Citrus Sinensis ID: 034444

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MADVVCNNFTGRVIELKLGNHFTYIGSVAELHANYRKSKLVGKHLIHGIQIPIYIASLENLRYLNLSNLSSGRLCGSIPSSLGNLYSFTSFDTF
ccccEEEcccccEEEEEccccccccccccccccccccccEEcccccccccccccccccccccEEEccccccccccEEccccccccccccEEEcc
cccEEEcccccEEEEEEcccccccccccHHccccccHHHHHHHHccccccccHHHHHHHHccEEEcccccccccccccccccccHHHHHEHccc
MADVVCNNFTGRVIELKLGNHFTYIGSVAELHANYRKSKLVGKHLIHGIQIPIYIASLENLRYLNlsnlssgrlcgsipsslgnlysftsfdtf
MADVVCNNFTGRVIELKLGNHFTYIGSVAELHANYRKSKLVGKHLIHGIQIPIYIASLENLRYLNLSNLSSGRLCGSipsslgnlysftsfdtf
MADVVCNNFTGRVIELKLGNHFTYIGSVAELHANYRKSKLVGKHLIHGIQIPIYIAslenlrylnlsnlssgrlcgsIPSSLGNLYSFTSFDTF
***VVCNNFTGRVIELKLGNHFTYIGSVAELHANYRKSKLVGKHLIHGIQIPIYIASLENLRYLNLSNLSSGRLCGSIPSSLGNLYSFT*****
MADVVCNNFTGRVIELKLGNHFTYIGSVAELHANYRKSKLVGKHLIHGIQIPIYIASLENLRYLNLSNLSSGRLCGSIPSSLGNLYSFTSFDTF
MADVVCNNFTGRVIELKLGNHFTYIGSVAELHANYRKSKLVGKHLIHGIQIPIYIASLENLRYLNLSNLSSGRLCGSIPSSLGNLYSFTSFDTF
*ADVVCNNFTGRVIELKLGNHFTYIGSVAELHANYRKSKLVGKHLIHGIQIPIYIASLENLRYLNLSNLSSGRLCGSIPSSLGNLYSFTSFDTF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADVVCNNFTGRVIELKLGNHFTYIGSVAELHANYRKSKLVGKHLIHGIQIPIYIASLENLRYLNLSNLSSGRLCGSIPSSLGNLYSFTSFDTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
359484185 990 PREDICTED: LRR receptor-like serine/thre 0.914 0.086 0.421 3e-07
40644874160 putative scab resistance protein [Pyrus 0.872 0.512 0.452 6e-07
40644876159 scab resistance protein [Pyrus communis] 0.872 0.515 0.442 1e-06
5739323 893 Cf2/Cf5 disease resistance protein homol 0.893 0.094 0.353 3e-06
359488591 981 PREDICTED: probable leucine-rich repeat 0.904 0.086 0.428 4e-06
296090228 896 unnamed protein product [Vitis vinifera] 0.904 0.094 0.428 6e-06
359473586 1001 PREDICTED: LRR receptor-like serine/thre 0.914 0.085 0.405 1e-05
359488583 958 PREDICTED: LRR receptor-like serine/thre 0.914 0.089 0.401 1e-05
147784408 898 hypothetical protein VITISV_002032 [Viti 0.914 0.095 0.405 2e-05
359473600 968 PREDICTED: leucine-rich repeat receptor 0.914 0.088 0.405 4e-05
>gi|359484185|ref|XP_002273824.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 54/102 (52%), Gaps = 16/102 (15%)

Query: 4   VVCNNFTGRVIELKLGNHFTY----IGSVAELHANYRKSKLVGKHLIH---------GIQ 50
           V CNN TGRVI+LKLGN F       G+ +EL      S L  K+L +         G++
Sbjct: 72  VSCNNRTGRVIKLKLGNPFPNSLEGDGTASELGGEINPSLLSLKYLNYLDLSMNNFGGME 131

Query: 51  IPIYIASLENLRYLNLSNLSSGRLCGSIPSSLGNLYSFTSFD 92
           IP +I SL  LRYLNLS  S G   G IP ++ NL +    D
Sbjct: 132 IPKFIGSLGKLRYLNLSGASFG---GMIPPNIANLSNLRYLD 170

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|40644874|emb|CAE46477.1| putative scab resistance protein [Pyrus communis] Back     alignment and taxonomy information
>gi|40644876|emb|CAE46478.1| scab resistance protein [Pyrus communis] Back     alignment and taxonomy information
>gi|5739323|gb|AAD50430.1|AF166121_1 Cf2/Cf5 disease resistance protein homolog [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|359488591|ref|XP_003633783.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296090228|emb|CBI40047.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473586|ref|XP_003631328.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488583|ref|XP_003633782.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase FLS2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147784408|emb|CAN63882.1| hypothetical protein VITISV_002032 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359473600|ref|XP_002272516.2| PREDICTED: leucine-rich repeat receptor protein kinase EXS-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00003143001
SubName- Full=Chromosome undetermined scaffold_139, whole genome shotgun sequence; (890 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 94
PLN03150 623 hypothetical protein; Provisional 99.48
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.18
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.9
PLN03150623 hypothetical protein; Provisional 98.83
KOG0617 264 consensus Ras suppressor protein (contains leucine 98.48
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.42
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.39
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.23
KOG0472565 consensus Leucine-rich repeat protein [Function un 98.04
KOG0617264 consensus Ras suppressor protein (contains leucine 97.76
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.74
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.71
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.7
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 97.69
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.64
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.6
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.59
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.56
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.49
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 97.46
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.28
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.18
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.18
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 97.17
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.15
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.09
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.0
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 96.98
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.88
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.78
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 96.75
KOG4237 498 consensus Extracellular matrix protein slit, conta 96.75
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 96.74
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.57
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 96.44
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 96.42
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.23
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.22
smart0037026 LRR Leucine-rich repeats, outliers. 96.18
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.18
KOG4237 498 consensus Extracellular matrix protein slit, conta 96.06
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 95.45
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 95.09
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 94.74
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 94.08
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 92.97
KOG1259 490 consensus Nischarin, modulator of integrin alpha5 91.74
KOG0473 326 consensus Leucine-rich repeat protein [Function un 90.67
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 90.34
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 90.08
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 88.17
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 88.15
PRK15386 426 type III secretion protein GogB; Provisional 87.91
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 87.47
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 87.39
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 87.15
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 85.92
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 85.4
KOG2123 388 consensus Uncharacterized conserved protein [Funct 83.49
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 81.23
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 80.43
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information 
Probab=99.48  E-value=9.2e-14  Score=102.91  Aligned_cols=83  Identities=29%  Similarity=0.286  Sum_probs=73.9

Q ss_pred             CcceEecC--CC--CcEEEEEeCCCCCCCCcccceeeeCCccccCCcCccc--------ccCCchhhhcCCCCCeEeccC
Q 034444            1 MADVVCNN--FT--GRVIELKLGNHFTYIGSVAELHANYRKSKLVGKHLIH--------GIQIPIYIASLENLRYLNLSN   68 (94)
Q Consensus         1 w~gv~c~~--~~--~~v~~L~l~~~~~~~~~~n~l~g~~p~~l~~l~~L~~--------~~~iP~~i~~l~~L~~L~ls~   68 (94)
                      |.||.|..  ..  ..|+.|+|++        |.+.|.+|+++..+++|+.        .|.+|+.++.+++|+.|+|++
T Consensus       404 w~Gv~C~~~~~~~~~~v~~L~L~~--------n~L~g~ip~~i~~L~~L~~L~Ls~N~l~g~iP~~~~~l~~L~~LdLs~  475 (623)
T PLN03150        404 WSGADCQFDSTKGKWFIDGLGLDN--------QGLRGFIPNDISKLRHLQSINLSGNSIRGNIPPSLGSITSLEVLDLSY  475 (623)
T ss_pred             cccceeeccCCCCceEEEEEECCC--------CCccccCCHHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECCC
Confidence            89999952  22  2589999999        9999999999999998887        578999999999999999999


Q ss_pred             CCCCcccccChHhhhCCCCCcEEecC
Q 034444           69 LSSGRLCGSIPSSLGNLYSFTSFDTF   94 (94)
Q Consensus        69 N~~~~l~g~iP~~i~~l~~L~~L~ls   94 (94)
                      |+   ++|.+|+.++++++|+.|+|+
T Consensus       476 N~---lsg~iP~~l~~L~~L~~L~Ls  498 (623)
T PLN03150        476 NS---FNGSIPESLGQLTSLRILNLN  498 (623)
T ss_pred             CC---CCCCCchHHhcCCCCCEEECc
Confidence            99   999999999999999999874

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 5e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-04
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-04
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
 Score = 37.9 bits (89), Expect = 1e-04
 Identities = 10/43 (23%), Positives = 21/43 (48%), Gaps = 3/43 (6%)

Query: 50  QIPIYIASLENLRYLNLSNLSSGRLCGSIPSSLGNLYSFTSFD 92
            IP +++ ++ L  L+ S      L G++P S+ +L +     
Sbjct: 116 AIPDFLSQIKTLVTLDFSY---NALSGTLPPSISSLPNLVGIT 155
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.6
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.48
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.45
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.4
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.37
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 99.21
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.1
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.02
3e6j_A 229 Variable lymphocyte receptor diversity region; var 99.0
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.99
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.98
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.96
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.94
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.93
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 98.92
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.92
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.92
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.9
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.9
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.88
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.87
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.86
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 98.86
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.85
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.83
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.83
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.82
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.81
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.78
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.78
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.78
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.78
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.77
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.77
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.76
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.76
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 98.75
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.75
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.74
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.74
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.74
3m19_A 251 Variable lymphocyte receptor A diversity region; a 98.74
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.74
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.71
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.7
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.69
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.68
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 98.68
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.67
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.67
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.66
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.66
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.66
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.65
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.65
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.64
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.63
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.63
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.63
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.63
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.62
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.62
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.62
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 98.61
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.61
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.6
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.6
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.59
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.59
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 98.59
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.58
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 98.58
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.56
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.56
4glp_A 310 Monocyte differentiation antigen CD14; alpha beta 98.56
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 98.56
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 98.55
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.55
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 98.54
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.54
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.54
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.53
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.53
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.53
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.53
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 98.52
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 98.52
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 98.52
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.52
1wwl_A 312 Monocyte differentiation antigen CD14; LPS, immune 98.49
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 98.48
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 98.47
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 98.39
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.38
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.34
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.32
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.32
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 98.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.28
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.26
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.25
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.24
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.23
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.21
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.21
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 98.21
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.17
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.17
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.16
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 98.16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.13
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.1
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.07
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 98.05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.02
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.01
1o6v_A466 Internalin A; bacterial infection, extracellular r 97.99
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 97.98
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.97
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 97.95
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.93
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.93
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.93
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.88
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.88
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 97.7
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.62
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.61
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.43
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 97.38
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 97.11
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.1
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.02
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.97
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 96.83
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 96.79
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.11
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 96.01
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 95.95
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 95.92
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 95.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.02
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 90.62
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 88.78
2ra8_A 362 Uncharacterized protein Q64V53_bacfr; WGR domain, 87.5
4fdw_A 401 Leucine rich hypothetical protein; putative cell s 84.97
4fdw_A401 Leucine rich hypothetical protein; putative cell s 81.51
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
Probab=99.60  E-value=1.7e-15  Score=102.03  Aligned_cols=82  Identities=28%  Similarity=0.332  Sum_probs=53.5

Q ss_pred             CcceEecCCC--CcEEEEEeCCCCCCCCcccceee--eCCccccCCcCccc---------ccCCchhhhcCCCCCeEecc
Q 034444            1 MADVVCNNFT--GRVIELKLGNHFTYIGSVAELHA--NYRKSKLVGKHLIH---------GIQIPIYIASLENLRYLNLS   67 (94)
Q Consensus         1 w~gv~c~~~~--~~v~~L~l~~~~~~~~~~n~l~g--~~p~~l~~l~~L~~---------~~~iP~~i~~l~~L~~L~ls   67 (94)
                      |.||.|+...  ++|+.|++++        |.+.|  .+|+.+..+++|++         .+.+|..++++++|++|+++
T Consensus        38 w~gv~C~~~~~~~~l~~L~L~~--------~~l~~~~~~~~~l~~l~~L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls  109 (313)
T 1ogq_A           38 WLGVLCDTDTQTYRVNNLDLSG--------LNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYIT  109 (313)
T ss_dssp             STTEEECCSSSCCCEEEEEEEC--------CCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEE
T ss_pred             CcceEeCCCCCCceEEEEECCC--------CCccCCcccChhHhCCCCCCeeeCCCCCcccccCChhHhcCCCCCEEECc
Confidence            9999998654  7899999999        66666  56666666655554         23455555555666666555


Q ss_pred             CCCCCcccccChHhhhCCCCCcEEec
Q 034444           68 NLSSGRLCGSIPSSLGNLYSFTSFDT   93 (94)
Q Consensus        68 ~N~~~~l~g~iP~~i~~l~~L~~L~l   93 (94)
                      +|+   ++|.+|..++.+++|++|++
T Consensus       110 ~n~---l~~~~p~~~~~l~~L~~L~L  132 (313)
T 1ogq_A          110 HTN---VSGAIPDFLSQIKTLVTLDF  132 (313)
T ss_dssp             EEC---CEEECCGGGGGCTTCCEEEC
T ss_pred             CCe---eCCcCCHHHhCCCCCCEEeC
Confidence            555   55555555555555555554
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 94
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

 Score = 35.9 bits (81), Expect = 2e-04
 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 4/42 (9%)

Query: 51  IPIYIASLENLRYLNLSNLSSGRLCGSIPSSLGNLYSFTSFD 92
           +P  +  L+ L  LN+S      LCG IP   GNL  F    
Sbjct: 260 LPQGLTQLKFLHSLNVSF---NNLCGEIP-QGGNLQRFDVSA 297

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.88
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.84
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.84
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.7
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.67
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.57
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.45
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 98.44
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.39
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.37
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.37
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.31
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.19
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.19
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.18
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.1
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.1
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.04
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.89
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.85
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.84
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.74
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.72
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.52
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.42
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.37
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 97.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.76
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 96.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 96.16
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.09
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.08
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.0
d2ca6a1 344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 94.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 93.74
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 89.7
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 80.7
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]

Probab=99.67  E-value=5.6e-17  Score=107.25  Aligned_cols=83  Identities=28%  Similarity=0.317  Sum_probs=70.6

Q ss_pred             CcceEecCC--CCcEEEEEeCCCCCCCCcccceee--eCCccccCCcCccc---------ccCCchhhhcCCCCCeEecc
Q 034444            1 MADVVCNNF--TGRVIELKLGNHFTYIGSVAELHA--NYRKSKLVGKHLIH---------GIQIPIYIASLENLRYLNLS   67 (94)
Q Consensus         1 w~gv~c~~~--~~~v~~L~l~~~~~~~~~~n~l~g--~~p~~l~~l~~L~~---------~~~iP~~i~~l~~L~~L~ls   67 (94)
                      |+||+|+..  ..||++|+|++        +.++|  .+|+++++|++|++         .|.+|++|+++++|++|+++
T Consensus        38 w~gv~C~~~~~~~~v~~L~L~~--------~~l~g~~~lp~~l~~L~~L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls  109 (313)
T d1ogqa_          38 WLGVLCDTDTQTYRVNNLDLSG--------LNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYIT  109 (313)
T ss_dssp             STTEEECCSSSCCCEEEEEEEC--------CCCSSCEECCGGGGGCTTCSEEEEEEETTEESCCCGGGGGCTTCSEEEEE
T ss_pred             CCCeEEeCCCCcEEEEEEECCC--------CCCCCCCCCChHHhcCccccccccccccccccccccccccccccchhhhc
Confidence            999999864  35899999999        88887  58899999999987         56899999999999999999


Q ss_pred             CCCCCcccccChHhhhCCCCCcEEecC
Q 034444           68 NLSSGRLCGSIPSSLGNLYSFTSFDTF   94 (94)
Q Consensus        68 ~N~~~~l~g~iP~~i~~l~~L~~L~ls   94 (94)
                      +|+   +.+..|..+..+..|++++++
T Consensus       110 ~N~---l~~~~~~~~~~~~~L~~l~l~  133 (313)
T d1ogqa_         110 HTN---VSGAIPDFLSQIKTLVTLDFS  133 (313)
T ss_dssp             EEC---CEEECCGGGGGCTTCCEEECC
T ss_pred             ccc---ccccccccccchhhhcccccc
Confidence            999   888777777888888877763
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure