Citrus Sinensis ID: 034571

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MNITLDNARIAVKAALEEGIVPGGGVALLHASKVLSICSNLKTLISKLVLRFYRMLLRFLFFFFPFSLTSIEFVSSLIVVHRTVQFSLSLI
ccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHEEEEEEEEEEEccc
ccccHcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEHEEHHEEEEEEcEEEEEEccc
MNITLDNARIAVKAALEEGIVPGGGVALLHASKVLSICSNLKTLISKLVLRFYRMLLRFLFfffpfsltsIEFVSSLIVVHRTVQFSLSLI
MNITLDNARIAVKAALEEGIVPGGGVALLHASKVLSICSNLKTLISKLVLRFYRMLLRFLFFFFPFSLTSIEFVSSLIVVHRTVQFSLSLI
MNITLDNARIAVKAALEEGIVPGGGVALLHASKVLSICSNLKTLISKlvlrfyrmllrflffffpfslTSIEFVSSLIVVHRTVQFSLSLI
*****DNARIAVKAALEEGIVPGGGVALLHASKVLSICSNLKTLISKLVLRFYRMLLRFLFFFFPFSLTSIEFVSSLIVVHRTVQFSL***
**ITLDNARIAVKAALEEGIVPGGGVALLHASKVLSICSNLKTLISKLVLRFYRMLLRFLFFFFPFSLTSIEFVSSLIVVHRTVQFSLSLI
MNITLDNARIAVKAALEEGIVPGGGVALLHASKVLSICSNLKTLISKLVLRFYRMLLRFLFFFFPFSLTSIEFVSSLIVVHRTVQFSLSLI
*NITLDNARIAVKAALEEGIVPGGGVALLHASKVLSICSNLKTLISKLVLRFYRMLLRFLFFFFPFSLTSIEFVSSLIVVHRTVQFSLSLI
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooo
ooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNITLDNARIAVKAALEEGIVPGGGVALLHASKVLSICSNLKTLISKLVLRFYRMLLRFLFFFFPFSLTSIEFVSSLIVVHRTVQFSLSLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query91 2.2.26 [Sep-21-2011]
Q2WAW8552 60 kDa chaperonin OS=Magn yes no 0.340 0.056 0.709 3e-05
A1UTX7544 60 kDa chaperonin OS=Bart yes no 0.362 0.060 0.666 4e-05
B0SXR2548 60 kDa chaperonin OS=Caul yes no 0.351 0.058 0.687 4e-05
Q6MBR6534 60 kDa chaperonin 3 OS=Pr yes no 0.340 0.058 0.709 5e-05
Q2N5R9550 60 kDa chaperonin 2 OS=Er yes no 0.340 0.056 0.677 6e-05
A5EG60540 60 kDa chaperonin 3 OS=Br yes no 0.340 0.057 0.677 8e-05
A4YRI5539 60 kDa chaperonin 1 OS=Br yes no 0.340 0.057 0.677 8e-05
A8ILV4547 60 kDa chaperonin 1 OS=Az yes no 0.516 0.085 0.52 9e-05
A8I5R5542 60 kDa chaperonin 2 OS=Az no no 0.340 0.057 0.709 0.0001
C0R2V3549 60 kDa chaperonin OS=Wolb yes no 0.340 0.056 0.677 0.0001
>sp|Q2WAW8|CH60_MAGSA 60 kDa chaperonin OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=groL PE=3 SV=1 Back     alignment and function desciption
 Score = 47.4 bits (111), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 22/31 (70%), Positives = 26/31 (83%)

Query: 5   LDNARIAVKAALEEGIVPGGGVALLHASKVL 35
           +D+A  A +AA+EEGIVPGGGVALLHA K L
Sbjct: 396 VDDALHATRAAVEEGIVPGGGVALLHAVKAL 426
Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions.
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) (taxid: 342108)
>sp|A1UTX7|CH60_BARBK 60 kDa chaperonin OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=groL PE=3 SV=1 Back     alignment and function description
>sp|B0SXR2|CH60_CAUSK 60 kDa chaperonin OS=Caulobacter sp. (strain K31) GN=groL PE=3 SV=1 Back     alignment and function description
>sp|Q6MBR6|CH603_PARUW 60 kDa chaperonin 3 OS=Protochlamydia amoebophila (strain UWE25) GN=groL3 PE=3 SV=1 Back     alignment and function description
>sp|Q2N5R9|CH602_ERYLH 60 kDa chaperonin 2 OS=Erythrobacter litoralis (strain HTCC2594) GN=groL2 PE=3 SV=1 Back     alignment and function description
>sp|A5EG60|CH603_BRASB 60 kDa chaperonin 3 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=groL3 PE=3 SV=1 Back     alignment and function description
>sp|A4YRI5|CH601_BRASO 60 kDa chaperonin 1 OS=Bradyrhizobium sp. (strain ORS278) GN=groL1 PE=3 SV=1 Back     alignment and function description
>sp|A8ILV4|CH601_AZOC5 60 kDa chaperonin 1 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571) GN=groL1 PE=3 SV=1 Back     alignment and function description
>sp|A8I5R5|CH602_AZOC5 60 kDa chaperonin 2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571) GN=groL2 PE=3 SV=1 Back     alignment and function description
>sp|C0R2V3|CH60_WOLWR 60 kDa chaperonin OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=groL PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
307136284 990 chaperonin-60 kDa protein [Cucumis melo 0.285 0.026 0.807 0.0005
197103235 539 heat shock protein chaperonin, HSP60 [Ph 0.340 0.057 0.741 0.0006
407784133 548 chaperonin GroEL [Oceanibaculum indicum 0.340 0.056 0.709 0.0006
256380529 541 chaperonin GroEL [Actinosynnema mirum DS 0.340 0.057 0.709 0.0006
449447855 980 PREDICTED: LOW QUALITY PROTEIN: chaperon 0.285 0.026 0.807 0.0007
197106643 547 molecular chaperone GroEL [Phenylobacter 0.340 0.056 0.741 0.0008
>gi|307136284|gb|ADN34111.1| chaperonin-60 kDa protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
 Score = 48.5 bits (114), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/26 (80%), Positives = 24/26 (92%)

Query: 11  AVKAALEEGIVPGGGVALLHASKVLS 36
           A +AA+EEGIVPGGGVALLHA+KVL 
Sbjct: 706 ATRAAVEEGIVPGGGVALLHATKVLD 731

Source: Cucumis melo subsp. melo

Species: Cucumis melo

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|197103235|ref|YP_002128613.1| heat shock protein chaperonin, HSP60 [Phenylobacterium zucineum HLK1] gi|196480511|gb|ACG80038.1| heat shock protein chaperonin, HSP60 [Phenylobacterium zucineum HLK1] Back     alignment and taxonomy information
>gi|407784133|ref|ZP_11131317.1| chaperonin GroEL [Oceanibaculum indicum P24] gi|407198205|gb|EKE68245.1| chaperonin GroEL [Oceanibaculum indicum P24] Back     alignment and taxonomy information
>gi|256380529|ref|YP_003104189.1| chaperonin GroEL [Actinosynnema mirum DSM 43827] gi|255924832|gb|ACU40343.1| chaperonin GroEL [Actinosynnema mirum DSM 43827] Back     alignment and taxonomy information
>gi|449447855|ref|XP_004141682.1| PREDICTED: LOW QUALITY PROTEIN: chaperonin CPN60-like 2, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|197106643|ref|YP_002132020.1| molecular chaperone GroEL [Phenylobacterium zucineum HLK1] gi|196480063|gb|ACG79591.1| heat shock protein chaperonin, HSP60 [Phenylobacterium zucineum HLK1] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query91
TAIR|locus:2046590585 HSP60-2 "heat shock protein 60 0.274 0.042 0.84 0.00025
TAIR|locus:2087959572 HSP60-3A "heat shock protein 6 0.329 0.052 0.636 0.0004
GENEDB_PFALCIPARUM|PF10_0153580 PF10_0153 "hsp60" [Plasmodium 0.340 0.053 0.677 0.00086
UNIPROTKB|Q8IJN9580 PF10_0153 "Heat shock protein 0.340 0.053 0.677 0.00086
TAIR|locus:2046590 HSP60-2 "heat shock protein 60-2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 100 (40.3 bits), Expect = 0.00025, P = 0.00025
 Identities = 21/25 (84%), Positives = 23/25 (92%)

Query:    11 AVKAALEEGIVPGGGVALLHASKVL 35
             A KAA+EEGIVPGGGVALL+ASK L
Sbjct:   433 ATKAAVEEGIVPGGGVALLYASKEL 457
GO:0005524 "ATP binding" evidence=IEA;IDA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;ISS;IDA
GO:0006457 "protein folding" evidence=IEA
GO:0006954 "inflammatory response" evidence=ISS
GO:0042026 "protein refolding" evidence=IEA
GO:0044267 "cellular protein metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA
GO:0005774 "vacuolar membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005507 "copper ion binding" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0006094 "gluconeogenesis" evidence=RCA
GO:0007010 "cytoskeleton organization" evidence=RCA
GO:0009165 "nucleotide biosynthetic process" evidence=RCA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0010498 "proteasomal protein catabolic process" evidence=RCA
TAIR|locus:2087959 HSP60-3A "heat shock protein 60-3A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF10_0153 PF10_0153 "hsp60" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IJN9 PF10_0153 "Heat shock protein 60" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
cd03344520 cd03344, GroEL, GroEL_like type I chaperonin 4e-12
PTZ00114555 PTZ00114, PTZ00114, Heat shock protein 60; Provisi 2e-11
PRK12849542 PRK12849, groEL, chaperonin GroEL; Reviewed 1e-10
PRK00013542 PRK00013, groEL, chaperonin GroEL; Reviewed 5e-10
PRK12851541 PRK12851, groEL, chaperonin GroEL; Reviewed 6e-09
PRK12850544 PRK12850, groEL, chaperonin GroEL; Reviewed 8e-09
TIGR02348524 TIGR02348, GroEL, chaperonin GroL 1e-08
PRK12852545 PRK12852, groEL, chaperonin GroEL; Reviewed 4e-08
PRK14104546 PRK14104, PRK14104, chaperonin GroEL; Provisional 4e-07
CHL00093529 CHL00093, groEL, chaperonin GroEL 6e-07
cd00309464 cd00309, chaperonin_type_I_II, chaperonin families 7e-06
COG0459524 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Po 2e-05
PLN03167600 PLN03167, PLN03167, Chaperonin-60 beta subunit; Pr 9e-05
pfam00118481 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin fami 4e-04
>gnl|CDD|239460 cd03344, GroEL, GroEL_like type I chaperonin Back     alignment and domain information 
 Score = 59.4 bits (145), Expect = 4e-12
 Identities = 20/31 (64%), Positives = 25/31 (80%)

Query: 5   LDNARIAVKAALEEGIVPGGGVALLHASKVL 35
           +++A  A +AA+EEGIVPGGGVALL AS  L
Sbjct: 393 VEDALNATRAAVEEGIVPGGGVALLRASPAL 423

Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found in eubacteria (GroEL) and in organelles of eubacterial descent (hsp60 and RBP). With the aid of cochaperonin GroES, GroEL encapsulates non-native substrate proteins inside the cavity of the GroEL-ES complex and promotes folding by using energy derived from ATP hydrolysis. Length = 520
>gnl|CDD|185455 PTZ00114, PTZ00114, Heat shock protein 60; Provisional Back     alignment and domain information
>gnl|CDD|237230 PRK12849, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|234573 PRK00013, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|171770 PRK12851, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|237231 PRK12850, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|233828 TIGR02348, GroEL, chaperonin GroL Back     alignment and domain information
>gnl|CDD|237232 PRK12852, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|172594 PRK14104, PRK14104, chaperonin GroEL; Provisional Back     alignment and domain information
>gnl|CDD|177025 CHL00093, groEL, chaperonin GroEL Back     alignment and domain information
>gnl|CDD|238189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II Back     alignment and domain information
>gnl|CDD|223535 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215611 PLN03167, PLN03167, Chaperonin-60 beta subunit; Provisional Back     alignment and domain information
>gnl|CDD|215730 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 91
KOG0356550 consensus Mitochondrial chaperonin, Cpn60/Hsp60p [ 99.82
COG0459524 GroL Chaperonin GroEL (HSP60 family) [Posttranslat 99.66
PRK12850544 groEL chaperonin GroEL; Reviewed 99.65
CHL00093529 groEL chaperonin GroEL 99.65
PTZ00114555 Heat shock protein 60; Provisional 99.65
PLN03167600 Chaperonin-60 beta subunit; Provisional 99.64
PRK12852545 groEL chaperonin GroEL; Reviewed 99.63
PRK12851541 groEL chaperonin GroEL; Reviewed 99.62
PRK00013542 groEL chaperonin GroEL; Reviewed 99.61
cd03344520 GroEL GroEL_like type I chaperonin. Chaperonins ar 99.6
TIGR02348524 GroEL chaperonin GroL. This family consists of Gro 99.58
PRK12849542 groEL chaperonin GroEL; Reviewed 99.58
cd03343517 cpn60 cpn60 chaperonin family. Chaperonins are inv 99.56
PRK14104546 chaperonin GroEL; Provisional 99.56
TIGR02345522 chap_CCT_eta T-complex protein 1, eta subunit. Mem 99.56
TIGR02340536 chap_CCT_alpha T-complex protein 1, alpha subunit. 99.55
cd03341472 TCP1_theta TCP-1 (CTT or eukaryotic type II) chape 99.54
cd03342484 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaper 99.53
TIGR02346531 chap_CCT_theta T-complex protein 1, theta subunit. 99.53
cd00309464 chaperonin_type_I_II chaperonin families, type I a 99.51
cd03338515 TCP1_delta TCP-1 (CTT or eukaryotic type II) chape 99.51
cd03339526 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) cha 99.51
PTZ00212533 T-complex protein 1 subunit beta; Provisional 99.51
TIGR02344525 chap_CCT_gamma T-complex protein 1, gamma subunit. 99.5
cd03336517 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaper 99.5
cd03335527 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chape 99.5
TIGR02347531 chap_CCT_zeta T-complex protein 1, zeta subunit. M 99.49
TIGR02339519 thermosome_arch thermosome, various subunits, arch 99.49
TIGR02342517 chap_CCT_delta T-complex protein 1, delta subunit. 99.47
cd03340522 TCP1_eta TCP-1 (CTT or eukaryotic type II) chapero 99.47
TIGR02341519 chap_CCT_beta T-complex protein 1, beta subunit. M 99.45
TIGR02343532 chap_CCT_epsi T-complex protein 1, epsilon subunit 99.45
cd03337480 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chape 99.45
PF00118485 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperon 99.3
KOG0361543 consensus Chaperonin complex component, TCP-1 eta 97.59
KOG0359520 consensus Chaperonin complex component, TCP-1 zeta 96.95
KOG0358534 consensus Chaperonin complex component, TCP-1 delt 96.87
KOG0363527 consensus Chaperonin complex component, TCP-1 beta 95.98
KOG0362537 consensus Chaperonin complex component, TCP-1 thet 95.86
KOG0357400 consensus Chaperonin complex component, TCP-1 epsi 95.86
KOG0360545 consensus Chaperonin complex component, TCP-1 alph 82.35
>KOG0356 consensus Mitochondrial chaperonin, Cpn60/Hsp60p [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.82  E-value=9.8e-21  Score=159.73  Aligned_cols=70  Identities=30%  Similarity=0.307  Sum_probs=65.9

Q ss_pred             CcchHHHHHHhHHHHHhhccccCchHHHHHhHHHhhhhhh----hHHHHHHHHHHHHHHHHHHHHhcCCCCcch
Q 034571            1 MNITLDNARIAVKAALEEGIVPGGGVALLHASKVLSICSN----LKTLISKLVLRFYRMLLRFLFFFFPFSLTS   70 (91)
Q Consensus         1 ~K~RieDALnAtrAAveeGIVpGGG~aLl~a~~~L~~l~g----~q~~Gi~IV~rAL~~Pl~QI~~n~~~~~~~   70 (91)
                      ||+|++||||||++|+|||+|||||++|++|++.|++++.    +++.|++||++||+.|++.|+.|+|+|-..
T Consensus       406 kk~rv~dalnat~aaveeGivpGGG~all~~~~~l~~lk~~~~~~~k~G~eiv~~Al~~P~~~IakNAGvdg~~  479 (550)
T KOG0356|consen  406 KKDRVEDALNATRAAVEEGIVPGGGTALLRAIPVLDELKATNNFDQKVGVEIVKKALRLPAQTIAKNAGVDGSV  479 (550)
T ss_pred             hhhhHHHHHHHHHHHhhcCcccCCchHHHHhhhhhhhcccccchHhhhhHHHHHHHHhhhHHHHHHhcCCchHH
Confidence            6999999999999999999999999999999999999875    399999999999999999999999998643

>COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12850 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>CHL00093 groEL chaperonin GroEL Back     alignment and domain information
>PTZ00114 Heat shock protein 60; Provisional Back     alignment and domain information
>PLN03167 Chaperonin-60 beta subunit; Provisional Back     alignment and domain information
>PRK12852 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12851 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK00013 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>cd03344 GroEL GroEL_like type I chaperonin Back     alignment and domain information
>TIGR02348 GroEL chaperonin GroL Back     alignment and domain information
>PRK12849 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>cd03343 cpn60 cpn60 chaperonin family Back     alignment and domain information
>PRK14104 chaperonin GroEL; Provisional Back     alignment and domain information
>TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit Back     alignment and domain information
>TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit Back     alignment and domain information
>cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit Back     alignment and domain information
>cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information
>TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit Back     alignment and domain information
>cd00309 chaperonin_type_I_II chaperonin families, type I and type II Back     alignment and domain information
>cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit Back     alignment and domain information
>cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit Back     alignment and domain information
>PTZ00212 T-complex protein 1 subunit beta; Provisional Back     alignment and domain information
>TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit Back     alignment and domain information
>cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit Back     alignment and domain information
>TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit Back     alignment and domain information
>TIGR02339 thermosome_arch thermosome, various subunits, archaeal Back     alignment and domain information
>TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit Back     alignment and domain information
>cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information
>TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit Back     alignment and domain information
>TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit Back     alignment and domain information
>cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit Back     alignment and domain information
>PF00118 Cpn60_TCP1: TCP-1/cpn60 chaperonin family Chaperonins cpn60 signature Chaperonins TCP-1 signatures 60 kd chaperonin signature; InterPro: IPR002423 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism Back     alignment and domain information
>KOG0361 consensus Chaperonin complex component, TCP-1 eta subunit (CCT7) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0359 consensus Chaperonin complex component, TCP-1 zeta subunit (CCT6) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0358 consensus Chaperonin complex component, TCP-1 delta subunit (CCT4) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0363 consensus Chaperonin complex component, TCP-1 beta subunit (CCT2) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0362 consensus Chaperonin complex component, TCP-1 theta subunit (CCT8) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0357 consensus Chaperonin complex component, TCP-1 epsilon subunit (CCT5) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0360 consensus Chaperonin complex component, TCP-1 alpha subunit (CCT1) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query91
3rtk_A546 60 kDa chaperonin 2; heat shock protein, chaperone 9e-10
1we3_A543 CPN60(groel); chaperonin, chaperone, groel, HSP60, 1e-09
1iok_A545 Chaperonin 60; chaperone; 3.20A {Paracoccus denitr 1e-09
1kp8_A547 Groel protein; chaperonin, assisted protein foldin 1e-09
>3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Length = 546 Back     alignment and structure
 Score = 52.6 bits (127), Expect = 9e-10
 Identities = 17/32 (53%), Positives = 22/32 (68%)

Query: 5   LDNARIAVKAALEEGIVPGGGVALLHASKVLS 36
           +++A    KAA+EEGIV GGGV LL A+  L 
Sbjct: 394 IEDAVRNAKAAVEEGIVAGGGVTLLQAAPTLD 425
>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Length = 543 Back     alignment and structure
>1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Length = 545 Back     alignment and structure
>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Length = 547 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
3p9d_B527 T-complex protein 1 subunit beta; HSP60, eukaryoti 99.72
1kp8_A547 Groel protein; chaperonin, assisted protein foldin 99.71
1we3_A543 CPN60(groel); chaperonin, chaperone, groel, HSP60, 99.7
3rtk_A546 60 kDa chaperonin 2; heat shock protein, chaperone 99.7
3iyg_Q512 T-complex protein 1 subunit theta; TRIC/CCT, asymm 99.7
1iok_A545 Chaperonin 60; chaperone; 3.20A {Paracoccus denitr 99.69
3iyg_E515 T-complex protein 1 subunit; TRIC/CCT, asymmetric, 99.69
3p9d_C590 T-complex protein 1 subunit gamma; HSP60, eukaryot 99.68
3iyg_D518 T-complex protein 1 subunit delta; TRIC/CCT, asymm 99.68
3p9d_F546 T-complex protein 1 subunit zeta; HSP60, eukaryoti 99.67
3p9d_G550 T-complex protein 1 subunit ETA; HSP60, eukaryotic 99.67
3p9d_E562 T-complex protein 1 subunit epsilon; HSP60, eukary 99.67
3iyg_H515 T-complex protein 1 subunit ETA; TRIC/CCT, asymmet 99.67
3p9d_A559 T-complex protein 1 subunit alpha; HSP60, eukaryot 99.67
3ruv_A543 Chaperonin, CPN; double-ring, protein folding mach 99.67
3iyg_Z517 T-complex protein 1 subunit zeta; TRIC/CCT, asymme 99.66
3p9d_D528 T-complex protein 1 subunit delta; HSP60, eukaryot 99.66
3iyg_B513 T-complex protein 1 subunit beta; TRIC/CCT, asymme 99.66
3aq1_B500 Thermosome subunit; group II chaperonin, protein f 99.66
3ko1_A553 Chaperonin; 9-fold symmetry, double ring, ATP hydr 99.64
1a6d_A545 Thermosome (alpha subunit); group II chaperonin, C 99.64
1q3q_A548 Thermosome alpha subunit; chaperone, chaperonin; H 99.64
1a6d_B543 Thermosome (beta subunit); group II chaperonin, CC 99.63
3iyg_G515 T-complex protein 1 subunit gamma; TRIC/CCT, asymm 99.63
3iyg_A529 T-complex protein 1 subunit alpha; TRIC/CCT, asymm 99.6
3p9d_H568 T-complex protein 1 subunit theta; HSP60, eukaryot 99.57
>3p9d_B T-complex protein 1 subunit beta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_b* 4d8q_B* 4d8r_b* Back     alignment and structure
Probab=99.72  E-value=5.4e-18  Score=137.19  Aligned_cols=79  Identities=27%  Similarity=0.209  Sum_probs=70.7

Q ss_pred             CcchHHHHHHhHHHHHhhc-cccCchHHHHHhHHHhhhh----hhhHHHHHHHHHHHHHHHHHHHHhcCCCCcchhhhhh
Q 034571            1 MNITLDNARIAVKAALEEG-IVPGGGVALLHASKVLSIC----SNLKTLISKLVLRFYRMLLRFLFFFFPFSLTSIEFVS   75 (91)
Q Consensus         1 ~K~RieDALnAtrAAveeG-IVpGGG~aLl~a~~~L~~l----~g~q~~Gi~IV~rAL~~Pl~QI~~n~~~~~~~~~~~~   75 (91)
                      +|+|++|||+++|+|+++| +|||||+++++++..|+++    .+++++|++++.+||+.|.+||++|+|||-  ++.++
T Consensus       380 ~kr~i~DAl~~~r~av~~g~iVpGGGa~e~~~s~~L~~~~~~~~g~eq~~i~~~a~ALe~ip~~La~NaG~d~--~~vv~  457 (527)
T 3p9d_B          380 AERSLHDALSVLSQTTKETRTVLGGGCAEMVMSKAVDTEAQNIDGKKSLAVEAFARALRQLPTILADNAGFDS--SELVS  457 (527)
T ss_dssp             HHTHHHHHHHHHHHHHHCCCEEETTTHHHHHHHHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHHHHHTSCS--HHHHH
T ss_pred             HHHHHHHHHHHHHHHHhcCCcccCCcHHHHHHHHHHHHHHhccCcHHHHHHHHHHHHHHHHHHHHHhccCCCH--HHHHH
Confidence            4789999999999999999 9999999999999999864    577999999999999999999999999985  55666


Q ss_pred             hhheee
Q 034571           76 SLIVVH   81 (91)
Q Consensus        76 ~~~~~~   81 (91)
                      .|.--|
T Consensus       458 ~l~~~h  463 (527)
T 3p9d_B          458 KLRSSI  463 (527)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            665555
>1kp8_A Groel protein; chaperonin, assisted protein folding, chaperone; HET: ATP; 2.00A {Escherichia coli} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1gr5_A 2c7e_A* 1grl_A 1oel_A 1xck_A 1gru_A 1mnf_A 1aon_A 2c7c_A 2c7d_A 2cgt_A 2nwc_A 3e76_A* 2eu1_A 1j4z_A 1kpo_O 1sx3_A* 3c9v_A 1ss8_A 3cau_A ... Back     alignment and structure
>1we3_A CPN60(groel); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 PDB: 1wf4_a* Back     alignment and structure
>3rtk_A 60 kDa chaperonin 2; heat shock protein, chaperone; 2.80A {Mycobacterium tuberculosis} PDB: 1sjp_A Back     alignment and structure
>3iyg_Q T-complex protein 1 subunit theta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>1iok_A Chaperonin 60; chaperone; 3.20A {Paracoccus denitrificans} SCOP: a.129.1.1 c.8.5.1 d.56.1.1 Back     alignment and structure
>3iyg_E T-complex protein 1 subunit; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_C T-complex protein 1 subunit gamma; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_c* 4d8q_C* 4d8r_c* 2bbm_B 2bbn_B Back     alignment and structure
>3iyg_D T-complex protein 1 subunit delta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_F T-complex protein 1 subunit zeta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_f* 4d8q_F* 4d8r_f* Back     alignment and structure
>3p9d_G T-complex protein 1 subunit ETA; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_g* 4d8q_G* 4d8r_g* Back     alignment and structure
>3p9d_E T-complex protein 1 subunit epsilon; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_e* 4d8q_E* 4d8r_e* Back     alignment and structure
>3iyg_H T-complex protein 1 subunit ETA; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_A T-complex protein 1 subunit alpha; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_a* 4d8q_A* 4d8r_a* Back     alignment and structure
>3ruv_A Chaperonin, CPN; double-ring, protein folding machinery, group II chaperonin, binding, chaperone; HET: ANP; 2.24A {Methanococcus maripaludis} PDB: 3rus_A* 3ruw_A* 3ruq_A* 3los_A 3kfb_A* 3izi_A 3izj_A 3izm_A 3izh_A 3kfe_A* 3iyf_A* 3kfk_A* 3izk_A 3izl_A 3j03_A 3izn_A 3j02_A Back     alignment and structure
>3iyg_Z T-complex protein 1 subunit zeta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_D T-complex protein 1 subunit delta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_d* 4d8q_D* 4d8r_d* Back     alignment and structure
>3iyg_B T-complex protein 1 subunit beta; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} PDB: 3ktt_B 4a0o_A 4a0v_A 4a0w_A 4a13_A Back     alignment and structure
>3aq1_B Thermosome subunit; group II chaperonin, protein folding, chaperone; 2.75A {Methanococcoides burtonii} Back     alignment and structure
>3ko1_A Chaperonin; 9-fold symmetry, double ring, ATP hydrolase, chaperone, NUCL binding; HET: ADP; 3.70A {Acidianus tengchongensis} Back     alignment and structure
>1a6d_A Thermosome (alpha subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_A* Back     alignment and structure
>1q3q_A Thermosome alpha subunit; chaperone, chaperonin; HET: ANP; 2.30A {Thermococcus SP} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1q2v_A* 1q3s_A* 1q3r_A Back     alignment and structure
>1a6d_B Thermosome (beta subunit); group II chaperonin, CCT, TRIC, PR folding, ATPase, chaperonin; 2.60A {Thermoplasma acidophilum} SCOP: a.129.1.2 c.8.5.2 d.56.1.2 PDB: 1a6e_B* 1e0r_B Back     alignment and structure
>3iyg_G T-complex protein 1 subunit gamma; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3iyg_A T-complex protein 1 subunit alpha; TRIC/CCT, asymmetric, cryo-EM, subunit arrangement, acetylation, ATP-binding, chaperone, cytoplasm, isopeptide bond; 4.00A {Bos taurus} Back     alignment and structure
>3p9d_H T-complex protein 1 subunit theta; HSP60, eukaryotic chaperonin, actin/tubulin binding, hexadec chaperone; HET: ADP; 3.80A {Saccharomyces cerevisiae} PDB: 3p9e_h* 4d8q_H* 4d8r_h* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query91
d1ioka1252 GroEL, E domain {Paracoccus denitrificans [TaxId: 99.19
d1sjpa1180 GroEL, E domain {Mycobacterium tuberculosis, GroEL 99.13
d1we3a1255 GroEL, E domain {Thermus thermophilus [TaxId: 274] 99.11
d1kp8a1252 GroEL, E domain {Escherichia coli [TaxId: 562]} 98.67
d1a6da1245 Thermosome, E domain {Archaeon Thermoplasma acidop 98.51
d1a6db1243 Thermosome, E domain {Archaeon Thermoplasma acidop 98.41
d1q3qa1258 Thermosome, E domain {Archaeon Thermococcus sp. ks 98.04
>d1ioka1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
class: All alpha proteins
fold: GroEL equatorial domain-like
superfamily: GroEL equatorial domain-like
family: GroEL chaperone, ATPase domain
domain: GroEL, E domain
species: Paracoccus denitrificans [TaxId: 266]

Probab=99.19  E-value=4.2e-12  Score=92.12  Aligned_cols=67  Identities=22%  Similarity=0.161  Sum_probs=58.6

Q ss_pred             chHHHHHHhHHHHHhhccccCchHHHHHhHHHhhhhh---hhHHHHHHHHHHHHHHHHHHHHhcCCCCcc
Q 034571            3 ITLDNARIAVKAALEEGIVPGGGVALLHASKVLSICS---NLKTLISKLVLRFYRMLLRFLFFFFPFSLT   69 (91)
Q Consensus         3 ~RieDALnAtrAAveeGIVpGGG~aLl~a~~~L~~l~---g~q~~Gi~IV~rAL~~Pl~QI~~n~~~~~~   69 (91)
                      ++..|++..+..++.+|++||||.++++++..+++.+   +++++|++||.+||..|++||+.|+|+|-.
T Consensus       120 ~~a~~~v~~~l~~~a~~i~~~g~~al~~~~~~l~~~~~~~~d~~~G~~iv~~Al~~p~~~i~~naG~dg~  189 (252)
T d1ioka1         120 DVATAKVVEAIKSAARGIVVGGGVALVQGAKVLEGLSGANSDQDAGIAIIRRALEAPMRQIAENAGVDGA  189 (252)
T ss_dssp             HHHHHHHHHHHHTTCBCEEETTTHHHHHHGGGGGSCCCSSHHHHHHHHHHHHHTTHHHHHHHHHHTSCHH
T ss_pred             HHHHHHHHHHHHHhcCCCCCchHHhhHHHHHHHHhhhcccchHHHHHHHHHHHHHHHHHHHHhccCCCcc
Confidence            4566777777777788999999999999999998654   669999999999999999999999999854
>d1sjpa1 a.129.1.1 (A:62-134,A:408-514) GroEL, E domain {Mycobacterium tuberculosis, GroEL2 [TaxId: 1773]} Back     information, alignment and structure
>d1we3a1 a.129.1.1 (A:3-138,A:409-527) GroEL, E domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kp8a1 a.129.1.1 (A:2-136,A:410-526) GroEL, E domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a6da1 a.129.1.2 (A:17-145,A:404-519) Thermosome, E domain {Archaeon Thermoplasma acidophilum, alpha chain [TaxId: 2303]} Back     information, alignment and structure
>d1a6db1 a.129.1.2 (B:20-144,B:404-521) Thermosome, E domain {Archaeon Thermoplasma acidophilum, beta chain [TaxId: 2303]} Back     information, alignment and structure
>d1q3qa1 a.129.1.2 (A:9-145,A:406-526) Thermosome, E domain {Archaeon Thermococcus sp. ks-1, alpha chain [TaxId: 79679]} Back     information, alignment and structure