Citrus Sinensis ID: 034410

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MHTFLCSQVEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYFVVGYGMDFAELYRNLPYVGVLKPECYK
cccEEEEEEEcEEcccHHHHHHHHHHHccccccEEEEEEEcccccEEEEEEEccccccEEEEEEccEEEEEEcccccccccccccEEEEcccccc
cccHHHHHEEEEEcccHHHHHHHHHHHcccccEEEEEEEEEEcccccEEEEEccccccEEEEEEEcccEEEccEcEccEccccccEEEEccHHcc
mhtflcsqVEDIVDTGTTLSSLIANLVSkgassvsvctlldkparRKIQVELVGegkfyrgfecpdyfvvgyGMDFAELyrnlpyvgvlkpecyk
mhtflcsqVEDIVDTGTTLSSLIANLVSKGASSVSVctlldkparrKIQVElvgegkfyrgfECPDYFVVGYGMDFAELYRNLPYVGVLKPECYK
MHTFLCSQVEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYFVVGYGMDFAELYRNLPYVGVLKPECYK
***FLCSQVEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYFVVGYGMDFAELYRNLPYVGVLKPE***
*HTFLCSQVEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYFVVGYGMDFAELYRNLPYVGVLKPECYK
MHTFLCSQVEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYFVVGYGMDFAELYRNLPYVGVLKPECYK
*HTFLCSQVEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYFVVGYGMDFAELYRNLPYVGVLKPECYK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHTFLCSQVEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYFVVGYGMDFAELYRNLPYVGVLKPECYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query95 2.2.26 [Sep-21-2011]
P65828179 Hypoxanthine-guanine phos yes no 0.852 0.452 0.546 1e-20
Q6GBX8179 Hypoxanthine-guanine phos yes no 0.852 0.452 0.546 1e-20
Q6GJG1179 Hypoxanthine-guanine phos yes no 0.852 0.452 0.546 1e-20
P99085179 Hypoxanthine-guanine phos yes no 0.852 0.452 0.546 1e-20
P65827179 Hypoxanthine-guanine phos yes no 0.852 0.452 0.546 1e-20
Q5HIG5179 Hypoxanthine-guanine phos yes no 0.852 0.452 0.546 1e-20
Q8YAC7648 Bifunctional protein TilS yes no 0.852 0.125 0.534 1e-20
Q724J4648 Bifunctional protein TilS yes no 0.852 0.125 0.534 1e-20
Q92F56648 Bifunctional protein TilS yes no 0.852 0.125 0.534 3e-20
Q8CQV4179 Hypoxanthine-guanine phos yes no 0.852 0.452 0.534 1e-19
>sp|P65828|HPRT_STAAW Hypoxanthine-guanine phosphoribosyltransferase OS=Staphylococcus aureus (strain MW2) GN=hpt PE=3 SV=1 Back     alignment and function desciption
 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 60/86 (69%), Gaps = 5/86 (5%)

Query: 9   VEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYF 68
           +EDI++TGTTL S+   L S+  +S+ + TLLDKP RRK  +E       Y G + PD F
Sbjct: 97  IEDILETGTTLKSITELLQSRKVNSLEIVTLLDKPNRRKADIE-----AKYVGKKIPDEF 151

Query: 69  VVGYGMDFAELYRNLPYVGVLKPECY 94
           VVGYG+D+ ELYRNLPY+G LKPE Y
Sbjct: 152 VVGYGLDYRELYRNLPYIGTLKPEVY 177

Staphylococcus aureus (strain MW2) (taxid: 196620)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 8
>sp|Q6GBX8|HPRT_STAAS Hypoxanthine-guanine phosphoribosyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=hpt PE=3 SV=1 Back     alignment and function description
>sp|Q6GJG1|HPRT_STAAR Hypoxanthine-guanine phosphoribosyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=hpt PE=3 SV=1 Back     alignment and function description
>sp|P99085|HPRT_STAAN Hypoxanthine-guanine phosphoribosyltransferase OS=Staphylococcus aureus (strain N315) GN=hpt PE=1 SV=1 Back     alignment and function description
>sp|P65827|HPRT_STAAM Hypoxanthine-guanine phosphoribosyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hpt PE=1 SV=1 Back     alignment and function description
>sp|Q5HIG5|HPRT_STAAC Hypoxanthine-guanine phosphoribosyltransferase OS=Staphylococcus aureus (strain COL) GN=hpt PE=3 SV=1 Back     alignment and function description
>sp|Q8YAC7|TILS_LISMO Bifunctional protein TilS/HprT OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tilS/hprT PE=3 SV=1 Back     alignment and function description
>sp|Q724J4|TILS_LISMF Bifunctional protein TilS/HprT OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tilS/hprT PE=3 SV=1 Back     alignment and function description
>sp|Q92F56|TILS_LISIN Bifunctional protein TilS/HprT OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tilS/hprT PE=3 SV=1 Back     alignment and function description
>sp|Q8CQV4|HPRT_STAES Hypoxanthine-guanine phosphoribosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hpt PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
255572309187 hypoxanthine-guanine phosphoribosyltrans 0.915 0.465 0.839 2e-37
226530643 266 bifunctional protein tilS/hprT [Zea mays 0.915 0.327 0.839 8e-37
242087115193 hypothetical protein SORBIDRAFT_09g00563 0.915 0.450 0.839 8e-37
195612222193 bifunctional protein tilS/hprT [Zea mays 0.915 0.450 0.839 1e-36
351734398185 hypoxanthine-guanine phosphoribosyltrans 0.915 0.470 0.816 6e-36
449446377187 PREDICTED: hypoxanthine-guanine phosphor 0.915 0.465 0.816 8e-36
449494059187 PREDICTED: hypoxanthine-guanine phosphor 0.915 0.465 0.816 8e-36
356535739185 PREDICTED: bifunctional protein tilS/hpr 0.915 0.470 0.804 1e-35
194466195187 hypoxanthine phosphoribosyltransferase [ 0.915 0.465 0.827 1e-35
225463085185 PREDICTED: hypoxanthine-guanine phosphor 0.915 0.470 0.827 2e-35
>gi|255572309|ref|XP_002527093.1| hypoxanthine-guanine phosphoribosyltransferase, putative [Ricinus communis] gi|223533516|gb|EEF35256.1| hypoxanthine-guanine phosphoribosyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  159 bits (401), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 73/87 (83%), Positives = 82/87 (94%)

Query: 9   VEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYF 68
           VEDIVDTG+TLSSLI++L SKGASSVSVCT LDKPARRK+  +L+G+GK+YRGFECPDYF
Sbjct: 101 VEDIVDTGSTLSSLISHLESKGASSVSVCTFLDKPARRKVHFQLLGDGKYYRGFECPDYF 160

Query: 69  VVGYGMDFAELYRNLPYVGVLKPECYK 95
           VVGYGMDFAELYRNLPYVGVLKPE Y+
Sbjct: 161 VVGYGMDFAELYRNLPYVGVLKPEYYQ 187

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|226530643|ref|NP_001147566.1| bifunctional protein tilS/hprT [Zea mays] gi|224034179|gb|ACN36165.1| unknown [Zea mays] gi|413944650|gb|AFW77299.1| bifunctional protein tilS/hprT [Zea mays] Back     alignment and taxonomy information
>gi|242087115|ref|XP_002439390.1| hypothetical protein SORBIDRAFT_09g005630 [Sorghum bicolor] gi|241944675|gb|EES17820.1| hypothetical protein SORBIDRAFT_09g005630 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|195612222|gb|ACG27941.1| bifunctional protein tilS/hprT [Zea mays] Back     alignment and taxonomy information
>gi|351734398|ref|NP_001236467.1| hypoxanthine-guanine phosphoribosyltransferase-like [Glycine max] gi|119639035|gb|ABL85241.1| putative hypoxanthine-guanine phosphoribosyltransferase [Glycine max] Back     alignment and taxonomy information
>gi|449446377|ref|XP_004140948.1| PREDICTED: hypoxanthine-guanine phosphoribosyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449494059|ref|XP_004159435.1| PREDICTED: hypoxanthine-guanine phosphoribosyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356535739|ref|XP_003536401.1| PREDICTED: bifunctional protein tilS/hprT-like [Glycine max] Back     alignment and taxonomy information
>gi|194466195|gb|ACF74328.1| hypoxanthine phosphoribosyltransferase [Arachis hypogaea] Back     alignment and taxonomy information
>gi|225463085|ref|XP_002263568.1| PREDICTED: hypoxanthine-guanine phosphoribosyltransferase [Vitis vinifera] gi|147785106|emb|CAN75448.1| hypothetical protein VITISV_030928 [Vitis vinifera] gi|297739372|emb|CBI29362.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
UNIPROTKB|A8JGE5240 CHLREDRAFT_132988 "Hypoxanthin 0.936 0.370 0.563 2.9e-23
TIGR_CMR|CHY_1067179 CHY_1067 "hypoxanthine phospho 0.863 0.458 0.551 3.9e-21
UNIPROTKB|Q7NGU7177 glr2790 "Hypoxanthine phosphor 0.831 0.446 0.6 9.2e-20
UNIPROTKB|A9WEI9181 Caur_2039 "Hypoxanthine phosph 0.863 0.453 0.505 6.5e-19
UNIPROTKB|P37472180 hprT "Hypoxanthine-guanine pho 0.863 0.455 0.528 6.5e-19
UNIPROTKB|Q9X8I5187 Q9X8I5 "Putative hypoxanthine 0.852 0.433 0.523 2.2e-18
TIGR_CMR|BA_0063180 BA_0063 "hypoxanthine phosphor 0.852 0.45 0.558 5.8e-18
TIGR_CMR|DET_0749174 DET_0749 "hypoxanthine phospho 0.789 0.431 0.55 7.5e-18
UNIPROTKB|A8IR93228 CHLREDRAFT_145152 "Predicted p 0.852 0.355 0.517 2.5e-17
TIGR_CMR|CPS_1752176 CPS_1752 "hypoxanthine phospho 0.821 0.443 0.518 4.1e-17
UNIPROTKB|A8JGE5 CHLREDRAFT_132988 "Hypoxanthine-guanine phosphoribosyltransferase" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
 Score = 268 (99.4 bits), Expect = 2.9e-23, P = 2.9e-23
 Identities = 53/94 (56%), Positives = 67/94 (71%)

Query:     2 HTFLCSQVEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRG 61
             H  +   VEDI+DTG TLS+L+A +   GA+SV VC LLDK ARR++ +E   E   Y G
Sbjct:   151 HKHMTLHVEDIIDTGNTLSALVAVMEGAGAASVRVCALLDKKARRRVPME--AE---YTG 205

Query:    62 FECPDYFVVGYGMDFAELYRNLPYVGVLKPECYK 95
             FECPD F+VGYG+D+AE YRNLPY+G +K E  K
Sbjct:   206 FECPDEFIVGYGIDYAEKYRNLPYIGAVKDEFIK 239
GO:0000287 "magnesium ion binding" evidence=IBA
GO:0004422 "hypoxanthine phosphoribosyltransferase activity" evidence=IBA
GO:0005829 "cytosol" evidence=IBA
GO:0006166 "purine ribonucleoside salvage" evidence=IBA
GO:0006168 "adenine salvage" evidence=IBA
GO:0006178 "guanine salvage" evidence=IBA
GO:0032263 "GMP salvage" evidence=IBA
GO:0032264 "IMP salvage" evidence=IBA
GO:0046100 "hypoxanthine metabolic process" evidence=IBA
TIGR_CMR|CHY_1067 CHY_1067 "hypoxanthine phosphoribosyltransferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q7NGU7 glr2790 "Hypoxanthine phosphoribosyltransferase" [Gloeobacter violaceus PCC 7421 (taxid:251221)] Back     alignment and assigned GO terms
UNIPROTKB|A9WEI9 Caur_2039 "Hypoxanthine phosphoribosyltransferase" [Chloroflexus aurantiacus J-10-fl (taxid:324602)] Back     alignment and assigned GO terms
UNIPROTKB|P37472 hprT "Hypoxanthine-guanine phosphoribosyltransferase" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
UNIPROTKB|Q9X8I5 Q9X8I5 "Putative hypoxanthine phosphoribosyltransferase" [Streptomyces coelicolor A3(2) (taxid:100226)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0063 BA_0063 "hypoxanthine phosphoribosyltransferase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0749 DET_0749 "hypoxanthine phosphoribosyltransferase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|A8IR93 CHLREDRAFT_145152 "Predicted protein" [Chlamydomonas reinhardtii (taxid:3055)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1752 CPS_1752 "hypoxanthine phosphoribosyltransferase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
Sb09g005630.1
hypothetical protein (193 aa)
(Sorghum bicolor)
Predicted Functional Partners:
Sb06g033930.1
hypothetical protein (545 aa)
•    •• 0.992
Sb01g011080.1
hypothetical protein; Plays an important role in the de novo pathway of purine nucleotide biosy [...] (489 aa)
•  • •• 0.981
Sb01g045540.1
hypothetical protein; Plays an important role in the de novo pathway of purine nucleotide biosy [...] (490 aa)
•    •• 0.981
Sb07g006010.1
hypothetical protein (601 aa)
•    •• 0.950
Sb06g028370.1
hypothetical protein (594 aa)
•    •• 0.950
Sb01g006320.1
hypothetical protein (501 aa)
•    •• 0.946
Sb02g002640.1
hypothetical protein (494 aa)
•    •• 0.945
Sb05g006625.1
hypothetical protein (117 aa)
     •• 0.917
Sb02g043940.1
hypothetical protein (817 aa)
     •• 0.913
Sb09g016850.1
hypothetical protein (866 aa)
     •• 0.911

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
PLN02238189 PLN02238, PLN02238, hypoxanthine phosphoribosyltra 1e-55
COG0634178 COG0634, Hpt, Hypoxanthine-guanine phosphoribosylt 7e-39
TIGR01203166 TIGR01203, HGPRTase, hypoxanthine phosphoribosyltr 2e-30
PRK15423178 PRK15423, PRK15423, hypoxanthine phosphoribosyltra 8e-22
PTZ00271211 PTZ00271, PTZ00271, hypoxanthine-guanine phosphori 9e-18
PRK09162181 PRK09162, PRK09162, hypoxanthine-guanine phosphori 5e-15
PTZ00149241 PTZ00149, PTZ00149, hypoxanthine phosphoribosyltra 9e-14
cd06223130 cd06223, PRTases_typeI, Phosphoribosyl transferase 9e-08
TIGR01251308 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosph 2e-04
COG0462314 COG0462, PrsA, Phosphoribosylpyrophosphate synthet 4e-04
pfam00156123 pfam00156, Pribosyltran, Phosphoribosyl transferas 0.002
PLN02369302 PLN02369, PLN02369, ribose-phosphate pyrophosphoki 0.003
>gnl|CDD|215132 PLN02238, PLN02238, hypoxanthine phosphoribosyltransferase Back     alignment and domain information 
 Score =  170 bits (432), Expect = 1e-55
 Identities = 67/87 (77%), Positives = 77/87 (88%)

Query: 9   VEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYF 68
           VEDIVDTG TLS+L+A+L +KGA+SVSVC LLDK ARRK++ ELVG+GK Y GFECPD F
Sbjct: 103 VEDIVDTGNTLSALVAHLEAKGAASVSVCALLDKRARRKVKYELVGDGKEYVGFECPDEF 162

Query: 69  VVGYGMDFAELYRNLPYVGVLKPECYK 95
           VVGYG+DFAE YRNLPYVGVLKPE Y+
Sbjct: 163 VVGYGLDFAEKYRNLPYVGVLKPEVYQ 189

Length = 189
>gnl|CDD|223707 COG0634, Hpt, Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|130270 TIGR01203, HGPRTase, hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|185321 PRK15423, PRK15423, hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|140297 PTZ00271, PTZ00271, hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181675 PRK09162, PRK09162, hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|240293 PTZ00149, PTZ00149, hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|206754 cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain Back     alignment and domain information
>gnl|CDD|130318 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosphokinase Back     alignment and domain information
>gnl|CDD|223538 COG0462, PrsA, Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215757 pfam00156, Pribosyltran, Phosphoribosyl transferase domain Back     alignment and domain information
>gnl|CDD|215209 PLN02369, PLN02369, ribose-phosphate pyrophosphokinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 95
PTZ00271211 hypoxanthine-guanine phosphoribosyltransferase; Pr 100.0
COG0634178 Hpt Hypoxanthine-guanine phosphoribosyltransferase 100.0
PLN02238189 hypoxanthine phosphoribosyltransferase 100.0
PRK15423178 hypoxanthine phosphoribosyltransferase; Provisiona 100.0
PTZ00149241 hypoxanthine phosphoribosyltransferase; Provisiona 100.0
TIGR01203166 HGPRTase hypoxanthine phosphoribosyltransferase. S 99.98
KOG3367216 consensus Hypoxanthine-guanine phosphoribosyltrans 99.97
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Pr 99.97
PRK05205176 bifunctional pyrimidine regulatory protein PyrR ur 99.68
PLN02440479 amidophosphoribosyltransferase 99.57
PRK09177156 xanthine-guanine phosphoribosyltransferase; Valida 99.46
COG2236192 Predicted phosphoribosyltransferases [General func 99.26
PF00156125 Pribosyltran: Phosphoribosyl transferase domain; I 99.24
COG2065179 PyrR Pyrimidine operon attenuation protein/uracil 99.23
TIGR00201190 comF comF family protein. This protein is found in 99.16
PRK02277200 orotate phosphoribosyltransferase-like protein; Pr 99.11
PRK09123479 amidophosphoribosyltransferase; Provisional 99.1
PRK02304175 adenine phosphoribosyltransferase; Provisional 99.09
PRK11595227 DNA utilization protein GntX; Provisional 99.08
TIGR01367187 pyrE_Therm orotate phosphoribosyltransferase, Ther 99.08
TIGR01090169 apt adenine phosphoribosyltransferase. A phylogene 99.07
PRK07322178 adenine phosphoribosyltransferase; Provisional 99.06
PRK08341442 amidophosphoribosyltransferase; Provisional 99.0
PRK09246501 amidophosphoribosyltransferase; Provisional 98.99
PRK13812176 orotate phosphoribosyltransferase; Provisional 98.97
PRK00455202 pyrE orotate phosphoribosyltransferase; Validated 98.97
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 98.95
PRK02458323 ribose-phosphate pyrophosphokinase; Provisional 98.94
COG1040225 ComFC Predicted amidophosphoribosyltransferases [G 98.92
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleo 98.91
PRK00129209 upp uracil phosphoribosyltransferase; Reviewed 98.9
PRK13811170 orotate phosphoribosyltransferase; Provisional 98.9
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 98.9
TIGR01091207 upp uracil phosphoribosyltransferase. that include 98.9
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisiona 98.89
TIGR00336173 pyrE orotate phosphoribosyltransferase. The conser 98.89
PF14572184 Pribosyl_synth: Phosphoribosyl synthetase-associat 98.89
PRK00934285 ribose-phosphate pyrophosphokinase; Provisional 98.88
COG0462314 PrsA Phosphoribosylpyrophosphate synthetase [Nucle 98.88
PRK02269320 ribose-phosphate pyrophosphokinase; Provisional 98.86
PLN02297326 ribose-phosphate pyrophosphokinase 98.86
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 98.83
PTZ00145439 phosphoribosylpyrophosphate synthetase; Provisiona 98.81
PRK06031233 phosphoribosyltransferase; Provisional 98.81
PRK13809206 orotate phosphoribosyltransferase; Provisional 98.8
PLN02293187 adenine phosphoribosyltransferase 98.79
PRK00553332 ribose-phosphate pyrophosphokinase; Provisional 98.77
PRK12560187 adenine phosphoribosyltransferase; Provisional 98.76
PRK06781471 amidophosphoribosyltransferase; Provisional 98.76
PRK07631475 amidophosphoribosyltransferase; Provisional 98.75
PRK08525445 amidophosphoribosyltransferase; Provisional 98.73
TIGR01744191 XPRTase xanthine phosphoribosyltransferase. This m 98.73
TIGR01134442 purF amidophosphoribosyltransferase. Alternate nam 98.73
PLN02369302 ribose-phosphate pyrophosphokinase 98.73
PRK02812330 ribose-phosphate pyrophosphokinase; Provisional 98.72
PRK06827382 phosphoribosylpyrophosphate synthetase; Provisiona 98.71
PRK13810187 orotate phosphoribosyltransferase; Provisional 98.71
PRK06388474 amidophosphoribosyltransferase; Provisional 98.68
PRK08558238 adenine phosphoribosyltransferase; Provisional 98.68
PRK09219189 xanthine phosphoribosyltransferase; Validated 98.68
PRK07349500 amidophosphoribosyltransferase; Provisional 98.68
PRK05793469 amidophosphoribosyltransferase; Provisional 98.67
PRK07272484 amidophosphoribosyltransferase; Provisional 98.56
COG0461201 PyrE Orotate phosphoribosyltransferase [Nucleotide 98.54
TIGR01251308 ribP_PPkin ribose-phosphate pyrophosphokinase. In 98.54
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and 98.54
PRK07847510 amidophosphoribosyltransferase; Provisional 98.52
TIGR01743268 purR_Bsub pur operon repressor, Bacillus subtilis 98.47
PRK09213271 pur operon repressor; Provisional 98.47
PRK05500477 bifunctional orotidine 5'-phosphate decarboxylase/ 98.38
KOG1448316 consensus Ribose-phosphate pyrophosphokinase [Nucl 98.19
KOG1712183 consensus Adenine phosphoribosyl transferases [Nuc 98.13
COG0034470 PurF Glutamine phosphoribosylpyrophosphate amidotr 97.86
PLN02541244 uracil phosphoribosyltransferase 97.81
KOG0572474 consensus Glutamine phosphoribosylpyrophosphate am 97.66
COG1926220 Predicted phosphoribosyltransferases [General func 97.59
PF15609191 PRTase_2: Phosphoribosyl transferase 97.43
PF14681207 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V 97.25
COG0035210 Upp Uracil phosphoribosyltransferase [Nucleotide t 97.22
KOG1503354 consensus Phosphoribosylpyrophosphate synthetase-a 95.3
KOG1017267 consensus Predicted uracil phosphoribosyltransfera 93.42
PF15610274 PRTase_3: PRTase ComF-like 91.8
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8.6e-35  Score=212.90  Aligned_cols=90  Identities=42%  Similarity=0.640  Sum_probs=86.9

Q ss_pred             CCCCeEEEEeeeechhHHHHHHHHHHHhCCCCEEEEEEEEEcCCCceeceeecCccCeEEEEEeCCEEEEeecCChhHhh
Q 034410            1 MHTFLCSQVEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYFVVGYGMDFAELY   80 (95)
Q Consensus         1 ~~~k~vliVDDIidTG~Tl~~~~~~l~~~g~~~i~~~~l~~k~~~~~~~~~pD~~~~~y~g~~i~~~~vvgygld~~~~~   80 (95)
                      ++||+|||||||+|||.||+++++.|++++|+++++|+|++|+++++++++||     |+||++||+|||||||||+++|
T Consensus       116 i~gk~VLIVDDIvDTG~TL~~v~~~l~~~~p~svk~avL~dK~~~r~~~i~~D-----yvG~~vpd~fvvGyGlDy~~~~  190 (211)
T PTZ00271        116 VENRHILIVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSGRKVEVLVD-----YPVITIPHAFVIGYGMDYAESY  190 (211)
T ss_pred             CCCCEEEEEecccCCHHHHHHHHHHHHhcCCCEEEEEEEEEcccCCcCCCCCC-----EEEEEcCCceEEEccccccccc
Confidence            47999999999999999999999999999999999999999999999999999     9999999999999999999999


Q ss_pred             hCCCceeecCCcccC
Q 034410           81 RNLPYVGVLKPECYK   95 (95)
Q Consensus        81 R~l~~v~~l~~~~~~   95 (95)
                      ||||+|+++++++++
T Consensus       191 Rnlp~I~~l~~~~~~  205 (211)
T PTZ00271        191 RELRDICVLKKEYYE  205 (211)
T ss_pred             CCCCeeEEechhhcC
Confidence            999999999988764

>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02238 hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>PRK15423 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>KOG3367 consensus Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>PLN02440 amidophosphoribosyltransferase Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PF00156 Pribosyltran: Phosphoribosyl transferase domain; InterPro: IPR000836 The name PRT comes from phosphoribosyltransferase (PRTase) enzymes, which carry out phosphoryl transfer reactions on 5-phosphoribosyl-alpha1-pyrophosphate PRPP, an activated form of ribose-5-phosphate Back     alignment and domain information
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00201 comF comF family protein Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK11595 DNA utilization protein GntX; Provisional Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08341 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09246 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>TIGR01091 upp uracil phosphoribosyltransferase Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase Back     alignment and domain information
>PF14572 Pribosyl_synth: Phosphoribosyl synthetase-associated domain; PDB: 2H07_B 2H06_B 3S5J_B 2HCR_A 3EFH_A 2H08_A 1DKR_B 1DKU_B 1IBS_B 2JI4_A Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PLN02297 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13809 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PLN02293 adenine phosphoribosyltransferase Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK12560 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06781 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08525 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01744 XPRTase xanthine phosphoribosyltransferase Back     alignment and domain information
>TIGR01134 purF amidophosphoribosyltransferase Back     alignment and domain information
>PLN02369 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK13810 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06388 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09219 xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05793 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07272 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase Back     alignment and domain information
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07847 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01743 purR_Bsub pur operon repressor, Bacillus subtilis type Back     alignment and domain information
>PRK09213 pur operon repressor; Provisional Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>KOG1448 consensus Ribose-phosphate pyrophosphokinase [Nucleotide transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>KOG1712 consensus Adenine phosphoribosyl transferases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02541 uracil phosphoribosyltransferase Back     alignment and domain information
>KOG0572 consensus Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PF15609 PRTase_2: Phosphoribosyl transferase Back     alignment and domain information
>PF14681 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C Back     alignment and domain information
>COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1503 consensus Phosphoribosylpyrophosphate synthetase-associated protein [Amino acid transport and metabolism; Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1017 consensus Predicted uracil phosphoribosyltransferase [General function prediction only] Back     alignment and domain information
>PF15610 PRTase_3: PRTase ComF-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
1r3u_A205 Crystal Structure Of Hypoxanthine-guanine Phosphori 6e-22
2geb_A185 Crystal Structure Of The Thermoanaerobacter Tengcon 1e-21
3h83_A204 2.06 Angstrom Resolution Structure Of A Hypoxanthin 2e-19
3ohp_A177 Crystal Structure Of Hgprt From Vibrio Cholerae Len 2e-18
1g9s_A182 Crystal Structure Of A Complex Between E.Coli Hprt 4e-17
1j7j_A178 Crystal Structure Of The Hprt From Salmonella Typhi 5e-17
3o7m_A186 1.98 Angstrom Resolution Crystal Structure Of A Hyp 3e-16
3acb_A181 Crystal Structure Of Hypoxanthine-Guanine Phosphori 6e-16
1hgx_A183 Hypoxanthine-Guanine-Xanthine Phosphoribosyltransfe 9e-13
1pzm_A211 Crystal Structure Of Hgprt-Ase From Leishmania Tare 1e-12
1hmp_A217 The Crystal Structure Of Human Hypoxanthine-Guanine 2e-09
1d6n_A214 Ternary Complex Structure Of Human Hgprtase, Prpp, 2e-09
1tc1_A220 A 1.4 Angstrom Crystal Structure For The Hypoxanthi 6e-09
1tc2_A221 Ternary Substrate Complex Of The Hypoxanthine Phosp 6e-09
1p17_A221 Hypoxanthine Phosphoribosyltransferase From Trypano 6e-09
2jbh_A225 Human Phosphoribosyl Transferase Domain Containing 1e-08
1i0l_A221 Analysis Of An Invariant Aspartic Acid In Hprts-Asp 2e-08
1i14_A221 Analysis Of An Invariant Aspartic Acid In Hprts-Glu 2e-08
1i0i_A221 Analysis Of An Invariant Aspartic Acid In Hprts-Glu 4e-08
1i13_A221 Analysis Of An Invariant Aspartic Acid In Hprts-Ala 6e-08
2vfa_A229 Crystal Structure Of A Chimera Of Plasmodium Falcip 2e-07
1qk3_A233 Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribos 2e-07
1dbr_A231 Hypoxanthine Guanine Xanthine Length = 231 2e-07
1cjb_A231 Malarial Purine Phosphoribosyltransferase Length = 7e-07
3ozf_A250 Crystal Structure Of Plasmodium Falciparum Hypoxant 8e-07
1qk5_A233 Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribos 2e-06
>pdb|1R3U|A Chain A, Crystal Structure Of Hypoxanthine-guanine Phosphoribosyltransferase From Thermoanaerobacter Tengcongensis Length = 205 Back     alignment and structure 
Iteration: 1

 Score = 99.0 bits (245), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 5/87 (5%)
Query: 9   VEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYF 68
           VEDI+D+G TL+ L   L+ +   S+ +CT+LDKP RR+  V++      Y GF+ PD F
Sbjct: 124 VEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKV-----DYCGFKIPDKF 178
Query: 69  VVGYGMDFAELYRNLPYVGVLKPECYK 95
           VVGYG+D+AE YRNLP++GVLKPE YK
Sbjct: 179 VVGYGLDYAEKYRNLPFIGVLKPELYK 205
>pdb|2GEB|A Chain A, Crystal Structure Of The Thermoanaerobacter Tengcongensis Hypoxanthine-Guanine Phosphoribosyltransferase L160i Mutant: Insights Into The Inhibitor Design Length = 185 Back     alignment and structure
>pdb|3H83|A Chain A, 2.06 Angstrom Resolution Structure Of A Hypoxanthine-Guanine Phosphoribosyltransferase (Hpt-1) From Bacillus Anthracis Str. 'ames Ancestor' Length = 204 Back     alignment and structure
>pdb|3OHP|A Chain A, Crystal Structure Of Hgprt From Vibrio Cholerae Length = 177 Back     alignment and structure
>pdb|1G9S|A Chain A, Crystal Structure Of A Complex Between E.Coli Hprt And Imp Length = 182 Back     alignment and structure
>pdb|1J7J|A Chain A, Crystal Structure Of The Hprt From Salmonella Typhimurium Length = 178 Back     alignment and structure
>pdb|3O7M|A Chain A, 1.98 Angstrom Resolution Crystal Structure Of A Hypoxanthine-Guanine Phosphoribosyltransferase (Hpt-2) From Bacillus Anthracis Str. 'ames Ancestor' Length = 186 Back     alignment and structure
>pdb|3ACB|A Chain A, Crystal Structure Of Hypoxanthine-Guanine Phosphoribosyltransferase From Thermus Thermophilus Hb8 Length = 181 Back     alignment and structure
>pdb|1HGX|A Chain A, Hypoxanthine-Guanine-Xanthine Phosphoribosyltransferase (Hgxprtase) Length = 183 Back     alignment and structure
>pdb|1PZM|A Chain A, Crystal Structure Of Hgprt-Ase From Leishmania Tarentolae In Complex With Gmp Length = 211 Back     alignment and structure
>pdb|1HMP|A Chain A, The Crystal Structure Of Human Hypoxanthine-Guanine Phosphoribosyltransferase With Bound Gmp Length = 217 Back     alignment and structure
>pdb|1D6N|A Chain A, Ternary Complex Structure Of Human Hgprtase, Prpp, Mg2+, And The Inhibitor Hpp Reveals The Involvement Of The Flexible Loop In Substrate Binding Length = 214 Back     alignment and structure
>pdb|1TC1|A Chain A, A 1.4 Angstrom Crystal Structure For The Hypoxanthine Phosphoribosyltransferase Of Trypanosoma Cruzi Length = 220 Back     alignment and structure
>pdb|1TC2|A Chain A, Ternary Substrate Complex Of The Hypoxanthine Phosphoribosyltransferase From Trypanosoma Cruzi Length = 221 Back     alignment and structure
>pdb|1P17|A Chain A, Hypoxanthine Phosphoribosyltransferase From Trypanosoma Cruzi, K68r Mutant, Complexed With The Product Imp Length = 221 Back     alignment and structure
>pdb|2JBH|A Chain A, Human Phosphoribosyl Transferase Domain Containing 1 Length = 225 Back     alignment and structure
>pdb|1I0L|A Chain A, Analysis Of An Invariant Aspartic Acid In Hprts-Asparagine Mutant Length = 221 Back     alignment and structure
>pdb|1I14|A Chain A, Analysis Of An Invariant Aspartic Acid In Hprts-Glutamic Acid Mutant Length = 221 Back     alignment and structure
>pdb|1I0I|A Chain A, Analysis Of An Invariant Aspartic Acid In Hprts-Glutamine Mutant Length = 221 Back     alignment and structure
>pdb|1I13|A Chain A, Analysis Of An Invariant Aspartic Acid In Hprts-Alanine Mutant Length = 221 Back     alignment and structure
>pdb|2VFA|A Chain A, Crystal Structure Of A Chimera Of Plasmodium Falciparum And Human Hypoxanthine-Guanine Phosphoribosyl Transferases Length = 229 Back     alignment and structure
>pdb|1QK3|A Chain A, Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribosyltransferase Gmp Complex Length = 233 Back     alignment and structure
>pdb|1DBR|A Chain A, Hypoxanthine Guanine Xanthine Length = 231 Back     alignment and structure
>pdb|1CJB|A Chain A, Malarial Purine Phosphoribosyltransferase Length = 231 Back     alignment and structure
>pdb|3OZF|A Chain A, Crystal Structure Of Plasmodium Falciparum Hypoxanthine-Guanine- Xanthine Phosphoribosyltransferase In Complex With Hypoxanthine Length = 250 Back     alignment and structure
>pdb|1QK5|A Chain A, Toxoplasma Gondii Hypoxanthine-Guanine Phosphoribosyltransferase With Xmp, Pyrophosphate And Two Mg2+ Ions Length = 233 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HG 6e-48
1tc1_A220 Protein (hypoxanthine phosphoribosyltransferase); 6e-48
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxanthi 6e-48
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransfer 8e-48
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; pr 9e-48
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural 3e-46
3ozf_A250 Hypoxanthine-guanine-xanthine phosphoribosyltrans; 4e-46
2ywu_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 1e-45
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltrans 1e-45
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthi 2e-45
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphori 5e-45
1z7g_A217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos 6e-44
1dqn_A230 Guanine phosphoribosyltransferase; protein-inhibit 1e-40
2jbh_A225 Phosphoribosyltransferase domain-containing prote; 1e-38
1vdm_A153 Purine phosphoribosyltransferase; structural genom 4e-09
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; 6e-05
2xbu_A221 Hypoxanthine-guanine phosphoribosyltransferase; gl 2e-04
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated 9e-04
3lrt_A286 Ribose-phosphate pyrophosphokinase; phosphoribosyl 9e-04
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Length = 185 Back     alignment and structure
 Score =  149 bits (379), Expect = 6e-48
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 5/87 (5%)

Query: 9   VEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYF 68
           VEDI+D+G TL+ L   L+ +   S+ +CT+LDKP RR+  V++      Y GF+ PD F
Sbjct: 104 VEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKVD-----YCGFKIPDKF 158

Query: 69  VVGYGMDFAELYRNLPYVGVLKPECYK 95
           VVGYG+D+AE YRNLP++GVLKPE YK
Sbjct: 159 VVGYGIDYAEKYRNLPFIGVLKPELYK 185
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* Length = 220 Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Length = 204 Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Length = 211 Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* Length = 205 Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Length = 177 Back     alignment and structure
>3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* Length = 250 Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Length = 233 Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} Length = 186 Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Length = 183 Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Length = 217 Back     alignment and structure
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* Length = 230 Back     alignment and structure
>2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Length = 225 Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Length = 153 Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Length = 152 Back     alignment and structure
>2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Length = 221 Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Length = 379 Back     alignment and structure
>3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Length = 286 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
3acd_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 100.0
2ywu_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 99.97
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.97
3ozf_A250 Hypoxanthine-guanine-xanthine phosphoribosyltrans; 99.97
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural 99.97
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.97
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphori 99.96
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HG 99.96
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransfer 99.96
1tc1_A220 Protein (hypoxanthine phosphoribosyltransferase); 99.96
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltrans 99.96
2jbh_A225 Phosphoribosyltransferase domain-containing prote; 99.95
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; pr 99.95
1z7g_A217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos 99.95
1dqn_A230 Guanine phosphoribosyltransferase; protein-inhibit 99.94
2xbu_A221 Hypoxanthine-guanine phosphoribosyltransferase; gl 99.75
1vdm_A153 Purine phosphoribosyltransferase; structural genom 99.74
1a3c_A181 PYRR, pyrimidine operon regulatory protein PYRR; t 99.66
1ufr_A181 TT1027, PYR mRNA-binding attenuation protein; pyri 99.65
1wd5_A208 Hypothetical protein TT1426; structural genomics, 99.65
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; 99.64
1w30_A201 PYRR bifunctional protein; transferase, glycosyltr 99.62
1ecf_A504 Glutamine phosphoribosylpyrophosphate amidotransf; 99.54
1vch_A175 Phosphoribosyltransferase-related protein; structu 99.31
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; 99.25
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 99.24
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabol 99.23
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 99.22
2p1z_A180 Phosphoribosyltransferase; STRU genomics, PSI-2, p 99.2
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 99.2
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 99.2
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransfe 99.14
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, o 99.14
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; 99.12
2wns_A205 Orotate phosphoribosyltransferase; alternative spl 99.07
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleot 99.07
1lh0_A213 OMP synthase; loop closure, monomer closure, orota 99.02
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid 99.01
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); 99.0
1o57_A291 PUR operon repressor; purine operon repressor, hel 98.99
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; 98.97
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; 98.95
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy 98.93
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; 98.91
3s5j_B326 Ribose-phosphate pyrophosphokinase 1; nucleotide s 98.9
2e55_A208 Uracil phosphoribosyltransferase; structural genom 98.9
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated 98.88
2ehj_A208 Uracil phosphoribosyltransferase; structural genom 98.87
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structur 98.84
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salva 98.83
3lrt_A286 Ribose-phosphate pyrophosphokinase; phosphoribosyl 98.82
3dah_A319 Ribose-phosphate pyrophosphokinase; pyrophosphoki 98.77
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; 98.75
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosy 98.67
3qw4_B453 UMP synthase; N-terminal orotidine monophosphate d 98.62
3dmp_A217 Uracil phosphoribosyltransferase; structural genom 98.46
1xtt_A216 Probable uracil phosphoribosyltransferase; tetrame 98.12
>3acd_A Hypoxanthine-guanine phosphoribosyltransferase; rossmann fold, structural genomics, NPPSFA; HET: IMP; 1.89A {Thermus thermophilus} PDB: 3acc_A* 3acb_A* Back     alignment and structure
Probab=100.00  E-value=8.6e-36  Score=211.89  Aligned_cols=87  Identities=47%  Similarity=0.762  Sum_probs=85.2

Q ss_pred             CCCCeEEEEeeeechhHHHHHHHHHHHhCCCCEEEEEEEEEcCCCceeceeecCccCeEEEEEeCCEEEEeecCChhHhh
Q 034410            1 MHTFLCSQVEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYFVVGYGMDFAELY   80 (95)
Q Consensus         1 ~~~k~vliVDDIidTG~Tl~~~~~~l~~~g~~~i~~~~l~~k~~~~~~~~~pD~~~~~y~g~~i~~~~vvgygld~~~~~   80 (95)
                      ++||+|||||||+|||+||+++.+.|.+.||+++++|+|++|+.+++.+++||     |+||++||+|||||||||+|+|
T Consensus        93 i~gk~VllVDDIldTG~Tl~~~~~~l~~~~p~sv~~avLl~K~~~r~~pi~~D-----yvG~~ipd~fvvGyGlDy~~~~  167 (181)
T 3acd_A           93 IHGRDVIVVEDIVDTGLTLSYLLDYLEARKPASVRVAALLSKPSRRQVEVPIH-----YLGFEIEDAYVYGYGLDRAQFD  167 (181)
T ss_dssp             CTTCEEEEEEEEESSSHHHHHHHHHHHTTCCSEEEEEEEEECGGGCSSCCCCS-----EEEEECCSCCEEBTTBCBTTBC
T ss_pred             cCCCeeEEEEEEEcCchhHHHHHHHHhcCCCCEEEEEEEEEcCccccCCCCCC-----EEEEECCCceEEECCcCccccc
Confidence            47999999999999999999999999999999999999999999999999999     9999999999999999999999


Q ss_pred             hCCCceeecCCc
Q 034410           81 RNLPYVGVLKPE   92 (95)
Q Consensus        81 R~l~~v~~l~~~   92 (95)
                      ||||+||+++||
T Consensus       168 Rnlp~i~~l~~e  179 (181)
T 3acd_A          168 RNLPFITSIRPE  179 (181)
T ss_dssp             TTCSSBEECCCC
T ss_pred             cCCCeeEEeCCC
Confidence            999999999997
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} SCOP: c.61.1.0 Back     alignment and structure
>3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Back     alignment and structure
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Back     alignment and structure
>2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Back     alignment and structure
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* Back     alignment and structure
>2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Back     alignment and structure
>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding P pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* Back     alignment and structure
>1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Back     alignment and structure
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Back     alignment and structure
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} Back     alignment and structure
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Back     alignment and structure
>1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Back     alignment and structure
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Back     alignment and structure
>3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Back     alignment and structure
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} SCOP: c.61.1.1 Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 95
d1yfza1178 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTas 5e-28
d1pzma_183 c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase 8e-28
d1cjba_228 c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTas 1e-27
d1tc1a_184 c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cru 2e-27
d1fsga_233 c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase 1e-26
d1hgxa_173 c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase 3e-26
d1z7ga1214 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HG 4e-26
d1j7ja_172 c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typh 1e-25
d1dqna_230 c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [Tax 7e-24
d1a3ca_178 c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Ba 5e-07
d1nula_150 c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {E 5e-07
d1ufra_178 c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Th 6e-07
d1wd5a_208 c.61.1.1 (A:) Putative phosphoribosyltransferase T 8e-07
d1w30a_182 c.61.1.1 (A:) Pyrimidine operon regulator PyrR {My 4e-06
d1vdma1153 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyl 0.002
d1vcha1174 c.61.1.1 (A:2-175) Putative phosphoribosyltransfer 0.004
>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Xanthine-guanine PRTase (XPRTase)
species: Thermoanaerobacter tengcongensis [TaxId: 119072]

 Score = 97.7 bits (243), Expect = 5e-28
 Identities = 46/86 (53%), Positives = 62/86 (72%), Gaps = 5/86 (5%)

Query: 9   VEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYF 68
           VEDI+D+G TL+ L   L+ +   S+ +CT+LDKP RR+  V++      Y GF+ PD F
Sbjct: 98  VEDIIDSGLTLAYLRETLLGRKPRSLKICTILDKPERREADVKV-----DYCGFKIPDKF 152

Query: 69  VVGYGMDFAELYRNLPYVGVLKPECY 94
           VVGYG+D+AE YRNLP++GVLKPE Y
Sbjct: 153 VVGYGLDYAEKYRNLPFIGVLKPELY 178
>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} Length = 183 Back     information, alignment and structure
>d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} Length = 228 Back     information, alignment and structure
>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} Length = 184 Back     information, alignment and structure
>d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} Length = 233 Back     information, alignment and structure
>d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} Length = 173 Back     information, alignment and structure
>d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} Length = 172 Back     information, alignment and structure
>d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} Length = 230 Back     information, alignment and structure
>d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} Length = 178 Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Length = 150 Back     information, alignment and structure
>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Length = 208 Back     information, alignment and structure
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} Length = 182 Back     information, alignment and structure
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
d1tc1a_184 Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 569 100.0
d1pzma_183 Hypoxanthine-guanine-xanthine PRTase {Leishmania t 100.0
d1yfza1178 Xanthine-guanine PRTase (XPRTase) {Thermoanaerobac 100.0
d1fsga_233 Hypoxanthine-guanine-xanthine PRTase {Toxoplasma g 100.0
d1cjba_228 Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium 100.0
d1z7ga1214 Hypoxanthine-guanine PRTase (HGPRTase) {Human (Hom 100.0
d1j7ja_172 Hypoxanthine PRTase {Salmonella typhimurium [TaxId 100.0
d1hgxa_173 Hypoxanthine-guanine-xanthine PRTase {Tritrichomon 99.97
d1dqna_230 Guanine PRTase {Giardia lamblia [TaxId: 5741]} 99.95
d1ufra_178 Pyrimidine operon regulator PyrR {Thermus thermoph 99.84
d1a3ca_178 Pyrimidine operon regulator PyrR {Bacillus subtili 99.82
d1vdma1153 Pprobable purine phosphoribosyltransferase PH0095 99.72
d1w30a_182 Pyrimidine operon regulator PyrR {Mycobacterium tu 99.71
d1nula_150 Xanthine-guanine PRTase (XPRTase) {Escherichia col 99.58
d1wd5a_208 Putative phosphoribosyltransferase TT1426 (TTHA146 99.52
d1vcha1174 Putative phosphoribosyltransferase TTHA1613 {Therm 99.05
d1u9ya2129 Phosphoribosylpyrophosphate synthetase {Methanocal 99.02
d2c4ka2184 PRPP synthetase-associated protein 1 {Human (Homo 99.0
d1dkua2149 Phosphoribosylpyrophosphate synthetase {Bacillus s 98.91
d1g2qa_178 Adenine PRTase {Baker's yeast (Saccharomyces cerev 98.87
d1o57a2202 Pur operon repressor (PurR), C-terminal domain {Ba 98.87
d1y0ba1191 Xanthine phosphoribosyltransferase {Bacillus subti 98.82
d1zn7a1178 Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] 98.8
d1qb7a_236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 98.69
d1l1qa_181 Adenine PRTase {Giardia lamblia [TaxId: 5741]} 98.68
d2aeea1208 Orotate PRTase {Streptococcus pyogenes [TaxId: 131 98.61
d1lh0a_213 Orotate PRTase {Salmonella typhimurium [TaxId: 903 98.46
d1gph11231 Glutamine PRPP amidotransferase, C-terminal domain 97.94
d1ecfa1243 Glutamine PRPP amidotransferase, C-terminal domain 97.76
d1i5ea_208 Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 97.65
d1o5oa_210 Uracil PRTase, Upp {Thermotoga maritima [TaxId: 23 97.59
d1v9sa1208 Uracil PRTase, Upp {Thermus thermophilus [TaxId: 2 97.53
d1bd3a_224 Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811 97.24
d1xtta1215 Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId 97.23
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 89.89
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 81.12
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 80.58
>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Hypoxanthine PRTase
species: Trypanosoma cruzi [TaxId: 5693]

Probab=100.00  E-value=5.4e-35  Score=204.90  Aligned_cols=87  Identities=36%  Similarity=0.564  Sum_probs=84.9

Q ss_pred             CCCCeEEEEeeeechhHHHHHHHHHHHhCCCCEEEEEEEEEcCCCceeceeecCccCeEEEEEeCCEEEEeecCChhHhh
Q 034410            1 MHTFLCSQVEDIVDTGTTLSSLIANLVSKGASSVSVCTLLDKPARRKIQVELVGEGKFYRGFECPDYFVVGYGMDFAELY   80 (95)
Q Consensus         1 ~~~k~vliVDDIidTG~Tl~~~~~~l~~~g~~~i~~~~l~~k~~~~~~~~~pD~~~~~y~g~~i~~~~vvgygld~~~~~   80 (95)
                      ++||+|||||||+|||+||+++++.|++.||+++++|+|++|+.+++.++.||     |+|+++||+|||||||||++.+
T Consensus        98 ~~gk~VLlVDDIldTG~Tl~~~~~~l~~~~~~~i~~avL~~k~~~r~~~i~~D-----y~G~~ipd~~vvGyGld~~~~~  172 (184)
T d1tc1a_          98 IEGHHVLIVEDIVDTALTLNYLYHMYFTRRPASLKTVVLLDKREGRRVPFSAD-----YVVANIPNAFVIGYGLDYDDTY  172 (184)
T ss_dssp             CTTSEEEEEEEEESSCHHHHHHHHHHHTTCCSEEEEEEEEECTTCCSSCCCCS-----EEEEECCSCEEEBTTBCBTTBS
T ss_pred             ccceeEEEEecchhHHHHHHHHHHHHhhhcCccccEEEEEEecccccCCCCCC-----EEEEEeCCeeEEECCcccCcCC
Confidence            47999999999999999999999999999999999999999999999999999     9999999999999999999999


Q ss_pred             hCCCceeecCCc
Q 034410           81 RNLPYVGVLKPE   92 (95)
Q Consensus        81 R~l~~v~~l~~~   92 (95)
                      ||||+|++|+||
T Consensus       173 R~l~~i~~l~~e  184 (184)
T d1tc1a_         173 RELRDIVVLRPE  184 (184)
T ss_dssp             TTCSSEEEEECC
T ss_pred             CCCCceEEeCCC
Confidence            999999999986
>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} Back     information, alignment and structure
>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} Back     information, alignment and structure
>d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Back     information, alignment and structure
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure