Citrus Sinensis ID: 034549

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLLPKKTNERVAKEPKSPSKATKSPKKA
ccHHHHHHHHHHHHHHHHHHHHccccccccccHHcccccHHHHHcccccEEEccccccccccccccccccccccccccccccccccccccc
HHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHccHHHHHHcccEEEccccccccccHHHcccccccccccccccccccccccccc
MAAVLEYLAAEVLELAGNaardnkkkkiiprHVQLAVRNDEELGKLLTgvtiasggvlpninpvllpkktnervakepkspskatkspkka
MAAVLEYLAAEVLELAgnaardnkkkkiiprhvqlavrndeelGKLLTGvtiasggvlpninpvllpkktnervakepkspskatkspkka
MaavleylaaevlelaGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLLPKKTNERVakepkspskatkspkka
***VLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLL*************************
MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNIN*****************************
MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLLPKKTN********************
MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLLPK***********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLLPKKTNERVAKEPKSPSKATKSPKKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
P19177149 Histone H2A OS=Petroselin N/A no 1.0 0.610 0.868 9e-38
Q2HU68148 Probable histone H2A.1 OS N/A no 0.989 0.608 0.857 7e-36
Q6L500163 Probable histone H2A.4 OS yes no 1.0 0.558 0.806 2e-34
A2Y5G8163 Probable histone H2A.4 OS N/A no 1.0 0.558 0.806 2e-34
Q2HU65153 Probable histone H2A.2 OS N/A no 1.0 0.594 0.840 2e-34
Q9LZ46153 Probable histone H2A.4 OS yes no 1.0 0.594 0.806 2e-34
P40281149 Histone H2A.2 OS=Pisum sa N/A no 0.989 0.604 0.813 2e-33
P25469146 Histone H2A.1 OS=Solanum N/A no 0.978 0.609 0.824 5e-33
Q1S053152 Probable histone H2A.3 OS N/A no 0.978 0.585 0.808 1e-32
Q94F49150 Probable histone H2A.5 OS no no 0.978 0.593 0.758 5e-31
>sp|P19177|H2A_PETCR Histone H2A OS=Petroselinum crispum PE=2 SV=1 Back     alignment and function desciption
 Score =  155 bits (391), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 79/91 (86%), Positives = 83/91 (91%)

Query: 1   MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPN 60
           +AAVLEYLAAEVLELAGNAARDNKK +IIPRH+ LAVRNDEELGKLL GVT A GGVLPN
Sbjct: 59  LAAVLEYLAAEVLELAGNAARDNKKTRIIPRHLLLAVRNDEELGKLLAGVTFAHGGVLPN 118

Query: 61  INPVLLPKKTNERVAKEPKSPSKATKSPKKA 91
           INPVLLPKKT E+ AKEPKSPSKA KSPKKA
Sbjct: 119 INPVLLPKKTAEKAAKEPKSPSKAGKSPKKA 149
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Petroselinum crispum (taxid: 4043)
>sp|Q2HU68|H2A1_MEDTR Probable histone H2A.1 OS=Medicago truncatula GN=MtrDRAFT_AC149210g1v1 PE=3 SV=1 Back     alignment and function description
>sp|Q6L500|H2A4_ORYSJ Probable histone H2A.4 OS=Oryza sativa subsp. japonica GN=Os05g0461400 PE=2 SV=1 Back     alignment and function description
>sp|A2Y5G8|H2A4_ORYSI Probable histone H2A.4 OS=Oryza sativa subsp. indica GN=OsI_019561 PE=3 SV=1 Back     alignment and function description
>sp|Q2HU65|H2A2_MEDTR Probable histone H2A.2 OS=Medicago truncatula GN=MtrDRAFT_AC149210g4v1 PE=3 SV=1 Back     alignment and function description
>sp|Q9LZ46|H2A4_ARATH Probable histone H2A.4 OS=Arabidopsis thaliana GN=At5g02560 PE=1 SV=1 Back     alignment and function description
>sp|P40281|H2A2_PEA Histone H2A.2 OS=Pisum sativum PE=2 SV=1 Back     alignment and function description
>sp|P25469|H2A1_SOLLC Histone H2A.1 OS=Solanum lycopersicum PE=2 SV=1 Back     alignment and function description
>sp|Q1S053|H2A3_MEDTR Probable histone H2A.3 OS=Medicago truncatula PE=3 SV=1 Back     alignment and function description
>sp|Q94F49|H2A5_ARATH Probable histone H2A.5 OS=Arabidopsis thaliana GN=At5g27670 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
330318556151 histone H2A [Camellia sinensis] 1.0 0.602 0.890 7e-37
351723527149 uncharacterized protein LOC100306579 [Gl 0.989 0.604 0.912 9e-37
351725389149 uncharacterized protein LOC100305705 [Gl 0.989 0.604 0.901 2e-36
118485435149 unknown [Populus trichocarpa] 0.989 0.604 0.901 2e-36
224087383136 histone 2 [Populus trichocarpa] gi|22285 0.989 0.661 0.901 3e-36
356550263149 PREDICTED: histone H2A-like [Glycine max 0.989 0.604 0.890 4e-36
122007149 RecName: Full=Histone H2A gi|20448|emb|C 1.0 0.610 0.868 4e-36
255640946149 unknown [Glycine max] 0.989 0.604 0.890 4e-36
356558219149 PREDICTED: histone H2A-like [Glycine max 0.989 0.604 0.890 4e-36
358248452148 uncharacterized protein LOC100784431 [Gl 0.978 0.601 0.901 4e-36
>gi|330318556|gb|AEC10950.1| histone H2A [Camellia sinensis] Back     alignment and taxonomy information
 Score =  157 bits (397), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 82/91 (90%)

Query: 1   MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPN 60
           MAAVLEYLAAEVLELAGNAARDNKK +IIPRHV LAVRNDEELGKLL GVTIA GGVLPN
Sbjct: 60  MAAVLEYLAAEVLELAGNAARDNKKNRIIPRHVLLAVRNDEELGKLLAGVTIAHGGVLPN 119

Query: 61  INPVLLPKKTNERVAKEPKSPSKATKSPKKA 91
           INPVLLPKKT     KEPKSPSKATKSPKKA
Sbjct: 120 INPVLLPKKTGSAATKEPKSPSKATKSPKKA 150

Source: Camellia sinensis

Species: Camellia sinensis

Genus: Camellia

Family: Theaceae

Order: Ericales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|351723527|ref|NP_001237026.1| uncharacterized protein LOC100306579 [Glycine max] gi|255628941|gb|ACU14815.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|351725389|ref|NP_001235555.1| uncharacterized protein LOC100305705 [Glycine max] gi|356558240|ref|XP_003547415.1| PREDICTED: histone H2A-like isoform 1 [Glycine max] gi|255626369|gb|ACU13529.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|118485435|gb|ABK94574.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224087383|ref|XP_002308145.1| histone 2 [Populus trichocarpa] gi|222854121|gb|EEE91668.1| histone 2 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356550263|ref|XP_003543507.1| PREDICTED: histone H2A-like [Glycine max] Back     alignment and taxonomy information
>gi|122007|sp|P19177.1|H2A_PETCR RecName: Full=Histone H2A gi|20448|emb|CAA37828.1| unnamed protein product [Petroselinum crispum] Back     alignment and taxonomy information
>gi|255640946|gb|ACU20753.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356558219|ref|XP_003547405.1| PREDICTED: histone H2A-like [Glycine max] Back     alignment and taxonomy information
>gi|358248452|ref|NP_001239884.1| uncharacterized protein LOC100784431 [Glycine max] gi|255647574|gb|ACU24250.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
FB|FBgn0051618124 His2A:CG31618 "His2A:CG31618" 0.626 0.459 0.789 1.2e-19
FB|FBgn0053808124 His2A:CG33808 "His2A:CG33808" 0.626 0.459 0.789 1.2e-19
FB|FBgn0053814124 His2A:CG33814 "His2A:CG33814" 0.626 0.459 0.789 1.2e-19
FB|FBgn0053817124 His2A:CG33817 "His2A:CG33817" 0.626 0.459 0.789 1.2e-19
FB|FBgn0053820124 His2A:CG33820 "His2A:CG33820" 0.626 0.459 0.789 1.2e-19
FB|FBgn0053823124 His2A:CG33823 "His2A:CG33823" 0.626 0.459 0.789 1.2e-19
FB|FBgn0053826124 His2A:CG33826 "His2A:CG33826" 0.626 0.459 0.789 1.2e-19
FB|FBgn0053829124 His2A:CG33829 "His2A:CG33829" 0.626 0.459 0.789 1.2e-19
FB|FBgn0053832124 His2A:CG33832 "His2A:CG33832" 0.626 0.459 0.789 1.2e-19
FB|FBgn0053835124 His2A:CG33835 "His2A:CG33835" 0.626 0.459 0.789 1.2e-19
FB|FBgn0051618 His2A:CG31618 "His2A:CG31618" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 234 (87.4 bits), Expect = 1.2e-19, P = 1.2e-19
 Identities = 45/57 (78%), Positives = 51/57 (89%)

Query:    17 GNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLLPKKTNER 73
             GNAARDNKK +IIPRH+QLA+RNDEEL KLL+GVTIA GGVLPNI  VLLPKKT ++
Sbjct:    67 GNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123
GO:0000786 "nucleosome" evidence=ISS
GO:0006334 "nucleosome assembly" evidence=ISS
GO:0003677 "DNA binding" evidence=ISS
GO:0006333 "chromatin assembly or disassembly" evidence=ISS
GO:0046982 "protein heterodimerization activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0051298 "centrosome duplication" evidence=IMP
FB|FBgn0053808 His2A:CG33808 "His2A:CG33808" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053814 His2A:CG33814 "His2A:CG33814" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053817 His2A:CG33817 "His2A:CG33817" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053820 His2A:CG33820 "His2A:CG33820" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053823 His2A:CG33823 "His2A:CG33823" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053826 His2A:CG33826 "His2A:CG33826" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053829 His2A:CG33829 "His2A:CG33829" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053832 His2A:CG33832 "His2A:CG33832" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053835 His2A:CG33835 "His2A:CG33835" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P40281H2A2_PEANo assigned EC number0.81310.98900.6040N/Ano
P69139H2A3_PSAMINo assigned EC number0.78940.83510.6031N/Ano
P16886H2AL_STRPUNo assigned EC number0.83330.79120.5714yesno
Q9LZ46H2A4_ARATHNo assigned EC number0.80641.00.5947yesno
P25469H2A1_SOLLCNo assigned EC number0.82410.97800.6095N/Ano
P27661H2AX_MOUSENo assigned EC number0.69660.95600.6083yesno
Q2HU68H2A1_MEDTRNo assigned EC number0.85710.98900.6081N/Ano
P02277H2A3_WHEATNo assigned EC number0.72341.00.6026N/Ano
P84051H2A_DROMENo assigned EC number0.80820.80210.5887yesno
P19177H2A_PETCRNo assigned EC number0.86811.00.6107N/Ano
P69140H2A_PARANNo assigned EC number0.78940.83510.6031N/Ano
P16104H2AX_HUMANNo assigned EC number0.71910.95600.6083yesno
Q43214H2A6_WHEATNo assigned EC number0.75260.98900.6081N/Ano
Q6GM86H2AX_XENLANo assigned EC number0.70930.94500.6187N/Ano
Q6L500H2A4_ORYSJNo assigned EC number0.80611.00.5582yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
PLN00157132 PLN00157, PLN00157, histone H2A; Provisional 1e-39
smart00414106 smart00414, H2A, Histone 2A 2e-39
PTZ00017134 PTZ00017, PTZ00017, histone H2A; Provisional 7e-39
cd00074115 cd00074, H2A, Histone 2A; H2A is a subunit of the 9e-39
PLN00156139 PLN00156, PLN00156, histone H2AX; Provisional 9e-34
COG5262132 COG5262, HTA1, Histone H2A [Chromatin structure an 2e-30
PLN00153129 PLN00153, PLN00153, histone H2A; Provisional 3e-30
PLN00154136 PLN00154, PLN00154, histone H2A; Provisional 8e-22
PTZ00252134 PTZ00252, PTZ00252, histone H2A; Provisional 5e-15
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 2e-12
COG4403963 COG4403, LcnDR2, Lantibiotic modifying enzyme [Def 0.003
>gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional Back     alignment and domain information 
 Score =  127 bits (320), Expect = 1e-39
 Identities = 63/81 (77%), Positives = 71/81 (87%), Gaps = 1/81 (1%)

Query: 1   MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPN 60
           +AAVLEYLAAEVLELAGNAARDNKK +I+PRH+QLAVRNDEEL KLL GVTIA+GGVLPN
Sbjct: 53  LAAVLEYLAAEVLELAGNAARDNKKSRIVPRHIQLAVRNDEELSKLLGGVTIAAGGVLPN 112

Query: 61  INPVLLPKKTNERVAKEPKSP 81
           I+ VLLPKK+  +   EPK P
Sbjct: 113 IHSVLLPKKS-GKSKGEPKDP 132

Length = 132
>gnl|CDD|197711 smart00414, H2A, Histone 2A Back     alignment and domain information
>gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional Back     alignment and domain information
>gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|226837 COG4403, LcnDR2, Lantibiotic modifying enzyme [Defense mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
PLN00153129 histone H2A; Provisional 100.0
PLN00156139 histone H2AX; Provisional 100.0
PTZ00017134 histone H2A; Provisional 100.0
PLN00157132 histone H2A; Provisional 100.0
PTZ00252134 histone H2A; Provisional 100.0
PLN00154136 histone H2A; Provisional 100.0
KOG1756131 consensus Histone 2A [Chromatin structure and dyna 100.0
smart00414106 H2A Histone 2A. 100.0
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 100.0
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 99.97
KOG1757131 consensus Histone 2A [Chromatin structure and dyna 99.96
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 98.9
COG5247113 BUR6 Class 2 transcription repressor NC2, alpha su 97.06
smart0080365 TAF TATA box binding protein associated factor. TA 96.81
KOG1659224 consensus Class 2 transcription repressor NC2, alp 95.26
PF0296966 TAF: TATA box binding protein associated factor (T 95.13
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 94.59
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 93.84
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 93.54
cd0797892 TAF13 The TATA Binding Protein (TBP) Associated Fa 92.85
PF0226993 TFIID-18kDa: Transcription initiation factor IID, 92.55
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 91.48
cd0007685 H4 Histone H4, one of the four histones, along wit 90.35
PF0286153 Clp_N: Clp amino terminal domain; InterPro: IPR004 89.67
cd0804885 TAF11 TATA Binding Protein (TBP) Associated Factor 89.35
PLN00035103 histone H4; Provisional 89.17
PTZ00015102 histone H4; Provisional 88.24
smart0042789 H2B Histone H2B. 86.96
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 86.56
smart0041774 H4 Histone H4. 86.12
PF0471990 TAFII28: hTAFII28-like protein conserved region; I 84.94
PLN00158116 histone H2B; Provisional 84.13
PF0460451 L_biotic_typeA: Type-A lantibiotic; InterPro: IPR0 81.38
>PLN00153 histone H2A; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.8e-36  Score=211.15  Aligned_cols=73  Identities=81%  Similarity=1.152  Sum_probs=70.5

Q ss_pred             ChHHHHHHHHHHHHHHHHHHHhcCCccccccchhhcccCcHHHHhhhcCceecCCcccCCCCccCCCCccccc
Q 034549            1 MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLLPKKTNER   73 (91)
Q Consensus         1 LAAVLEYLtaEILELA~n~A~~~kk~rItPrhi~lAI~nD~EL~~Lf~~~tIa~gGV~P~i~~~ll~kK~~~~   73 (91)
                      ||||||||++||||||+|+|++++++||+||||++||+||+||++||++|||++|||+|+||++|++||++++
T Consensus        51 LAAVLEYLtaEVLELAgnaa~d~kk~RItPrHi~lAI~nDeEL~~Ll~~vTIa~GGV~P~i~~~l~~kk~~~~  123 (129)
T PLN00153         51 LAAVLEYLTAEVLELAGNAARDNKKNRIVPRHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKTKGG  123 (129)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCCCccChHHHHhhccCcHHHHHHHCCCccCCCccCCCcchhhcCcccCCC
Confidence            6999999999999999999999999999999999999999999999999999999999999999999987554

>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>PLN00154 histone H2A; Provisional Back     alignment and domain information
>KOG1756 consensus Histone 2A [Chromatin structure and dynamics] Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>KOG1757 consensus Histone 2A [Chromatin structure and dynamics] Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>KOG1659 consensus Class 2 transcription repressor NC2, alpha subunit (DRAP1) [Transcription] Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes Back     alignment and domain information
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>PF04604 L_biotic_typeA: Type-A lantibiotic; InterPro: IPR007682 Lantibiotics are antibiotic peptides distinguished by the presence of the rare thioether amino acids lanthionine and/or methyllanthionine Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
2nqb_C123 Drosophila Nucleosome Structure Length = 123 1e-20
2pyo_C120 Drosophila Nucleosome Core Length = 120 2e-20
2hio_A128 Histone Octamer (Chicken), Chromosomal Protein Leng 2e-19
1zbb_C129 Structure Of The 4_601_167 Tetranucleosome Length = 2e-19
3c1b_C129 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 2e-19
1m18_C129 Ligand Binding Alters The Structure And Dynamics Of 2e-19
1eqz_A129 X-Ray Structure Of The Nucleosome Core Particle At 2e-19
3kwq_C107 Structural Characterization Of H3k56q Nucleosomes A 3e-19
2cv5_C130 Crystal Structure Of Human Nucleosome Core Particle 4e-19
3a6n_C133 The Nucleosome Containing A Testis-Specific Histone 4e-19
2f8n_K149 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc 5e-19
1s32_C119 Molecular Recognition Of The Nucleosomal 'supergroo 1e-18
1aoi_C116 Complex Between Nucleosome Core Particle (H3,H4,H2a 1e-18
1zla_C129 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 4e-18
1id3_C131 Crystal Structure Of The Yeast Nucleosome Core Part 1e-17
1kx3_C128 X-Ray Structure Of The Nucleosome Core Particle, Nc 1e-17
1u35_C120 Crystal Structure Of The Nucleosome Core Particle C 5e-16
1hio_A95 Histone Octamer (Chicken), Chromosomal Protein, Alp 4e-14
2xql_A91 Fitting Of The H2a-H2b Histones In The Electron Mic 9e-12
1f66_C128 2.6 A Crystal Structure Of A Nucleosome Core Partic 8e-11
2jss_A192 Nmr Structure Of Chaperone Chz1 Complexed With Hist 5e-10
>pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 Back     alignment and structure 
Iteration: 1

 Score = 94.7 bits (234), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 45/58 (77%), Positives = 51/58 (87%)
Query: 17  GNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLLPKKTNERV 74
           GNAARDNKK +IIPRH+QLA+RNDEEL KLL+GVTIA GGVLPNI  VLLPKKT ++ 
Sbjct: 66  GNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKKA 123
>pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 Back     alignment and structure
>pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 Back     alignment and structure
>pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 Back     alignment and structure
>pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 Back     alignment and structure
>pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 Back     alignment and structure
>pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 Back     alignment and structure
>pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 Back     alignment and structure
>pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 Back     alignment and structure
>pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 Back     alignment and structure
>pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 Back     alignment and structure
>pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 Back     alignment and structure
>pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 Back     alignment and structure
>pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 Back     alignment and structure
>pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 Back     alignment and structure
>pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 Back     alignment and structure
>pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 Back     alignment and structure
>pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 Back     alignment and structure
>pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 Back     alignment and structure
>pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 7e-28
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 3e-27
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 6e-27
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 4e-25
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 4e-24
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 8e-22
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 1e-21
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 4e-07
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 2e-04
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 Back     alignment and structure
 Score = 96.9 bits (240), Expect = 7e-28
 Identities = 53/71 (74%), Positives = 59/71 (83%)

Query: 1   MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPN 60
           MAAVLEYL AE+LELA NAARDNKK ++ PRH+ LAV NDEEL +LL GVTIASGGVLPN
Sbjct: 49  MAAVLEYLTAEILELAVNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPN 108

Query: 61  INPVLLPKKTN 71
           I+P LL KK  
Sbjct: 109 IHPELLAKKRG 119
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 99.97
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 99.97
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 99.97
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 99.97
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 99.97
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 99.97
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 99.91
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 99.63
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 99.28
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 98.92
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 98.91
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 98.3
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 98.28
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 98.26
1f1e_A154 Histone fold protein; archaeal histone protein, DN 97.69
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 97.36
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 97.04
1taf_B70 TFIID TBP associated factor 62; transcription init 96.39
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 95.49
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 95.21
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 94.82
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 94.26
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 92.67
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 92.61
1f1e_A154 Histone fold protein; archaeal histone protein, DN 92.48
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 92.14
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 92.1
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 91.92
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 91.92
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 91.83
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 91.69
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 91.28
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 90.91
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 90.84
1taf_A68 TFIID TBP associated factor 42; transcription init 90.49
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 89.62
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 89.4
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 89.3
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 88.89
3zri_A171 CLPB protein, CLPV; chaperone, HSP100 proteins, AA 87.33
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 87.32
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 86.46
1bh9_B89 TAFII28; histone fold, tata binding protein, trans 84.99
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 84.9
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 83.84
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 83.42
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 83.26
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 82.76
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 81.96
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
Probab=99.97  E-value=7.7e-33  Score=191.27  Aligned_cols=73  Identities=81%  Similarity=1.182  Sum_probs=68.0

Q ss_pred             ChHHHHHHHHHHHHHHHHHHHhcCCccccccchhhcccCcHHHHhhhcCceecCCcccCCCCccCCCCccccc
Q 034549            1 MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLLPKKTNER   73 (91)
Q Consensus         1 LAAVLEYLtaEILELA~n~A~~~kk~rItPrhi~lAI~nD~EL~~Lf~~~tIa~gGV~P~i~~~ll~kK~~~~   73 (91)
                      ||||||||++||||+|+|+|++++++||+|+||++||+||+||++||+++||++|||+||||++|++||++++
T Consensus        50 LaAvLEyL~aEIlelAgn~A~~~k~krItp~hi~lAI~nDeEL~~Ll~~vtia~ggvlp~i~~~l~~k~~~~~  122 (123)
T 2nqb_C           50 LAAVMEYLAAEVLELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK  122 (123)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHTSHHHHHHTTTEEETTCCCCCCCCGGGSSCC----
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCCccccHHHHHHHHhccHHHHHHhcCceeCCCCcCCCccHHHcCcccccC
Confidence            6899999999999999999999999999999999999999999999999999999999999999999987643
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Back     alignment and structure
>3zri_A CLPB protein, CLPV; chaperone, HSP100 proteins, AAA+ proteins, T6SS, secretion,; 1.80A {Vibrio cholerae} PDB: 3zrj_A Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Back     alignment and structure
>1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 91
d1tzya_106 a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) 4e-35
d1u35c1106 a.22.1.1 (C:814-919) macro-H2A.1, histone domain { 1e-33
d1f66c_103 a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v 8e-29
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 2e-19
d1n1jb_78 a.22.1.3 (B:) Nuclear transcription factor Y subun 5e-10
d1jfia_66 a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai 2e-08
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 3e-05
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 4e-04
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H2A
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

 Score =  113 bits (284), Expect = 4e-35
 Identities = 55/68 (80%), Positives = 60/68 (88%)

Query: 1   MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPN 60
           +AAVLEYL AE+LELAGNAARDNKK +IIPRH+QLA+RNDEEL KLL  VTIA GGVLPN
Sbjct: 39  LAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPN 98

Query: 61  INPVLLPK 68
           I  VLLPK
Sbjct: 99  IQAVLLPK 106
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 100.0
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 100.0
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 99.97
d1q9ca_172 Histone domain of Son of sevenless protein {Human 99.72
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 98.28
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 98.08
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 97.59
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 96.85
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 95.98
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 95.23
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 95.21
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 94.92
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 94.91
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 93.82
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 93.25
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 92.66
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 91.07
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 90.97
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 88.39
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 87.34
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 86.65
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 85.96
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 84.7
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 81.21
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H2A
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]

Probab=100.00  E-value=1.3e-36  Score=204.95  Aligned_cols=68  Identities=81%  Similarity=1.163  Sum_probs=66.8

Q ss_pred             ChHHHHHHHHHHHHHHHHHHHhcCCccccccchhhcccCcHHHHhhhcCceecCCcccCCCCccCCCC
Q 034549            1 MAAVLEYLAAEVLELAGNAARDNKKKKIIPRHVQLAVRNDEELGKLLTGVTIASGGVLPNINPVLLPK   68 (91)
Q Consensus         1 LAAVLEYLtaEILELA~n~A~~~kk~rItPrhi~lAI~nD~EL~~Lf~~~tIa~gGV~P~i~~~ll~k   68 (91)
                      ||||||||++||||||||+|++++++|||||||++||+||+||++||+++||++|||+|+||++|+||
T Consensus        39 laAVLEYLtaEiLELAgn~a~~~k~~rItPrhi~lAirnDeeL~~L~~~vtI~~GGv~P~Ih~~Llpk  106 (106)
T d1tzya_          39 LAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPK  106 (106)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHTSHHHHHHTTTEEETTCCCCCCCCGGGSCC
T ss_pred             HHHHHHHHHHHHHHHhhHHHHhcCCceecchhhhhcccCHHHHHHHHcCCeecCCCccCccCHhhcCC
Confidence            68999999999999999999999999999999999999999999999999999999999999999986
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure