Citrus Sinensis ID: 034542


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MELKGKKEQAFFSSLILLIIHLCPSCSELEKVKNNTSFTADEVHVGVILDMRSWSGKISNSCISMAIADFYALNTHYKTRLVLHSRDSQGIG
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccc
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcccccc
MELKGKKEQAFFSSLILLIIHLcpscselekvknntsftadeVHVGVILDMRswsgkisnSCISMAIADFYALNTHYKTRLVlhsrdsqgig
MELKGKKEQAFFSSLILLIIHLCPSCSELEKVKNNtsftadevhVGVILDMRSWSGKISNSCISMAIADFYALNTHYKTRlvlhsrdsqgig
MELKGKKEQAFFsslilliihlcpscsELEKVKNNTSFTADEVHVGVILDMRSWSGKISNSCISMAIADFYALNTHYKTRLVLHSRDSQGIG
*********AFFSSLILLIIHLCPSCSELEKVKNNTSFTADEVHVGVILDMRSWSGKISNSCISMAIADFYALNTHYKTRLVLH********
********QAFFSSLILLIIHLCPSCSE************DEVHVGVILDMRSWSGKISNSCISMAIADFYALNTHYKTRLVLHSRDS****
MELKGKKEQAFFSSLILLIIHLCPSCSELEKVKNNTSFTADEVHVGVILDMRSWSGKISNSCISMAIADFYALNTHYKTRLVLHSRDSQGIG
**LKGKKEQAFFSSLILLIIHLCPSCSELEKVKNNTSFTADEVHVGVILDMRSWSGKISNSCISMAIADFYALNTHYKTRLVLHSRDS****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELKGKKEQAFFSSLILLIIHLCPSCSELEKVKNNTSFTADEVHVGVILDMRSWSGKISNSCISMAIADFYALNTHYKTRLVLHSRDSQGIG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query92 2.2.26 [Sep-21-2011]
Q8LGN1 861 Glutamate receptor 1.4 OS yes no 0.869 0.092 0.353 2e-08
Q9M8W7 808 Glutamate receptor 1.1 OS no no 0.543 0.061 0.44 3e-07
Q9LV72 867 Glutamate receptor 1.2 OS no no 0.630 0.066 0.482 4e-07
O81078 940 Glutamate receptor 2.9 OS no no 0.565 0.055 0.482 1e-06
Q9C5V5 947 Glutamate receptor 2.8 OS no no 0.510 0.049 0.468 6e-06
Q9FH75 860 Glutamate receptor 1.3 OS no no 0.532 0.056 0.428 1e-05
Q8LGN0 952 Glutamate receptor 2.7 OS no no 0.510 0.049 0.404 0.0001
>sp|Q8LGN1|GLR14_ARATH Glutamate receptor 1.4 OS=Arabidopsis thaliana GN=GLR1.4 PE=2 SV=2 Back     alignment and function desciption
 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 2/82 (2%)

Query: 11 FFSSLILLIIHLCPSCSELEKVKN--NTSFTADEVHVGVILDMRSWSGKISNSCISMAIA 68
          F +   L  I    +CS   +  N        ++V +G+++DM S  GK+  + ISMA++
Sbjct: 12 FLTIFFLAFISFAVTCSGTNQKDNVDRLPVVYEDVRIGLVVDMGSMEGKLVTTSISMALS 71

Query: 69 DFYALNTHYKTRLVLHSRDSQG 90
          DFY +N  Y+TR+ + SRDS G
Sbjct: 72 DFYHVNNGYRTRVSVLSRDSHG 93




Glutamate-gated receptor that probably acts as non-selective cation channel. Can transport calcium ions. May be involved in light-signal transduction and calcium homeostasis via the regulation of calcium influx into cells.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9M8W7|GLR11_ARATH Glutamate receptor 1.1 OS=Arabidopsis thaliana GN=GLR1.1 PE=2 SV=1 Back     alignment and function description
>sp|Q9LV72|GLR12_ARATH Glutamate receptor 1.2 OS=Arabidopsis thaliana GN=GLR1.2 PE=2 SV=1 Back     alignment and function description
>sp|O81078|GLR29_ARATH Glutamate receptor 2.9 OS=Arabidopsis thaliana GN=GLR2.9 PE=2 SV=1 Back     alignment and function description
>sp|Q9C5V5|GLR28_ARATH Glutamate receptor 2.8 OS=Arabidopsis thaliana GN=GLR2.8 PE=2 SV=2 Back     alignment and function description
>sp|Q9FH75|GLR13_ARATH Glutamate receptor 1.3 OS=Arabidopsis thaliana GN=GLR1.3 PE=2 SV=1 Back     alignment and function description
>sp|Q8LGN0|GLR27_ARATH Glutamate receptor 2.7 OS=Arabidopsis thaliana GN=GLR2.7 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
147767994 887 hypothetical protein VITISV_017199 [Viti 0.858 0.089 0.457 4e-12
50726494 919 putative Avr9/Cf-9 rapidly elicited prot 0.793 0.079 0.506 2e-11
297735388 884 unnamed protein product [Vitis vinifera] 0.869 0.090 0.437 2e-11
125605772 572 hypothetical protein OsJ_29443 [Oryza sa 0.793 0.127 0.506 2e-11
449489402 970 PREDICTED: glutamate receptor 2.7-like [ 0.586 0.055 0.555 7e-11
449453069 970 PREDICTED: glutamate receptor 2.7-like [ 0.586 0.055 0.555 7e-11
296083760 1834 unnamed protein product [Vitis vinifera] 0.913 0.045 0.454 2e-10
359476438 600 PREDICTED: LOW QUALITY PROTEIN: glutamat 0.554 0.085 0.627 2e-10
296083771146 unnamed protein product [Vitis vinifera] 0.554 0.349 0.627 5e-10
296083773 1727 unnamed protein product [Vitis vinifera] 0.554 0.029 0.607 5e-10
>gi|147767994|emb|CAN64920.1| hypothetical protein VITISV_017199 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 75.5 bits (184), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 57/83 (68%), Gaps = 4/83 (4%)

Query: 10 AFFSSLILLIIHLCP--SCSELEKVKNNTSFTADEVHVGVILDMRSWSGKISNSCISMAI 67
          A++  + L +   C   + S   +  N++S TA    VGV+LDM S  G+++N+CISMA+
Sbjct: 2  AYYCVIFLSVTVFCHFLNLSSGNQTSNSSSMTA--YGVGVVLDMGSSLGRMANNCISMAV 59

Query: 68 ADFYALNTHYKTRLVLHSRDSQG 90
          +DFY++N HYKTRL+LH+RDS G
Sbjct: 60 SDFYSINRHYKTRLILHTRDSMG 82




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|50726494|dbj|BAD34102.1| putative Avr9/Cf-9 rapidly elicited protein 141 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|297735388|emb|CBI17828.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|125605772|gb|EAZ44808.1| hypothetical protein OsJ_29443 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|449489402|ref|XP_004158301.1| PREDICTED: glutamate receptor 2.7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449453069|ref|XP_004144281.1| PREDICTED: glutamate receptor 2.7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296083760|emb|CBI23977.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359476438|ref|XP_003631839.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 2.3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083771|emb|CBI23988.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083773|emb|CBI23990.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
TAIR|locus:2079681 861 GLR1.4 "glutamate receptor 1.4 0.543 0.058 0.46 4.1e-07
TAIR|locus:2166001 867 ATGLR1.2 [Arabidopsis thaliana 0.630 0.066 0.482 6.8e-07
TAIR|locus:2102975 808 GLR1.1 "glutamate receptor 1.1 0.543 0.061 0.44 1.7e-06
TAIR|locus:2066148 940 GLR2.9 "glutamate receptor 2.9 0.565 0.055 0.482 3.3e-06
TAIR|locus:2066086 947 GLR2.8 "glutamate receptor 2.8 0.510 0.049 0.468 1.1e-05
TAIR|locus:2166006 860 GLR1.3 "glutamate receptor 1.3 0.532 0.056 0.428 1.3e-05
TAIR|locus:2066107 952 GLR2.7 "glutamate receptor 2.7 0.510 0.049 0.404 0.0001
TAIR|locus:2047251 895 GLR2.3 "glutamate receptor 2.3 0.641 0.065 0.370 0.00016
TAIR|locus:2079681 GLR1.4 "glutamate receptor 1.4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 128 (50.1 bits), Expect = 4.1e-07, P = 4.1e-07
 Identities = 23/50 (46%), Positives = 37/50 (74%)

Query:    41 DEVHVGVILDMRSWSGKISNSCISMAIADFYALNTHYKTRLVLHSRDSQG 90
             ++V +G+++DM S  GK+  + ISMA++DFY +N  Y+TR+ + SRDS G
Sbjct:    44 EDVRIGLVVDMGSMEGKLVTTSISMALSDFYHVNNGYRTRVSVLSRDSHG 93




GO:0004970 "ionotropic glutamate receptor activity" evidence=IEA
GO:0005215 "transporter activity" evidence=IEA
GO:0005217 "intracellular ligand-gated ion channel activity" evidence=ISS
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0006810 "transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0006874 "cellular calcium ion homeostasis" evidence=NAS
GO:0009416 "response to light stimulus" evidence=NAS
GO:0005261 "cation channel activity" evidence=IDA
GO:0005262 "calcium channel activity" evidence=IDA
GO:0006816 "calcium ion transport" evidence=IDA
GO:0030003 "cellular cation homeostasis" evidence=RCA;IDA
TAIR|locus:2166001 ATGLR1.2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102975 GLR1.1 "glutamate receptor 1.1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066148 GLR2.9 "glutamate receptor 2.9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066086 GLR2.8 "glutamate receptor 2.8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166006 GLR1.3 "glutamate receptor 1.3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066107 GLR2.7 "glutamate receptor 2.7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047251 GLR2.3 "glutamate receptor 2.3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00031375001
SubName- Full=Chromosome chr11 scaffold_56, whole genome shotgun sequence; (876 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
cd06366 350 cd06366, PBP1_GABAb_receptor, Ligand-binding domai 2e-11
>gnl|CDD|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
 Score = 57.7 bits (140), Expect = 2e-11
 Identities = 21/49 (42%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 44 HVGVILDM-RSWSGKISNSCISMAIADFYALNT-HYKTRLVLHSRDSQG 90
           +G I D+  SW GK +   I MA+ D  A N+     RLVLH RDS+ 
Sbjct: 1  RIGAIFDLSGSWIGKAALPAIEMALEDVNADNSILPGYRLVLHVRDSKC 49


Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA). GABA is the major inhibitory neurotransmitter in the mammalian CNS and, like glutamate and other transmitters, acts via both ligand gated ion channels (GABAa receptors) and G-protein coupled receptors (GABAb). GABAa receptors are members of the ionotropic receptor superfamily which includes alpha-adrenergic and glycine receptors. The GABAb receptor is a member of a receptor superfamily which includes the mGlu receptors. The GABAb receptor is coupled to G alpha_i proteins, and activation causes a decrease in calcium, an increase in potassium membrane conductance, and inhibition of cAMP formation. The response is thus inhibitory and leads to hyperpolarization and decreased neurotransmitter release, for example. Length = 350

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 92
cd06394 333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 98.77
cd06391 400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 97.92
cd06382 327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 97.83
cd06392 400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 97.57
cd06366 350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 97.57
PRK15404 369 leucine ABC transporter subunit substrate-binding 97.54
cd06358 333 PBP1_NHase Type I periplasmic-binding protein of t 97.51
cd06346 312 PBP1_ABC_ligand_binding_like_11 Type I periplasmic 97.41
cd06368 324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 97.4
cd06380 382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 97.39
cd06348 344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 97.35
cd06370 404 PBP1_Speract_GC_like Ligand-binding domain of memb 97.34
cd06344 332 PBP1_ABC_ligand_binding_like_9 Type I periplasmic 97.33
cd06393 384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 97.31
cd06357 360 PBP1_AmiC Periplasmic binding domain of amidase (A 97.26
cd06356 334 PBP1_Amide_Urea_BP_like Periplasmic component (Fmd 97.24
cd06331 333 PBP1_AmiC_like Type I periplasmic components of am 97.2
TIGR03407 359 urea_ABC_UrtA urea ABC transporter, urea binding p 97.2
cd06345 344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 97.16
cd06343 362 PBP1_ABC_ligand_binding_like_8 Type I periplasmic 97.16
cd06347 334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 97.1
cd06355 348 PBP1_FmdD_like Periplasmic component (FmdD) of an 97.09
cd06385 405 PBP1_NPR_A Ligand-binding domain of type A natriur 97.08
cd06330 346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 97.04
cd04509 299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 97.04
cd06333 312 PBP1_ABC-type_HAAT_like Type I periplasmic binding 97.0
cd06349 340 PBP1_ABC_ligand_binding_like_14 Type I periplasmic 96.97
PF13458 343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 96.96
cd06352 389 PBP1_NPR_GC_like Ligand-binding domain of membrane 96.85
TIGR03669 374 urea_ABC_arch urea ABC transporter, substrate-bind 96.83
cd06268 298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 96.79
cd06338 345 PBP1_ABC_ligand_binding_like_5 Type I periplasmic 96.79
cd06342 334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 96.78
cd06329 342 PBP1_SBP_like_3 Periplasmic solute-binding domain 96.66
COG0683 366 LivK ABC-type branched-chain amino acid transport 96.58
cd06334 351 PBP1_ABC_ligand_binding_like_1 Type I periplasmic 96.57
cd06326 336 PBP1_STKc_like Type I periplasmic binding domain o 96.53
cd06335 347 PBP1_ABC_ligand_binding_like_2 Type I periplasmic 96.53
cd06340 347 PBP1_ABC_ligand_binding_like_6 Type I periplasmic 96.51
cd06328 333 PBP1_SBP_like_2 Periplasmic solute-binding domain 96.46
cd06327 334 PBP1_SBP_like_1 Periplasmic solute-binding domain 96.39
cd06374 472 PBP1_mGluR_groupI Ligand binding domain of the gro 96.39
cd06341 341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic 96.38
cd06336 347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 96.3
cd06350 348 PBP1_GPCR_family_C_like Ligand-binding domain of m 96.12
cd06362 452 PBP1_mGluR Ligand binding domain of the metabotrop 96.11
cd06364 510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 96.09
cd06372 391 PBP1_GC_G_like Ligand-binding domain of membrane g 95.93
cd06383 368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 95.92
cd06363 410 PBP1_Taste_receptor Ligand-binding domain of the T 95.9
KOG1055 865 consensus GABA-B ion channel receptor subunit GABA 95.9
cd06376 463 PBP1_mGluR_groupIII Ligand-binding domain of the g 95.82
cd06371 382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 95.58
cd06365 469 PBP1_Pheromone_receptor Ligand-binding domain of t 95.55
cd06367 362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 95.51
cd06361 403 PBP1_GPC6A_like Ligand-binding domain of the promi 95.44
cd06375 458 PBP1_mGluR_groupII Ligand binding domain of the gr 95.2
cd06373 396 PBP1_NPR_like Ligand binding domain of natriuretic 95.15
cd06351 328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 95.01
cd06359 333 PBP1_Nba_like Type I periplasmic binding component 94.83
cd06339 336 PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin 94.53
cd06386 387 PBP1_NPR_C_like Ligand-binding domain of type C na 94.43
cd06269 298 PBP1_glutamate_receptors_like Family C G-protein c 94.12
PF13433 363 Peripla_BP_5: Periplasmic binding protein domain; 93.43
cd06332 333 PBP1_aromatic_compounds_like Type I periplasmic bi 93.19
cd06360 336 PBP1_alkylbenzenes_like Type I periplasmic binding 92.57
cd06384 399 PBP1_NPR_B Ligand-binding domain of type B natriur 92.45
cd06379 377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 90.68
cd06337 357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 90.48
cd06381 363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 89.44
PF01094 348 ANF_receptor: Receptor family ligand binding regio 85.64
cd06377 382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 80.34
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
Probab=98.77  E-value=8.2e-09  Score=80.93  Aligned_cols=48  Identities=13%  Similarity=0.075  Sum_probs=43.8

Q ss_pred             EEEEEEecCCcchHHHHHHHHHHHHHHhccCCCce-eEEEEEeecCCCC
Q 034542           44 HVGVILDMRSWSGKISNSCISMAIADFYALNTHYK-TRLVLHSRDSQGI   91 (92)
Q Consensus        44 ~IGaIlDl~S~iGK~a~~aIemAveDfna~~~~~~-TrL~L~~rDS~~~   91 (92)
                      +||+|||.+|.+|+.++.|++||++|||++...++ ++|+++++|.+.+
T Consensus         1 ~iG~i~d~~s~~G~~~~~a~~lAv~~iN~~~~~~~~~~l~~~~~d~~~d   49 (333)
T cd06394           1 RIAAILDDPMECGRGERLALALARERINRAPERLGKARVEVDIFELLRD   49 (333)
T ss_pred             CceeeecCCccccHHHHHHHHHHHHHhccCccccCCceeEEEEeecccc
Confidence            58999999999999999999999999998876664 7999999998875



N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. There are five types of kainate receptors, GluR5, GluR6, GluR7, KA1, and KA2, which are structurally similar to AMPA and NMDA subunits of ionotropic glutamate receptors. KA1 and KA2 subunits can only form functional receptors with one of the GluR5-7 subunits. Moreover, GluR5-7 can also form functional homomeric receptor channels act

>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional Back     alignment and domain information
>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides Back     alignment and domain information
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria Back     alignment and domain information
>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>KOG1055 consensus GABA-B ion channel receptor subunit GABABR1 and related subunits, G-protein coupled receptor superfamily [Inorganic ion transport and metabolism; Amino acid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway Back     alignment and domain information
>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A Back     alignment and domain information
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
3om0_A 393 Glutamate receptor, ionotropic kainate 5; membrane 6e-08
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 5e-06
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 Back     alignment and structure
 Score = 47.5 bits (112), Expect = 6e-08
 Identities = 8/50 (16%), Positives = 20/50 (40%), Gaps = 1/50 (2%)

Query: 42 EVHVGVILDMRSWSGKISNSCISMAIADFYALNT-HYKTRLVLHSRDSQG 90
           + +  ILD ++  G+     +++A      +     K R+ +   + Q 
Sbjct: 4  SLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAKARVEVDIFELQR 53


>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
3om0_A 393 Glutamate receptor, ionotropic kainate 5; membrane 98.56
3o21_A 389 Glutamate receptor 3; periplasmatic binding protei 98.24
3qek_A 384 NMDA glutamate receptor subunit; amino terminal do 98.15
3h6g_A 395 Glutamate receptor, ionotropic kainate 2; membrane 98.11
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 98.07
4gnr_A 353 ABC transporter substrate-binding protein-branche 98.01
4gpa_A 389 Glutamate receptor 4; PBP fold, ligand-gated ION c 97.99
1jdp_A 441 NPR-C, atrial natriuretic peptide clearance recept 97.88
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 97.8
3hsy_A 376 Glutamate receptor 2; ligand-gated ION channel, sy 97.66
1dp4_A 435 Atrial natriuretic peptide receptor A; periplasmic 97.63
3h5l_A 419 Putative branched-chain amino acid ABC transporter 97.54
3lkb_A 392 Probable branched-chain amino acid ABC transporter 97.51
3i45_A 387 Twin-arginine translocation pathway signal protei; 97.49
3n0x_A 374 Possible substrate binding protein of ABC transpo 97.41
2e4u_A 555 Metabotropic glutamate receptor 3; G-protein-coupl 97.37
3ipc_A 356 ABC transporter, substrate binding protein (amino; 97.25
3eaf_A 391 ABC transporter, substrate binding protein; PSI2, 97.22
3lop_A 364 Substrate binding periplasmic protein; protein str 97.18
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 97.09
4f06_A 371 Extracellular ligand-binding receptor; PSI-biology 97.07
3mq4_A 481 Mglur7, metabotropic glutamate receptor 7; glutama 97.06
3hut_A 358 Putative branched-chain amino acid ABC transporter 97.0
1usg_A 346 Leucine-specific binding protein; leucine-binding 96.89
3td9_A 366 Branched chain amino acid ABC transporter, peripl 96.77
3i09_A 375 Periplasmic branched-chain amino acid-binding Pro; 96.75
4eyg_A 368 Twin-arginine translocation pathway signal; PSI-bi 96.69
3n0w_A 379 ABC branched chain amino acid family transporter, 96.6
3sm9_A 479 Mglur3, metabotropic glutamate receptor 3; structu 96.32
1pea_A 385 Amidase operon; gene regulator, receptor, binding 96.29
4evq_A 375 Putative ABC transporter subunit, substrate-bindi 95.8
3sg0_A 386 Extracellular ligand-binding receptor; structural 94.47
3ks9_A 496 Mglur1, metabotropic glutamate receptor 1; glutama 94.24
3snr_A 362 Extracellular ligand-binding receptor; structural 94.11
3ckm_A 327 YRAM (HI1655), LPOA; periplasmic-binding protein, 92.14
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
Probab=98.56  E-value=1.2e-07  Score=70.49  Aligned_cols=51  Identities=14%  Similarity=0.147  Sum_probs=46.9

Q ss_pred             ceEEEEEEEecCCcchHHHHHHHHHHHHHHhccCCCce-eEEEEEeecCCCC
Q 034542           41 DEVHVGVILDMRSWSGKISNSCISMAIADFYALNTHYK-TRLVLHSRDSQGI   91 (92)
Q Consensus        41 ~~V~IGaIlDl~S~iGK~a~~aIemAveDfna~~~~~~-TrL~L~~rDS~~~   91 (92)
                      .+|+||+|+++++..|+..+.|+++|++++|++...++ .+|.++++|+.++
T Consensus         3 ~~ikIG~~~~~s~~~G~~~~~a~~lAv~eiN~~ggil~g~~l~~~~~D~~~~   54 (393)
T 3om0_A            3 SSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAKARVEVDIFELQRD   54 (393)
T ss_dssp             CEEEEEEEECCCCSSCCCHHHHHHHHHHHHHHSCCSSCCCEEEEEEEECCSS
T ss_pred             cceeEEEEecCCCcccHHHHHHHHHHHHHHhcCcccccCcEEEEEEEecCCC
Confidence            47999999999999999999999999999999877664 8999999999886



>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>3ckm_A YRAM (HI1655), LPOA; periplasmic-binding protein, lipoprotein, unliganded, biosynthetic protein; 1.35A {Haemophilus influenzae} SCOP: c.93.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
d1jdpa_ 401 Hormone binding domain of the atrial natriuretic p 98.08
d1usga_ 346 Leucine-binding protein {Escherichia coli [TaxId: 98.01
d1dp4a_ 425 Hormone binding domain of the atrial natriuretic p 97.68
d1qo0a_ 373 Amide receptor/negative regulator of the amidase o 97.61
d1ewka_ 477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 96.6
d3ckma1 317 YraM C-terminal domain {Haemophilus influenzae [Ta 94.77
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Hormone binding domain of the atrial natriuretic peptide receptor
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.08  E-value=4.4e-06  Score=58.09  Aligned_cols=55  Identities=20%  Similarity=0.163  Sum_probs=43.3

Q ss_pred             CCcceEEEEEEEecCC---cchHHHHHHHHHHHHHHhccCCCc-----eeEEEEEeecCCCCC
Q 034542           38 FTADEVHVGVILDMRS---WSGKISNSCISMAIADFYALNTHY-----KTRLVLHSRDSQGIG   92 (92)
Q Consensus        38 ~~~~~V~IGaIlDl~S---~iGK~a~~aIemAveDfna~~~~~-----~TrL~L~~rDS~~~g   92 (92)
                      .+|..++|||++-++.   ..|..-+.|++||++|+|++....     +.++++.++|+.|+.
T Consensus         3 ~~~~~i~igvllP~tg~~~~~~~~~~~a~~lAv~~iN~~g~~~~~~~~g~~i~~~~~D~~~~~   65 (401)
T d1jdpa_           3 LPPQKIEVLVLLPQDDSYLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSDCGN   65 (401)
T ss_dssp             CCCCEEEEEEEECSSTTSTTCHHHHHHHHHHHHHHHCC-----CCSCTTCEEEEEEEECTTST
T ss_pred             CCCCccEEEEEECCCCchhhhhHHHHHHHHHHHHHHHhcCCccccCCCCcEEEEEEEeCCCCH
Confidence            3578999999998874   668888889999999999875432     479999999999863



>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure