

>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis}	Back alignment and structure

>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A	Back alignment and structure

>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis}	Back alignment and structure

>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A*	Back alignment and structure

>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum}	Back alignment and structure

>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp}	Back alignment and structure

>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E	Back alignment and structure

>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0	Back alignment and structure

>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A*	Back alignment and structure

>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum}	Back alignment and structure

>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ...	Back alignment and structure

>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus}	Back alignment and structure

>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0	Back alignment and structure

>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum}	Back alignment and structure

>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus}	Back alignment and structure

>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans}	Back alignment and structure

>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A*	Back alignment and structure

>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A*	Back alignment and structure

>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A*	Back alignment and structure

>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0	Back alignment and structure

>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0	Back alignment and structure

>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti}	Back alignment and structure

>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A*	Back alignment and structure

>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A*	Back alignment and structure

>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti}	Back alignment and structure

>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A*	Back alignment and structure

>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B}	Back alignment and structure

>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile}	Back alignment and structure

>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A*	Back alignment and structure

>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0	Back alignment and structure

>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli}	Back alignment and structure

>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp}	Back alignment and structure

>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444}	Back alignment and structure

>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus}	Back alignment and structure

>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis}	Back alignment and structure

>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A*	Back alignment and structure

>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A*	Back alignment and structure

>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5}	Back alignment and structure

>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ...	Back alignment and structure

>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A*	Back alignment and structure

>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella}	Back alignment and structure

>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum}	Back alignment and structure

>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium}	Back alignment and structure

>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ...	Back alignment and structure

>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A*	Back alignment and structure

>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A	Back alignment and structure

>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis}	Back alignment and structure

>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A*	Back alignment and structure

>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A*	Back alignment and structure

>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A*	Back alignment and structure

>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp}	Back alignment and structure

>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A*	Back alignment and structure

>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0	Back alignment and structure

>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0	Back alignment and structure

>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A*	Back alignment and structure

>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2	Back alignment and structure

>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei}	Back alignment and structure

>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2	Back alignment and structure

>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str}	Back alignment and structure

>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris}	Back alignment and structure

>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti}	Back alignment and structure

>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0	Back alignment and structure

>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus}	Back alignment and structure

>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A	Back alignment and structure

>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A	Back alignment and structure

>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium}	Back alignment and structure

>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides}	Back alignment and structure

>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber}	Back alignment and structure

>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2	Back alignment and structure

>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A*	Back alignment and structure

>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2	Back alignment and structure

>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A*	Back alignment and structure

>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A*	Back alignment and structure

>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti}	Back alignment and structure

>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum}	Back alignment and structure

>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti}	Back alignment and structure

>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A*	Back alignment and structure

>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A*	Back alignment and structure

>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A	Back alignment and structure

>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti}	Back alignment and structure

>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2	Back alignment and structure

>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus}	Back alignment and structure

>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A*	Back alignment and structure

>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A*	Back alignment and structure

>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A*	Back alignment and structure

>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2	Back alignment and structure

>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2	Back alignment and structure

>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A*	Back alignment and structure

>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0	Back alignment and structure

>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor}	Back alignment and structure

>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A	Back alignment and structure

>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2	Back alignment and structure

>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix}	Back alignment and structure

>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A	Back alignment and structure

>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans}	Back alignment and structure

>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ...	Back alignment and structure

>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8}	Back alignment and structure

>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis}	Back alignment and structure

>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A*	Back alignment and structure

>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus}	Back alignment and structure

>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV}	Back alignment and structure

>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A*	Back alignment and structure

>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A*	Back alignment and structure

>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp}	Back alignment and structure

>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A*	Back alignment and structure

>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2	Back alignment and structure

>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A	Back alignment and structure

>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli}	Back alignment and structure

>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A*	Back alignment and structure

>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum}	Back alignment and structure

>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A*	Back alignment and structure

>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G	Back alignment and structure

>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2	Back alignment and structure

>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A	Back alignment and structure

>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A	Back alignment and structure

>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus}	Back alignment and structure

>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2	Back alignment and structure

>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A*	Back alignment and structure

>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A*	Back alignment and structure

>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A*	Back alignment and structure

>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A	Back alignment and structure

>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum}	Back alignment and structure

>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens}	Back alignment and structure

>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa}	Back alignment and structure

>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti}	Back alignment and structure

>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A*	Back alignment and structure

>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A*	Back alignment and structure

>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2	Back alignment and structure

>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		96
d1jtva_		285	Human estrogenic 17beta-hydroxysteroid dehydrogena	97.16
d2a4ka1		241	beta-keto acyl carrier protein reductase {Thermus	96.42
d1oaaa_		259	Sepiapterin reductase {Mouse (Mus musculus) [TaxId	96.21
d1yo6a1		250	Putative carbonyl reductase sniffer {Caenorhabditi	96.21
d1xu9a_		269	11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom	96.17
d1fmca_		255	7-alpha-hydroxysteroid dehydrogenase {Escherichia	96.07
d1vl8a_		251	Gluconate 5-dehydrogenase {Thermotoga maritima [Ta	95.8
d1sbya1		254	Drosophila alcohol dehydrogenase {Fly (Drosophila	95.8
d1ae1a_		258	Tropinone reductase {Jimsonweed (Datura stramonium	95.79
d1snya_		248	Carbonyl reductase sniffer {Fruit fly (Drosophila	95.78
d1xkqa_		272	Hypothetical protein R05D8.7 {Caenorhabditis elega	95.64
d2ew8a1		247	(s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb	95.44
d2ae2a_		259	Tropinone reductase {Jimsonweed (Datura stramonium	95.41
d1yb1a_		244	17-beta-hydroxysteroid dehydrogenase type XI {Huma	95.28
d1pr9a_		244	Carbonyl reductase {Human (Homo sapiens) [TaxId: 9	95.25
d2bgka1		268	Rhizome secoisolariciresinol dehydrogenase {Mayapp	95.08
d1spxa_		264	Glucose dehydrogenase (5l265) {Nematode (Caenorhab	95.07
d2d1ya1		248	Hypothetical protein TTHA0369 {Thermus thermophilu	95.07
d1xq1a_		259	Tropinone reductase {Thale cress (Arabidopsis thal	95.05
d1zk4a1		251	R-specific alcohol dehydrogenase {Lactobacillus br	95.04
d1wmaa1		275	Carbonyl reductase/20beta-hydroxysteroid dehydroge	94.97
d1qsga_		258	Enoyl-ACP reductase {Escherichia coli [TaxId: 562]	94.91
d1dhra_		236	Dihydropteridin reductase (pteridine reductase) {R	94.8
d1ulsa_		242	beta-keto acyl carrier protein reductase {Thermus	94.66
d1uaya_		241	Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t	94.63
d1q7ba_		243	beta-keto acyl carrier protein reductase {Escheric	94.61
d1xhla_		274	Hypothetical protein F25D1.5 {Caenorhabditis elega	94.56
d1ydea1		250	Retinal dehydrogenase/reductase 3 {Human (Homo sap	94.52
d1cyda_		242	Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1	94.4
d2bd0a1		240	Bacterial sepiapterin reductase {Chlorobium tepidu	94.37
d1fjha_		257	3-alpha-hydroxysteroid dehydrogenase {Comamonas te	94.28
d2c07a1		251	beta-keto acyl carrier protein reductase {Malaria	94.27
d1geea_		261	Glucose dehydrogenase {Bacillus megaterium [TaxId:	94.26
d1w6ua_		294	2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H	94.18
d1iy8a_		258	Levodione reductase {Corynebacterium aquaticum [Ta	94.05
d2rhca1		257	beta-keto acyl carrier protein reductase {Streptom	94.03
d1h5qa_		260	Mannitol dehydrogenase {Mushroom (Agaricus bisporu	94.01
d1hdca_		254	3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre	93.75
d1d7oa_		297	Enoyl-ACP reductase {Oil seed rape (Brassica napus	93.71
d1o5ia_		234	beta-keto acyl carrier protein reductase {Thermoto	93.63
d2gdza1		254	15-hydroxyprostaglandin dehydrogenase, PGDH {Human	93.63
d1zmta1		252	Halohydrin dehalogenase HheC {Agrobacterium tumefa	93.46
d2o23a1		248	Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho	93.4
d1edoa_		244	beta-keto acyl carrier protein reductase {Oil seed	93.34
d1zema1		260	Xylitol dehydrogenase {Gluconobacter oxydans [TaxI	93.3
d2pd4a1		274	Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2	93.17
d1ja9a_		259	1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl	92.99
d1yxma1		297	Peroxisomal trans 2-enoyl CoA reductase {Human (Ho	92.99
d1uzma1		237	beta-keto acyl carrier protein reductase {Mycobact	92.96
d1hxha_		253	3beta/17beta hydroxysteroid dehydrogenase {Comamon	92.93
d1ulua_		256	Enoyl-ACP reductase {Thermus thermophilus [TaxId:	92.75
d1g0oa_		272	1,3,8-trihydroxynaphtalene reductase (THNR, naphto	92.31
d1x1ta1		260	D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas	92.17
d1ooea_		235	Dihydropteridin reductase (pteridine reductase) {N	91.88
d1mxha_		266	Dihydropteridin reductase (pteridine reductase) {T	91.7
d2h7ma1		268	Enoyl-ACP reductase {Mycobacterium tuberculosis, T	91.68
d1k2wa_		256	Sorbitol dehydrogenase {Rhodobacter sphaeroides [T	91.49
d1bdba_		276	Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps	90.61
d1xg5a_		257	Putative dehydrogenase ARPG836 (MGC4172) {Human (H	89.53
d2ag5a1		245	Dehydrogenase/reductase SDR family member 6, DHRS6	88.53
d2bnma1		71	Hydroxypropylphosphonic acid epoxidase Fom4, N-ter	84.62
d1gz6a_		302	(3R)-hydroxyacyl-CoA dehydrogenase domain of estra	84.05
d1gega_		255	meso-2,3-butanediol dehydrogenase {Klebsiella pneu	83.86
d1nffa_		244	Putative oxidoreductase Rv2002 {Mycobacterium tube	81.77

>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Human estrogenic 17beta-hydroxysteroid dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.16  E-value=0.00033  Score=50.56  Aligned_cols=72  Identities=19%  Similarity=0.206  Sum_probs=40.8

Q ss_pred             CceeEEeecCcchhhhhhhhcC-CCh---------HHHHHHHH----------HhCCchHhHHHHHHHHHHhhhccCCCC
Q 034377            4 VKNVVVHNLSPGMVTTDLLMSG-ATT---------KQAKFFIN----------VLAEPADVVAECLVPKIRSIAASGSTK   63 (96)
Q Consensus         4 ~~~V~Vh~LSPGMV~TdLL~~~-a~~---------~~~k~f~n----------ilaE~petVA~~Lv~ri~~~~~~~~~~   63 (96)
                      -.+|.|..++||+|.|+++..- .++         +..+++..          --.-+||.||+.++.-+.+.       
T Consensus       175 ~~gIrVn~V~PG~v~T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PeeVA~~v~~~~~~~-------  247 (285)
T d1jtva_         175 PFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEVFLTALRAP-------  247 (285)
T ss_dssp             GGTEEEEEEEECCBCC-------CCHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHCBCHHHHHHHHHHHHHCS-------
T ss_pred             ccCcEEEEEecCCCCChHHHHhccCHHHHhhccchhHHHHHHHHHHHHhhhhcccCCCHHHHHHHHHHHHhCC-------
Confidence            3579999999999999987653 221         11222222          22457999999777544432       


Q ss_pred             CceEEeeChhHHHHHHHHH
Q 034377           64 PTYLRFLTGVKAYSQIFSR   82 (96)
Q Consensus        64 g~~I~~LT~~kal~ki~~R   82 (96)
                      -..++|+|+.+.+.-+.+|
T Consensus       248 ~p~~ry~~g~~~~~~~~~~  266 (285)
T d1jtva_         248 KPTLRYFTTERFLPLLRMR  266 (285)
T ss_dssp             SCCSEEESCSTTHHHHHHH
T ss_pred             CCCeEEecHHHHHHHHHHH
Confidence            1236899998765444333

PyMOL of d1jtva_

>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]}	Back information, alignment and structure

>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]}	Back information, alignment and structure

>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]}	Back information, alignment and structure

>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]}	Back information, alignment and structure

>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]}	Back information, alignment and structure

>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]}	Back information, alignment and structure

>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}	Back information, alignment and structure

>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]}	Back information, alignment and structure

>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]}	Back information, alignment and structure

>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]}	Back information, alignment and structure

>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]}	Back information, alignment and structure

>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]}	Back information, alignment and structure

>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}	Back information, alignment and structure

>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}	Back information, alignment and structure

>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]}	Back information, alignment and structure

>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]}	Back information, alignment and structure

>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]}	Back information, alignment and structure

>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}	Back information, alignment and structure

>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]}	Back information, alignment and structure

>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bnma1 a.35.1.3 (A:6-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}	Back information, alignment and structure

>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]}	Back information, alignment and structure

>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure