Citrus Sinensis ID: 034578


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMFDAIPNADAVFMKVA
ccccHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHHccccEEEEEEcHHHHHcccccccEEEEEcccccccccccEEEEEcc
cccccHHHHHHHHHHHccccccccccEEEEcccccHHHHccHHHcccccEEEEEcHHHHHccccEccEEEEEccccccccccccEEccEc
MACTTKITMKAFVSHYkvdgfnniRSMVDVGGGTGTVLAEIVKsyphikginfdLQHViatapthegvshvggdmfdaipNADAVFMKVA
macttkitmKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMFDAIPNADAVFMKVA
MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMFDAIPNADAVFMKVA
***TTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMFDAIPNADAVF****
****T**TMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMFDAIPNADAVFMKVA
MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMFDAIPNADAVFMKVA
****TKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMFDAIPNADAVFMKVA
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMFDAIPNADAVFMKVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query90 2.2.26 [Sep-21-2011]
Q43046365 Caffeic acid 3-O-methyltr N/A no 0.911 0.224 0.630 2e-23
Q00763365 Caffeic acid 3-O-methyltr N/A no 0.911 0.224 0.619 9e-23
P28002365 Caffeic acid 3-O-methyltr N/A no 0.955 0.235 0.602 1e-22
Q43609365 Caffeic acid 3-O-methyltr N/A no 0.955 0.235 0.602 2e-22
Q41086364 Caffeic acid 3-O-methyltr N/A no 0.955 0.236 0.590 2e-22
Q43047364 Caffeic acid 3-O-methyltr N/A no 0.911 0.225 0.607 3e-22
Q9FK25363 Flavone 3'-O-methyltransf yes no 0.955 0.236 0.556 4e-22
Q8GU25365 Caffeic acid 3-O-methyltr N/A no 0.955 0.235 0.590 6e-22
Q8W013363 Caffeic acid 3-O-methyltr N/A no 0.955 0.236 0.545 7e-22
Q9SWC2313 Caffeic acid 3-O-methyltr N/A no 0.911 0.261 0.595 1e-21
>sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 Back     alignment and function desciption
 Score =  107 bits (268), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 62/84 (73%), Gaps = 2/84 (2%)

Query: 5   TKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPT 64
           + ITMK  +  YK  GF  + S+VDVGGGTG V+  IV  YP IKGINFDL HVI  AP+
Sbjct: 184 STITMKKILETYK--GFEGLTSLVDVGGGTGAVVNTIVSKYPSIKGINFDLPHVIEDAPS 241

Query: 65  HEGVSHVGGDMFDAIPNADAVFMK 88
           + GV HVGGDMF ++PNADAVFMK
Sbjct: 242 YPGVEHVGGDMFVSVPNADAVFMK 265




Catalyzes the conversion of caffeic acid to ferulic acid and of 5-hydroxyferulic acid to sinapic acid. The resulting products may subsequently be converted to the corresponding alcohols that are incorporated into lignins.
Populus kitakamiensis (taxid: 34292)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 6EC: 8
>sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 Back     alignment and function description
>sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 Back     alignment and function description
>sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 Back     alignment and function description
>sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 Back     alignment and function description
>sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SWC2|COMT1_EUCGL Caffeic acid 3-O-methyltransferase (Fragment) OS=Eucalyptus globulus GN=COMT1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
118486094 354 unknown [Populus trichocarpa] 0.966 0.245 0.727 7e-33
224103575 354 alkaloid o-methyltransferase related [Po 0.966 0.245 0.715 2e-32
183585187 351 caffeic acid 3-O-methyltransferase [Popu 0.966 0.247 0.693 1e-30
429326472 351 caffeic acid O-methyltransferase [Populu 0.966 0.247 0.693 1e-30
224127144 351 alkaloid o-methyltransferase related [Po 0.966 0.247 0.693 2e-30
255553835 351 o-methyltransferase, putative [Ricinus c 0.966 0.247 0.681 3e-29
388502510 369 unknown [Lotus japonicus] 0.966 0.235 0.636 3e-28
255553833 352 o-methyltransferase, putative [Ricinus c 0.966 0.247 0.659 8e-28
225447213 375 PREDICTED: (RS)-norcoclaurine 6-O-methyl 0.966 0.232 0.704 1e-27
147809600 375 hypothetical protein VITISV_006040 [Viti 0.966 0.232 0.704 2e-27
>gi|118486094|gb|ABK94890.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  144 bits (363), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 64/88 (72%), Positives = 78/88 (88%), Gaps = 1/88 (1%)

Query: 1   MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIA 60
           MACT+ ITM+A +SHYK DGFNNIRS+VDV GG G  +AEIV++YPHI+GINFDL HV+A
Sbjct: 166 MACTSNITMRAILSHYK-DGFNNIRSLVDVAGGIGGHVAEIVRAYPHIEGINFDLPHVVA 224

Query: 61  TAPTHEGVSHVGGDMFDAIPNADAVFMK 88
           TAP +EGVSHV G+MF+AIPNADA+FM+
Sbjct: 225 TAPKYEGVSHVAGNMFEAIPNADAIFMQ 252




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224103575|ref|XP_002334037.1| alkaloid o-methyltransferase related [Populus trichocarpa] gi|224124568|ref|XP_002319364.1| alkaloid o-methyltransferase related [Populus trichocarpa] gi|222839673|gb|EEE77996.1| alkaloid o-methyltransferase related [Populus trichocarpa] gi|222857740|gb|EEE95287.1| alkaloid o-methyltransferase related [Populus trichocarpa] Back     alignment and taxonomy information
>gi|183585187|gb|ACC63885.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|429326472|gb|AFZ78576.1| caffeic acid O-methyltransferase [Populus tomentosa] Back     alignment and taxonomy information
>gi|224127144|ref|XP_002329411.1| alkaloid o-methyltransferase related [Populus trichocarpa] gi|222870461|gb|EEF07592.1| alkaloid o-methyltransferase related [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255553835|ref|XP_002517958.1| o-methyltransferase, putative [Ricinus communis] gi|223542940|gb|EEF44476.1| o-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|388502510|gb|AFK39321.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255553833|ref|XP_002517957.1| o-methyltransferase, putative [Ricinus communis] gi|223542939|gb|EEF44475.1| o-methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225447213|ref|XP_002277602.1| PREDICTED: (RS)-norcoclaurine 6-O-methyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|147809600|emb|CAN64492.1| hypothetical protein VITISV_006040 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
TAIR|locus:2153423363 OMT1 "AT5G54160" [Arabidopsis 0.955 0.236 0.556 4.3e-22
TAIR|locus:2015519205 AT1G62900 [Arabidopsis thalian 0.955 0.419 0.511 1e-20
TAIR|locus:2015223381 AT1G63140 [Arabidopsis thalian 0.955 0.225 0.511 1.5e-20
TAIR|locus:2204695381 AT1G77530 [Arabidopsis thalian 0.955 0.225 0.488 1.3e-19
TAIR|locus:2034016363 AT1G51990 [Arabidopsis thalian 0.911 0.225 0.511 2.1e-19
TAIR|locus:2204680381 AT1G77520 [Arabidopsis thalian 0.955 0.225 0.5 3.8e-19
TAIR|locus:2166193334 AT5G37170 [Arabidopsis thalian 0.955 0.257 0.471 8.7e-18
TAIR|locus:2102038359 AT3G53140 [Arabidopsis thalian 0.866 0.217 0.518 1.1e-17
UNIPROTKB|Q84N28360 OMT1 "Flavone O-methyltransfer 0.888 0.222 0.512 3.2e-17
TAIR|locus:2164087378 AT5G53810 [Arabidopsis thalian 0.911 0.216 0.494 4e-17
TAIR|locus:2153423 OMT1 "AT5G54160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 257 (95.5 bits), Expect = 4.3e-22, P = 4.3e-22
 Identities = 49/88 (55%), Positives = 61/88 (69%)

Query:     1 MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIA 60
             M+  + ITMK  +  YK  GF  + S+VDVGGG G  L  IV  YP++KGINFDL HVI 
Sbjct:   178 MSNHSTITMKKILETYK--GFEGLTSLVDVGGGIGATLKMIVSKYPNLKGINFDLPHVIE 235

Query:    61 TAPTHEGVSHVGGDMFDAIPNADAVFMK 88
              AP+H G+ HVGGDMF ++P  DA+FMK
Sbjct:   236 DAPSHPGIEHVGGDMFVSVPKGDAIFMK 263




GO:0030744 "luteolin O-methyltransferase activity" evidence=IDA
GO:0030755 "quercetin 3-O-methyltransferase activity" evidence=IDA
GO:0033799 "myricetin 3'-O-methyltransferase activity" evidence=IDA
GO:0047763 "caffeate O-methyltransferase activity" evidence=ISS;IMP
GO:0051555 "flavonol biosynthetic process" evidence=IDA
GO:0009809 "lignin biosynthetic process" evidence=IMP
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0006598 "polyamine catabolic process" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009698 "phenylpropanoid metabolic process" evidence=RCA
GO:0009805 "coumarin biosynthetic process" evidence=RCA
GO:0009963 "positive regulation of flavonoid biosynthetic process" evidence=RCA
GO:0016126 "sterol biosynthetic process" evidence=RCA
GO:0042398 "cellular modified amino acid biosynthetic process" evidence=RCA
GO:0005829 "cytosol" evidence=TAS
TAIR|locus:2015519 AT1G62900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015223 AT1G63140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204695 AT1G77530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034016 AT1G51990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204680 AT1G77520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166193 AT5G37170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102038 AT3G53140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q84N28 OMT1 "Flavone O-methyltransferase 1" [Triticum aestivum (taxid:4565)] Back     alignment and assigned GO terms
TAIR|locus:2164087 AT5G53810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
pfam00891239 pfam00891, Methyltransf_2, O-methyltransferase 5e-40
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 0.002
PRK08287187 PRK08287, PRK08287, cobalt-precorrin-6Y C(15)-meth 0.003
>gnl|CDD|216177 pfam00891, Methyltransf_2, O-methyltransferase Back     alignment and domain information
 Score =  131 bits (332), Expect = 5e-40
 Identities = 44/88 (50%), Positives = 61/88 (69%), Gaps = 2/88 (2%)

Query: 1   MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIA 60
           MA  +++ MK  +       F+ + S+VDVGGGTG + A IV++YPHIKGI FDL HVIA
Sbjct: 81  MAAHSRLVMKKILETAF--DFSGLSSLVDVGGGTGALAAAIVRAYPHIKGIVFDLPHVIA 138

Query: 61  TAPTHEGVSHVGGDMFDAIPNADAVFMK 88
            AP+ + V  VGGD F+++P ADA+ +K
Sbjct: 139 DAPSADRVEFVGGDFFESVPEADAILLK 166


This family includes a range of O-methyltransferases. These enzymes utilise S-adenosyl methionine. Length = 239

>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|181354 PRK08287, PRK08287, cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 90
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 99.87
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 99.71
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.61
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 99.58
COG2890280 HemK Methylase of polypeptide chain release factor 99.55
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 99.53
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 99.48
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.47
COG2226 238 UbiE Methylase involved in ubiquinone/menaquinone 99.47
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 99.46
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.46
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.45
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.44
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.41
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.4
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.39
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.37
TIGR02752 231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.37
PF01209 233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.37
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.37
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.36
PRK15451 247 tRNA cmo(5)U34 methyltransferase; Provisional 99.36
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 99.35
PLN02233 261 ubiquinone biosynthesis methyltransferase 99.35
PLN02244 340 tocopherol O-methyltransferase 99.35
TIGR00740 239 methyltransferase, putative. A simple BLAST search 99.34
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.34
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.34
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 99.34
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.33
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.32
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.31
PRK10258 251 biotin biosynthesis protein BioC; Provisional 99.31
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 99.31
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.31
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.3
PRK11207197 tellurite resistance protein TehB; Provisional 99.3
PLN02336 475 phosphoethanolamine N-methyltransferase 99.29
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.28
PRK08317 241 hypothetical protein; Provisional 99.28
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.28
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.27
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.27
PRK05785 226 hypothetical protein; Provisional 99.27
COG4123 248 Predicted O-methyltransferase [General function pr 99.26
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 99.26
PRK11088 272 rrmA 23S rRNA methyltransferase A; Provisional 99.26
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.26
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.25
smart00650169 rADc Ribosomal RNA adenine dimethylases. 99.25
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.24
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.22
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 99.22
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 99.22
PLN02490 340 MPBQ/MSBQ methyltransferase 99.22
PRK06202232 hypothetical protein; Provisional 99.21
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.21
PRK00216 239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.21
PRK04457 262 spermidine synthase; Provisional 99.2
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.2
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 99.19
PRK07402196 precorrin-6B methylase; Provisional 99.19
PRK06922 677 hypothetical protein; Provisional 99.19
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.18
PLN02672 1082 methionine S-methyltransferase 99.17
PF07021 193 MetW: Methionine biosynthesis protein MetW; InterP 99.16
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 99.15
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.15
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.15
PHA03411 279 putative methyltransferase; Provisional 99.14
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.14
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.13
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 99.12
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.12
PHA03412 241 putative methyltransferase; Provisional 99.12
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 99.12
TIGR01934 223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.11
KOG2904328 consensus Predicted methyltransferase [General fun 99.11
PRK12335287 tellurite resistance protein TehB; Provisional 99.11
KOG1540 296 consensus Ubiquinone biosynthesis methyltransferas 99.09
PLN03075296 nicotianamine synthase; Provisional 99.09
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 99.08
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 99.08
PRK04266226 fibrillarin; Provisional 99.08
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.07
PRK14967 223 putative methyltransferase; Provisional 99.07
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.07
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.07
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.07
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.06
TIGR00452 314 methyltransferase, putative. Known examples to dat 99.06
PLN02396 322 hexaprenyldihydroxybenzoate methyltransferase 99.05
TIGR02081 194 metW methionine biosynthesis protein MetW. This pr 99.05
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.04
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.02
PLN02336 475 phosphoethanolamine N-methyltransferase 99.02
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.02
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 99.01
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 99.01
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.0
PRK14968188 putative methyltransferase; Provisional 98.99
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.97
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.97
KOG1270 282 consensus Methyltransferases [Coenzyme transport a 98.97
PRK04148134 hypothetical protein; Provisional 98.96
PRK01581 374 speE spermidine synthase; Validated 98.96
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.95
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.94
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.94
TIGR03438 301 probable methyltransferase. This model represents 98.93
PRK00811 283 spermidine synthase; Provisional 98.93
PLN02366 308 spermidine synthase 98.92
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.9
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.89
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.89
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.87
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.87
KOG1271227 consensus Methyltransferases [General function pre 98.86
PTZ00146293 fibrillarin; Provisional 98.86
PRK03612 521 spermidine synthase; Provisional 98.85
PRK14902 444 16S rRNA methyltransferase B; Provisional 98.85
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.83
TIGR00438188 rrmJ cell division protein FtsJ. 98.82
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.82
PRK11727 321 23S rRNA mA1618 methyltransferase; Provisional 98.82
PRK10901 427 16S rRNA methyltransferase B; Provisional 98.81
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.8
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 98.79
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.78
KOG1541 270 consensus Predicted protein carboxyl methylase [Ge 98.76
COG2227 243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.76
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.75
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.75
KOG0820 315 consensus Ribosomal RNA adenine dimethylase [RNA p 98.75
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.71
PRK05134 233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.7
TIGR00417 270 speE spermidine synthase. the SpeE subunit of sper 98.67
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.66
PRK14904 445 16S rRNA methyltransferase B; Provisional 98.65
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 98.64
PLN02823 336 spermine synthase 98.63
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.62
PRK14903 431 16S rRNA methyltransferase B; Provisional 98.59
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.59
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.59
TIGR00563 426 rsmB ribosomal RNA small subunit methyltransferase 98.58
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.58
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.56
PRK14901434 16S rRNA methyltransferase B; Provisional 98.56
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.55
TIGR01983 224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.54
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.53
PF00398 262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 98.53
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.51
COG0421 282 SpeE Spermidine synthase [Amino acid transport and 98.5
TIGR00446 264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.5
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.5
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 98.49
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 98.49
PLN02476278 O-methyltransferase 98.46
COG0030 259 KsgA Dimethyladenosine transferase (rRNA methylati 98.46
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.46
PF08704 247 GCD14: tRNA methyltransferase complex GCD14 subuni 98.45
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.44
KOG2899 288 consensus Predicted methyltransferase [General fun 98.44
PRK00536 262 speE spermidine synthase; Provisional 98.43
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 98.42
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 98.35
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 98.32
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.31
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.31
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 98.3
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.3
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.26
PF08003 315 Methyltransf_9: Protein of unknown function (DUF16 98.24
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.23
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.23
PF13679141 Methyltransf_32: Methyltransferase domain 98.21
COG4122219 Predicted O-methyltransferase [General function pr 98.19
COG0220 227 Predicted S-adenosylmethionine-dependent methyltra 98.18
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.14
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 98.12
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 98.11
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 98.1
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 98.1
PLN02589247 caffeoyl-CoA O-methyltransferase 98.07
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 98.06
PF04816 205 DUF633: Family of unknown function (DUF633) ; Inte 98.05
COG4262 508 Predicted spermidine synthase with an N-terminal m 98.03
COG4076 252 Predicted RNA methylase [General function predicti 98.01
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 97.98
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.96
KOG3010 261 consensus Methyltransferase [General function pred 97.96
PF02384 311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.89
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.89
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 97.81
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 97.78
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 97.74
COG2265432 TrmA SAM-dependent methyltransferases related to t 97.74
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.71
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.7
PF06080 204 DUF938: Protein of unknown function (DUF938); Inte 97.69
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 97.68
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.68
KOG2915 314 consensus tRNA(1-methyladenosine) methyltransferas 97.67
KOG2361 264 consensus Predicted methyltransferase [General fun 97.65
PRK10611287 chemotaxis methyltransferase CheR; Provisional 97.63
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 97.63
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 97.62
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.59
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.59
COG3897218 Predicted methyltransferase [General function pred 97.55
KOG4300252 consensus Predicted methyltransferase [General fun 97.53
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.53
KOG4058199 consensus Uncharacterized conserved protein [Funct 97.51
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 97.44
COG2384 226 Predicted SAM-dependent methyltransferase [General 97.43
KOG2730263 consensus Methylase [General function prediction o 97.34
KOG3115 249 consensus Methyltransferase-like protein [General 97.33
PF05219 265 DREV: DREV methyltransferase; InterPro: IPR007884 97.33
PRK10742250 putative methyltransferase; Provisional 97.2
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 97.18
TIGR03439 319 methyl_EasF probable methyltransferase domain, Eas 97.15
COG0742187 N6-adenine-specific methylase [DNA replication, re 97.14
PF04672 267 Methyltransf_19: S-adenosyl methyltransferase; Int 97.12
COG2521287 Predicted archaeal methyltransferase [General func 97.09
COG1092393 Predicted SAM-dependent methyltransferases [Genera 97.08
PF05971 299 Methyltransf_10: Protein of unknown function (DUF8 97.05
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 96.99
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 96.89
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 96.85
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 96.64
COG2520341 Predicted methyltransferase [General function pred 96.63
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 96.56
COG1565 370 Uncharacterized conserved protein [Function unknow 96.55
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 96.39
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 96.38
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 96.32
PF11968 219 DUF3321: Putative methyltransferase (DUF3321); Int 96.08
KOG1501 636 consensus Arginine N-methyltransferase [General fu 95.76
KOG1663237 consensus O-methyltransferase [Secondary metabolit 95.74
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 95.59
KOG0822 649 consensus Protein kinase inhibitor [Cell cycle con 95.53
PLN02232 160 ubiquinone biosynthesis methyltransferase 95.53
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 95.51
KOG2940 325 consensus Predicted methyltransferase [General fun 95.47
KOG1709271 consensus Guanidinoacetate methyltransferase and r 95.45
PF05206 259 TRM13: Methyltransferase TRM13; InterPro: IPR00787 95.44
COG1041347 Predicted DNA modification methylase [DNA replicat 95.41
COG0500 257 SmtA SAM-dependent methyltransferases [Secondary m 95.38
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 95.28
KOG2651 476 consensus rRNA adenine N-6-methyltransferase [RNA 95.19
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 95.16
KOG1331 293 consensus Predicted methyltransferase [General fun 95.03
COG5459 484 Predicted rRNA methylase [Translation, ribosomal s 94.91
KOG3045325 consensus Predicted RNA methylase involved in rRNA 94.9
PF02636 252 Methyltransf_28: Putative S-adenosyl-L-methionine- 94.82
KOG3924 419 consensus Putative protein methyltransferase invol 94.81
PF11599 246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 94.61
PF01861 243 DUF43: Protein of unknown function DUF43; InterPro 94.36
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 94.13
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 94.02
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 93.4
KOG1562 337 consensus Spermidine synthase [Amino acid transpor 93.38
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 93.37
COG0144 355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 93.34
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 92.72
PF04072183 LCM: Leucine carboxyl methyltransferase; InterPro: 92.5
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 92.26
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 91.77
PF03686127 UPF0146: Uncharacterised protein family (UPF0146); 91.74
KOG2918 335 consensus Carboxymethyl transferase [Posttranslati 91.69
PF02153 258 PDH: Prephenate dehydrogenase; InterPro: IPR003099 91.27
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.03
PF11312 315 DUF3115: Protein of unknown function (DUF3115); In 90.3
PF03514 374 GRAS: GRAS domain family; InterPro: IPR005202 Sequ 89.9
PF14314 675 Methyltrans_Mon: Virus-capping methyltransferase 89.86
KOG1098 780 consensus Putative SAM-dependent rRNA methyltransf 89.57
cd08283 386 FDH_like_1 Glutathione-dependent formaldehyde dehy 89.38
TIGR01470 205 cysG_Nterm siroheme synthase, N-terminal domain. T 89.23
COG1255129 Uncharacterized protein conserved in archaea [Func 89.17
PF06690 252 DUF1188: Protein of unknown function (DUF1188); In 89.02
PRK11524284 putative methyltransferase; Provisional 88.95
PF01189 283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 88.6
PF05050167 Methyltransf_21: Methyltransferase FkbM domain; In 88.56
PF12692160 Methyltransf_17: S-adenosyl-L-methionine methyltra 88.55
KOG2782 303 consensus Putative SAM dependent methyltransferase 88.06
KOG2920282 consensus Predicted methyltransferase [General fun 87.82
COG0286 489 HsdM Type I restriction-modification system methyl 87.41
PLN02668 386 indole-3-acetate carboxyl methyltransferase 87.39
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 87.33
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 87.04
KOG2666 481 consensus UDP-glucose/GDP-mannose dehydrogenase [C 86.72
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 86.64
KOG3201201 consensus Uncharacterized conserved protein [Funct 86.54
PRK13699227 putative methylase; Provisional 86.47
PRK06719157 precorrin-2 dehydrogenase; Validated 86.36
KOG3987 288 consensus Uncharacterized conserved protein DREV/C 86.2
KOG0024 354 consensus Sorbitol dehydrogenase [Secondary metabo 86.08
PF13460 183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 85.1
KOG1269 364 consensus SAM-dependent methyltransferases [Lipid 84.99
TIGR00027 260 mthyl_TIGR00027 methyltransferase, putative, TIGR0 84.43
PF03492 334 Methyltransf_7: SAM dependent carboxyl methyltrans 84.33
PRK07417 279 arogenate dehydrogenase; Reviewed 84.21
PHA01634156 hypothetical protein 83.81
PRK05562 223 precorrin-2 dehydrogenase; Provisional 83.37
PRK09496 453 trkA potassium transporter peripheral membrane com 82.94
PRK06718 202 precorrin-2 dehydrogenase; Reviewed 82.91
COG0031300 CysK Cysteine synthase [Amino acid transport and m 82.65
PRK04176 257 ribulose-1,5-biphosphate synthetase; Provisional 82.43
KOG2078 495 consensus tRNA modification enzyme [RNA processing 82.24
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 82.19
cd02190 379 epsilon_tubulin The tubulin superfamily includes f 82.02
PRK09273211 hypothetical protein; Provisional 81.03
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 80.93
PRK09496 453 trkA potassium transporter peripheral membrane com 80.55
COG2933358 Predicted SAM-dependent methyltransferase [General 80.39
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
Probab=99.87  E-value=2.6e-22  Score=132.16  Aligned_cols=87  Identities=31%  Similarity=0.659  Sum_probs=75.3

Q ss_pred             CCcchhhhH-HHHHhhcccCCCCCCCeEEEecCCchHHHHHHHHHCCCCeEEEeehHHHHHhCCCCCCeeEEEecCCCCC
Q 034578            1 MACTTKITM-KAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMFDAI   79 (90)
Q Consensus         1 m~~~~~~~~-~~~~~~~~~~~~~~~~~vlDvG~G~G~~~~~l~~~~p~~~~~~~D~p~~~~~a~~~~rv~~~~~d~~~~~   79 (90)
                      |+..++..+ +.+++.++   +++..+|||||||+|.++.++++++|+++++++|+|++++.+++.+|+++++||||+++
T Consensus        80 m~~~~~~~~~~~~~~~~d---~~~~~~vvDvGGG~G~~~~~l~~~~P~l~~~v~Dlp~v~~~~~~~~rv~~~~gd~f~~~  156 (241)
T PF00891_consen   80 MAEYSRLNAFDILLEAFD---FSGFKTVVDVGGGSGHFAIALARAYPNLRATVFDLPEVIEQAKEADRVEFVPGDFFDPL  156 (241)
T ss_dssp             HHHHHHHHHHHHHHHHST---TTTSSEEEEET-TTSHHHHHHHHHSTTSEEEEEE-HHHHCCHHHTTTEEEEES-TTTCC
T ss_pred             HHhhhhcchhhhhhcccc---ccCccEEEeccCcchHHHHHHHHHCCCCcceeeccHhhhhccccccccccccccHHhhh
Confidence            344555566 77788888   77889999999999999999999999999999999999999888999999999999989


Q ss_pred             CcccEEEeecC
Q 034578           80 PNADAVFMKVA   90 (90)
Q Consensus        80 p~~D~i~l~~v   90 (90)
                      |.+|+|+++||
T Consensus       157 P~~D~~~l~~v  167 (241)
T PF00891_consen  157 PVADVYLLRHV  167 (241)
T ss_dssp             SSESEEEEESS
T ss_pred             ccccceeeehh
Confidence            88999999987



The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. This domain includes a range of O-methyltransferases some of which utilise S-adenosyl methionine as substrate []. In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes. In eukaryotes, DNA methylation has been implicated in the control of several cellular processes, including differentiation, gene regulation, and embryonic development. O-methyltransferases have a common catalytic domain structure, which might be universal among S-adenosyl-L-methionine (AdoMet)-dependent methyltransferases []. Comparative analysis of the predicted amino acid sequences of a number of plant O-methyltransferase cDNA clones show that they share some 32-71% sequence identity, and can be grouped according to the different compounds they utilise as substrates [].; GO: 0008171 O-methyltransferase activity; PDB: 1FPQ_A 1FP1_D 3P9K_B 3P9I_D 3P9C_A 3I53_A 3I5U_A 3I64_A 3I58_A 1ZG3_A ....

>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>KOG4058 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>COG1565 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function Back     alignment and domain information
>KOG3924 consensus Putative protein methyltransferase involved in meiosis and transcriptional silencing (Dot1) [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PF04072 LCM: Leucine carboxyl methyltransferase; InterPro: IPR007213 This entry represents a group of leucine carboxymethyltransferases which methylate the carboxyl group of leucine residues to form alpha-leucine ester residues Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF03686 UPF0146: Uncharacterised protein family (UPF0146); InterPro: IPR005353 The function of this family of proteins is unknown Back     alignment and domain information
>KOG2918 consensus Carboxymethyl transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02153 PDH: Prephenate dehydrogenase; InterPro: IPR003099 Members of this family are prephenate dehydrogenases 1 Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF11312 DUF3115: Protein of unknown function (DUF3115); InterPro: IPR021463 This eukaryotic family of proteins has no known function Back     alignment and domain information
>PF03514 GRAS: GRAS domain family; InterPro: IPR005202 Sequence analysis of the products of the GRAS (GAI, RGA, SCR) gene family indicates that they share a variable N terminus and a highly conserved C terminus that contains five recognizable motifs [] Back     alignment and domain information
>PF14314 Methyltrans_Mon: Virus-capping methyltransferase Back     alignment and domain information
>KOG1098 consensus Putative SAM-dependent rRNA methyltransferase SPB1 [RNA processing and modification; General function prediction only] Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG1255 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PF06690 DUF1188: Protein of unknown function (DUF1188); InterPro: IPR009573 This family consists of several hypothetical archaeal proteins of around 260 residues in length, which seem to be specific to Methanobacterium, Methanococcus and Methanopyrus species Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF05050 Methyltransf_21: Methyltransferase FkbM domain; InterPro: IPR007744 This entry contains proteins of unknown function Back     alignment and domain information
>PF12692 Methyltransf_17: S-adenosyl-L-methionine methyltransferase; PDB: 3IHT_B Back     alignment and domain information
>KOG2782 consensus Putative SAM dependent methyltransferases [General function prediction only] Back     alignment and domain information
>KOG2920 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>KOG2666 consensus UDP-glucose/GDP-mannose dehydrogenase [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>cd02190 epsilon_tubulin The tubulin superfamily includes five distinct families, the alpha-, beta-, gamma-, delta-, and epsilon-tubulins and a sixth family (zeta-tubulin) which is present only in kinetoplastid protozoa Back     alignment and domain information
>PRK09273 hypothetical protein; Provisional Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
1kyw_A365 Crystal Structure Analysis Of Caffeic Acid5-Hydroxy 8e-24
3reo_A368 Monolignol O-Methyltransferase (Momt) Length = 368 3e-21
1fp1_D372 Crystal Structure Analysis Of Chalcone O-Methyltran 4e-18
3p9c_A364 Crystal Structure Of Perennial Ryegrass Lpomt1 Boun 4e-18
1fpq_A372 Crystal Structure Analysis Of Selenomethionine Subs 6e-17
1fp2_A352 Crystal Structure Analysis Of Isoflavone O-Methyltr 1e-13
1fpx_A352 Crystal Structure Analysis Of Selenomethionine Subs 9e-13
2qyo_A357 Crystal Structure Of Isoflavone O-Methyltransferase 4e-10
1zg3_A358 Crystal Structure Of The Isoflavanone 4'-O-Methyltr 2e-07
1zga_A357 Crystal Structure Of Isoflavanone 4'-o-methyltransf 2e-07
1zgj_A354 Crystal Structure Of Isoflavanone 4'-O-Methyltransf 2e-07
2ip2_A334 Structure Of The Pyocyanin Biosynthetic Protein Phz 9e-06
1qzz_A 374 Crystal Structure Of Aclacinomycin-10-Hydroxylase ( 2e-04
4a6d_A353 Crystal Structure Of Human N-Acetylserotonin Methyl 2e-04
>pdb|1KYW|A Chain A, Crystal Structure Analysis Of Caffeic Acid5-Hydroxyferulic Acid 35-O-Methyltransferase In Complex With 5- Hydroxyconiferaldehyde Length = 365 Back     alignment and structure

Iteration: 1

Score = 105 bits (261), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 53/88 (60%), Positives = 63/88 (71%), Gaps = 2/88 (2%) Query: 1 MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIA 60 M+ + ITMK + Y GF ++S+VDVGGGTG V+ IV YP IKGINFDL HVI Sbjct: 180 MSDHSTITMKKILETYT--GFEGLKSLVDVGGGTGAVINTIVSKYPTIKGINFDLPHVIE 237 Query: 61 TAPTHEGVSHVGGDMFDAIPNADAVFMK 88 AP++ GV HVGGDMF +IP ADAVFMK Sbjct: 238 DAPSYPGVEHVGGDMFVSIPKADAVFMK 265
>pdb|3REO|A Chain A, Monolignol O-Methyltransferase (Momt) Length = 368 Back     alignment and structure
>pdb|1FP1|D Chain D, Crystal Structure Analysis Of Chalcone O-Methyltransferase Length = 372 Back     alignment and structure
>pdb|3P9C|A Chain A, Crystal Structure Of Perennial Ryegrass Lpomt1 Bound To Sah Length = 364 Back     alignment and structure
>pdb|1FPQ|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Chalcone O- Methyltransferase Length = 372 Back     alignment and structure
>pdb|1FP2|A Chain A, Crystal Structure Analysis Of Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure
>pdb|1FPX|A Chain A, Crystal Structure Analysis Of Selenomethionine Substituted Isoflavone O-Methyltransferase Length = 352 Back     alignment and structure
>pdb|2QYO|A Chain A, Crystal Structure Of Isoflavone O-Methyltransferase Homolog In Complex With Biochanin A And Sah Length = 357 Back     alignment and structure
>pdb|1ZG3|A Chain A, Crystal Structure Of The Isoflavanone 4'-O-Methyltransferase Complexed With Sah And 2,7,4'-Trihydroxyisoflavanone Length = 358 Back     alignment and structure
>pdb|1ZGA|A Chain A, Crystal Structure Of Isoflavanone 4'-o-methyltransferase Complexed With (+)-6a-hydroxymaackiain Length = 357 Back     alignment and structure
>pdb|1ZGJ|A Chain A, Crystal Structure Of Isoflavanone 4'-O-Methyltransferase Complexed With (+)-Pisatin Length = 354 Back     alignment and structure
>pdb|2IP2|A Chain A, Structure Of The Pyocyanin Biosynthetic Protein Phzm Length = 334 Back     alignment and structure
>pdb|1QZZ|A Chain A, Crystal Structure Of Aclacinomycin-10-Hydroxylase (Rdmb) In Complex With S-Adensyl-L-Methionine (Sam) Length = 374 Back     alignment and structure
>pdb|4A6D|A Chain A, Crystal Structure Of Human N-Acetylserotonin Methyltransferase (Asmt) In Complex With Sam Length = 353 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 9e-37
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 6e-36
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 7e-36
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 2e-35
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 5e-35
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 2e-34
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 2e-34
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 1e-33
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 1e-33
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 9e-33
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 3e-31
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 2e-30
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 1e-26
2r3s_A335 Uncharacterized protein; methyltransferase domain, 3e-26
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 2e-23
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Length = 352 Back     alignment and structure
 Score =  125 bits (315), Expect = 9e-37
 Identities = 36/88 (40%), Positives = 51/88 (57%), Gaps = 2/88 (2%)

Query: 1   MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIA 60
           MA  +K+   A         F+ + S+VDVGGGTGT    I +++P +K I FD   V+ 
Sbjct: 168 MASDSKLINLALRDCD--FVFDGLESIVDVGGGTGTTAKIICETFPKLKCIVFDRPQVVE 225

Query: 61  TAPTHEGVSHVGGDMFDAIPNADAVFMK 88
                  +++VGGDMF +IPNADAV +K
Sbjct: 226 NLSGSNNLTYVGGDMFTSIPNADAVLLK 253


>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Length = 364 Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 1kyz_A* 1kyw_A* Length = 368 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Length = 348 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Length = 372 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Length = 360 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Length = 332 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Length = 369 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Length = 374 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Length = 358 Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Length = 359 Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Length = 334 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Length = 352 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Length = 335 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Length = 363 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 99.82
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 99.78
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 99.78
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 99.73
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 99.73
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 99.71
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 99.71
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 99.71
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.7
1qzz_A 374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 99.66
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 99.66
1tw3_A 360 COMT, carminomycin 4-O-methyltransferase; anthracy 99.64
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.64
3dp7_A 363 SAM-dependent methyltransferase; structural genomi 99.62
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.61
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 99.6
4gek_A 261 TRNA (CMO5U34)-methyltransferase; structural genom 99.57
3ege_A 261 Putative methyltransferase from antibiotic biosyn 99.53
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 99.51
3dtn_A 234 Putative methyltransferase MM_2633; structural gen 99.5
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 99.5
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 99.48
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 99.48
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.47
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.47
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.46
3f4k_A 257 Putative methyltransferase; structural genomics, P 99.46
3jwg_A 219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.45
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 99.45
3kr9_A 225 SAM-dependent methyltransferase; class I rossmann- 99.45
3jwh_A 217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.45
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 99.44
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.44
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 99.44
3g07_A 292 7SK snRNA methylphosphate capping enzyme; structur 99.44
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 99.43
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 99.42
3dh0_A 219 SAM dependent methyltransferase; cystal structure, 99.41
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.41
3lec_A 230 NADB-rossmann superfamily protein; PSI, MCSG, stru 99.41
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 99.41
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.4
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.4
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.4
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.4
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.4
1ve3_A 227 Hypothetical protein PH0226; dimer, riken structur 99.39
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.39
1xxl_A 239 YCGJ protein; structural genomics, protein structu 99.39
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.39
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.39
3ou2_A 218 SAM-dependent methyltransferase; O-methyltransfera 99.38
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.38
4dzr_A 215 Protein-(glutamine-N5) methyltransferase, release 99.37
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 99.37
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.37
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 99.37
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.36
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.36
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.36
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.35
2h00_A 254 Methyltransferase 10 domain containing protein; st 99.35
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.34
3l8d_A 242 Methyltransferase; structural genomics, PSI, nysgr 99.34
3hnr_A 220 Probable methyltransferase BT9727_4108; structural 99.34
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.34
3dxy_A 218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.33
2p7i_A 250 Hypothetical protein; putative methyltransferase, 99.33
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.33
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.32
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.32
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.32
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.32
3mq2_A 218 16S rRNA methyltransferase; methyltranferase, ribo 99.31
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.31
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.31
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.31
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.31
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.31
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.3
3ggd_A 245 SAM-dependent methyltransferase; YP_325210.1, stru 99.3
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 99.3
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.3
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.3
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.3
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 99.3
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 99.3
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.3
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.3
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.29
2ozv_A 260 Hypothetical protein ATU0636; structural genomics, 99.29
3m33_A 226 Uncharacterized protein; structural genomics, PSI- 99.29
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.29
2qe6_A 274 Uncharacterized protein TFU_2867; putative methylt 99.29
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.29
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.28
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.28
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.28
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.28
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 99.27
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.27
3ocj_A 305 Putative exported protein; structural genomics, PS 99.27
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 99.27
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.27
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.27
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.27
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 99.26
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.26
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.26
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 99.26
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.25
3ckk_A 235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.25
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 99.25
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 99.25
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.24
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.24
1o9g_A 250 RRNA methyltransferase; antibiotic resistance, Se- 99.24
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.24
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.24
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.24
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.24
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.24
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.24
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.24
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; R 99.23
3lpm_A 259 Putative methyltransferase; structural genomics, p 99.23
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 99.23
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 99.23
2plw_A 201 Ribosomal RNA methyltransferase, putative; malaria 99.23
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 99.23
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 99.23
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 99.23
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.23
3lcc_A235 Putative methyl chloride transferase; halide methy 99.23
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.22
3e8s_A 227 Putative SAM dependent methyltransferase; NP_74470 99.22
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.22
3sm3_A 235 SAM-dependent methyltransferases; NESG, structural 99.22
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 99.22
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.22
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 99.22
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.22
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.22
3adn_A 294 Spermidine synthase; aminopropyltransferase, polya 99.22
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.21
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 99.21
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 99.21
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.2
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.2
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.2
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.2
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 99.2
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.2
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.2
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.2
3tfw_A 248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.19
2b25_A 336 Hypothetical protein; structural genomics, methyl 99.19
1u2z_A 433 Histone-lysine N-methyltransferase, H3 lysine-79 s 99.19
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.19
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.18
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.18
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.18
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.18
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.17
2p8j_A 209 S-adenosylmethionine-dependent methyltransferase; 99.17
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 99.17
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 99.17
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 99.17
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 99.17
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.16
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.16
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 99.16
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.16
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 99.16
2vdv_E 246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.16
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.16
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 99.16
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.15
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 99.15
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.15
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.14
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.14
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 99.14
3cc8_A 230 Putative methyltransferase; structural genomics, j 99.14
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 99.13
2gs9_A 211 Hypothetical protein TT1324; methyl transferase, s 99.13
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.13
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.13
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.13
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 99.12
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.12
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.12
2hnk_A 239 SAM-dependent O-methyltransferase; modified rossma 99.12
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.11
3p2e_A 225 16S rRNA methylase; methyltransferase, transferase 99.11
1iy9_A 275 Spermidine synthase; rossmann fold, structural gen 99.11
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.1
1xj5_A 334 Spermidine synthase 1; structural genomics, protei 99.1
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 99.09
2pt6_A 321 Spermidine synthase; transferase, structural genom 99.09
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.09
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.09
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.09
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.09
2qm3_A 373 Predicted methyltransferase; putative methyltransf 99.07
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 99.07
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 99.07
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.07
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 99.07
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 99.06
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.06
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.05
2cmg_A 262 Spermidine synthase; transferase, putrescine amino 99.05
1inl_A 296 Spermidine synthase; beta-barrel, rossman fold, st 99.05
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 99.04
2o07_A 304 Spermidine synthase; structural genomics, structur 99.03
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.03
1mjf_A 281 Spermidine synthase; spermidine synthetase, struct 99.03
3bwc_A 304 Spermidine synthase; SAM, SGPP, structura genomics 99.03
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 99.02
3bzb_A 281 Uncharacterized protein; RED ALGA, protein structu 99.0
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.0
2b2c_A 314 Spermidine synthase; beta-alpha, transferase; 2.50 99.0
2i7c_A 283 Spermidine synthase; transferase, structural genom 98.99
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.99
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.99
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.97
2oxt_A 265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.97
2wa2_A 276 Non-structural protein 5; transferase, S-adenosyl- 98.97
1ixk_A 315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.96
1vlm_A 219 SAM-dependent methyltransferase; possible histamin 98.95
3k6r_A278 Putative transferase PH0793; structural genomics, 98.95
3ajd_A 274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.93
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.92
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.92
2f8l_A 344 Hypothetical protein LMO1582; structural genomics, 98.89
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.89
2g72_A 289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.89
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.89
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.87
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 98.86
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.85
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.84
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.83
3sso_A 419 Methyltransferase; macrolide, natural product, ros 98.83
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.83
3opn_A 232 Putative hemolysin; structural genomics, PSI-2, pr 98.83
2yxl_A 450 PH0851 protein, 450AA long hypothetical FMU protei 98.81
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.8
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 98.79
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.77
1sqg_A 429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.76
3o4f_A 294 Spermidine synthase; aminopropyltransferase, polya 98.74
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 98.72
3ll7_A 410 Putative methyltransferase; methytransferase, stru 98.72
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 98.71
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.71
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.7
3giw_A 277 Protein of unknown function DUF574; rossmann-fold 98.7
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.7
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 98.69
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.69
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.68
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.68
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.66
2b9e_A 309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 98.66
4dmg_A 393 Putative uncharacterized protein TTHA1493; rRNA, m 98.65
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.64
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.56
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.56
1wg8_A 285 Predicted S-adenosylmethionine-dependent methyltra 98.43
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.41
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 98.41
4gqb_A 637 Protein arginine N-methyltransferase 5; TIM barrel 98.39
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 98.26
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.22
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 98.18
3khk_A 544 Type I restriction-modification system methylation 98.15
3lkd_A 542 Type I restriction-modification system methyltrans 98.14
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 98.12
3p8z_A 267 Mtase, non-structural protein 5; methyltransferase 98.09
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.07
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 97.93
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 97.91
2zig_A297 TTHA0409, putative modification methylase; methylt 97.9
3gcz_A 282 Polyprotein; flavivirus, RNA capping, methyltransf 97.9
3evf_A 277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.84
2ld4_A 176 Anamorsin; methyltransferase-like fold, alpha/beta 97.75
3lkz_A 321 Non-structural protein 5; flavivirus, methyltransf 97.73
2px2_A 269 Genome polyprotein [contains: capsid protein C (co 97.53
2qy6_A 257 UPF0209 protein YFCK; structural genomics, unknown 97.45
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 97.38
3cvo_A202 Methyltransferase-like protein of unknown functio; 97.29
3ufb_A 530 Type I restriction-modification system methyltran 97.1
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 97.06
3eld_A 300 Methyltransferase; flavivirus, RNA capping, guanyl 96.66
1zkd_A 387 DUF185; NESG, RPR58, structural genomics, PSI, pro 96.47
1rjd_A 334 PPM1P, carboxy methyl transferase for protein phos 96.43
2py6_A 409 Methyltransferase FKBM; YP_546752.1, structural ge 96.4
4fzv_A 359 Putative methyltransferase NSUN4; mterf fold, meth 96.37
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 96.23
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 96.04
2oo3_A 283 Protein involved in catabolism of external DNA; st 95.71
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 95.18
3r24_A 344 NSP16, 2'-O-methyl transferase; methyltransferase, 94.89
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 94.38
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 94.27
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 94.09
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 93.36
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 93.09
2uyo_A 310 Hypothetical protein ML2640; putative methyltransf 92.87
4f3n_A 432 Uncharacterized ACR, COG1565 superfamily; structur 92.58
3iht_A174 S-adenosyl-L-methionine methyl transferase; YP_165 92.19
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 92.0
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 90.8
3qv2_A 327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 90.51
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 90.32
3l4b_C 218 TRKA K+ channel protien TM1088B; potassium channel 89.31
4h0n_A 333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 89.28
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 89.03
2qrv_A 295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 88.66
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 88.1
3ubt_Y 331 Modification methylase HAEIII; protein-DNA complex 88.04
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 87.95
3iei_A 334 Leucine carboxyl methyltransferase 1; LCMT-1, S-ad 87.48
2aef_A 234 Calcium-gated potassium channel MTHK; rossmann fol 87.39
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 87.3
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 87.11
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 86.91
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 86.1
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 85.9
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 85.68
3dqp_A 219 Oxidoreductase YLBE; alpha-beta protein., structur 85.67
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 85.63
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 85.31
3h2s_A 224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 85.08
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 84.95
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 84.87
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 84.83
4g65_A 461 TRK system potassium uptake protein TRKA; structur 84.36
1lss_A140 TRK system potassium uptake protein TRKA homolog; 84.01
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 83.23
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 82.51
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 81.96
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 81.54
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 81.54
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 81.48
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 80.81
3ew7_A 221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 80.5
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 80.37
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
Probab=99.82  E-value=3.2e-20  Score=126.96  Aligned_cols=87  Identities=25%  Similarity=0.464  Sum_probs=76.7

Q ss_pred             CCcchhhhHHHHHhhcccCCCCCCCeEEEecCCchHHHHHHHHHCCCCeEEEeehHHHHHhCCC------CCCeeEEEec
Q 034578            1 MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPT------HEGVSHVGGD   74 (90)
Q Consensus         1 m~~~~~~~~~~~~~~~~~~~~~~~~~vlDvG~G~G~~~~~l~~~~p~~~~~~~D~p~~~~~a~~------~~rv~~~~~d   74 (90)
                      |++.+...++.+++.++   +++..+|||||||+|.++..+++++|+++++++|+|++++.+++      .+|++++.+|
T Consensus       160 M~~~~~~~~~~~~~~~~---~~~~~~v~DvGgG~G~~~~~l~~~~p~~~~~~~dlp~v~~~a~~~~~~~~~~rv~~~~gD  236 (353)
T 4a6d_A          160 LQEVWSVNGRSVLTAFD---LSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGD  236 (353)
T ss_dssp             HHTTHHHHHHHHHHSSC---GGGCSEEEEETCTTSHHHHHHHHHCSSCEEEEEECHHHHHHHHHHSCC--CCSEEEEESC
T ss_pred             HHHHHHHHHHHHHHhcC---cccCCeEEeeCCCCCHHHHHHHHhCCCceeEeccCHHHHHHHHHhhhhcccCceeeecCc
Confidence            44566677888999998   67788999999999999999999999999999999999988764      4899999999


Q ss_pred             CCC-CCCcccEEEeecC
Q 034578           75 MFD-AIPNADAVFMKVA   90 (90)
Q Consensus        75 ~~~-~~p~~D~i~l~~v   90 (90)
                      ||+ +.|++|+|++++|
T Consensus       237 ~~~~~~~~~D~~~~~~v  253 (353)
T 4a6d_A          237 FFKDPLPEADLYILARV  253 (353)
T ss_dssp             TTTSCCCCCSEEEEESS
T ss_pred             cccCCCCCceEEEeeee
Confidence            998 4667999999986



>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>1zkd_A DUF185; NESG, RPR58, structural genomics, PSI, protein structure INI northeast structural genomics consortium, unknown function; 2.10A {Rhodopseudomonas palustris} SCOP: c.66.1.52 Back     alignment and structure
>1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* Back     alignment and structure
>4f3n_A Uncharacterized ACR, COG1565 superfamily; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.75A {Burkholderia thailandensis} PDB: 4g67_A* Back     alignment and structure
>3iht_A S-adenosyl-L-methionine methyl transferase; YP_165822.1, STR genomics, joint center for structural genomics, JCSG; HET: MSE SAM; 1.80A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3iei_A Leucine carboxyl methyltransferase 1; LCMT-1, S-adenosyl-L-methionine; HET: SAH MES; 1.90A {Homo sapiens} PDB: 3p71_T* 3mnt_A* 3o7w_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 90
d1fp1d2244 c.66.1.12 (D:129-372) Chalcone O-methyltransferase 3e-21
d1fp2a2244 c.66.1.12 (A:109-352) Isoflavone O-methyltransfera 3e-21
d1kyza2243 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferuli 1e-17
d1qzza2 256 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase 5e-06
d1tw3a2 253 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransf 2e-05
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Chalcone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]
 Score = 81.7 bits (201), Expect = 3e-21
 Identities = 42/88 (47%), Positives = 52/88 (59%), Gaps = 2/88 (2%)

Query: 1   MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIA 60
           M       MK  +  Y   GF  I ++VDVGGG+G  L  I+  YP IKGINFDL  VI 
Sbjct: 61  MVDVCATEMKRMLEIY--TGFEGISTLVDVGGGSGRNLELIISKYPLIKGINFDLPQVIE 118

Query: 61  TAPTHEGVSHVGGDMFDAIPNADAVFMK 88
            AP   G+ HVGGDMF ++P  DA+ +K
Sbjct: 119 NAPPLSGIEHVGGDMFASVPQGDAMILK 146


>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 244 Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Length = 243 Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Length = 256 Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Length = 253 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 99.88
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 99.85
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 99.85
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.84
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.83
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.6
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.58
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 99.57
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.55
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.55
d1p91a_ 268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.51
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.48
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.48
d1im8a_ 225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.48
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.47
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.46
d1ve3a1 226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.43
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.42
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.41
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.41
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.4
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 99.36
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 99.35
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.35
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 99.33
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.32
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.31
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.31
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.29
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.28
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.26
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.25
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.22
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.22
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.21
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.2
d1vlma_ 208 Possible histamine N-methyltransferase TM1293 {The 99.2
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.2
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.19
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.19
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.18
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.17
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.17
d2h00a1 250 Methyltransferase 10 domain containing protein MET 99.17
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 99.17
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.16
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.16
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 99.12
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.09
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.09
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.07
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 99.07
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 99.06
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.05
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 99.03
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 99.02
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.02
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.98
d1qama_ 235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.98
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.95
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 98.9
d1yuba_ 245 rRNA adenine dimethylase {Streptococcus pneumoniae 98.88
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.76
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.75
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 98.72
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.68
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.66
d1iy9a_ 274 Spermidine synthase {Bacillus subtilis [TaxId: 142 98.66
d1inla_ 295 Spermidine synthase {Thermotoga maritima [TaxId: 2 98.63
d2o07a1 285 Spermidine synthase {Human (Homo sapiens) [TaxId: 98.62
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.6
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.54
d2f8la1 328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.53
d2b2ca1 312 Spermidine synthase {Caenorhabditis elegans [TaxId 98.52
d1xj5a_ 290 Spermidine synthase {Thale cress (Arabidopsis thal 98.52
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 98.5
d1zq9a1 278 Probable dimethyladenosine transferase {Human (Hom 98.49
d2ih2a1 223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.49
d1mjfa_ 276 Putative spermidine synthetase PF0127 (SpeE) {Arch 98.48
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.44
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.42
d1qyra_ 252 High level kasugamycin resistance protein KsgA {Es 98.35
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.34
d2a14a1 257 Indolethylamine N-methyltransferase, INMT {Human ( 98.34
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.18
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.13
d2g72a1 263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.07
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 98.05
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.04
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.93
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.87
d1i4wa_ 322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 97.79
d2okca1 425 Type I restriction enzyme StySJI M protein {Bacter 97.66
d2p41a1 257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.46
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 96.94
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 96.78
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 96.48
d2b9ea1 293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 96.41
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 96.25
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.19
d1sqga2 284 Ribosomal RNA small subunit methyltransferase B, R 96.19
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.11
d1zkda1 365 Hypothetical protein RPA4359 {Rhodopseudomonas pal 95.93
d1ixka_ 313 Hypothetical methyltransferase PH1374 {Archaeon Py 95.66
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.39
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.48
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 93.63
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.99
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.77
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.75
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 92.55
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 92.52
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 92.04
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 91.92
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.91
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.88
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 91.63
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 91.28
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 91.09
d1rjda_ 328 Leucine carboxy methyltransferase Ppm1 {Baker's ye 91.01
d2py6a1 395 Methyltransferase FkbM {Methylobacillus flagellatu 90.48
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 90.16
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.71
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 89.32
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 89.28
d1o9ga_ 249 rRNA methyltransferase AviRa {Streptomyces viridoc 88.53
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 88.48
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 88.04
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 87.62
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.21
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 87.01
d1fcda1 186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 86.72
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 86.48
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 86.46
d1id1a_153 Rck domain from putative potassium channel Kch {Es 85.54
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 85.54
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 85.15
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 84.56
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 83.78
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 82.98
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 82.29
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 82.26
d2uyoa1 297 Putative methyltransferase ML2640 {Mycobacterium l 81.81
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 81.34
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 81.26
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 81.18
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 80.87
d1bg6a2 184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 80.85
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 80.65
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Plant O-methyltransferase, C-terminal domain
domain: Chalcone O-methyltransferase
species: Alfalfa (Medicago sativa) [TaxId: 3879]
Probab=99.88  E-value=7.3e-23  Score=133.16  Aligned_cols=88  Identities=47%  Similarity=0.832  Sum_probs=81.9

Q ss_pred             CCcchhhhHHHHHhhcccCCCCCCCeEEEecCCchHHHHHHHHHCCCCeEEEeehHHHHHhCCCCCCeeEEEecCCCCCC
Q 034578            1 MACTTKITMKAFVSHYKVDGFNNIRSMVDVGGGTGTVLAEIVKSYPHIKGINFDLQHVIATAPTHEGVSHVGGDMFDAIP   80 (90)
Q Consensus         1 m~~~~~~~~~~~~~~~~~~~~~~~~~vlDvG~G~G~~~~~l~~~~p~~~~~~~D~p~~~~~a~~~~rv~~~~~d~~~~~p   80 (90)
                      |++.+...++.+++.++.  +++..+|||||||+|.++.++++++|+++++++|+|++++.+...+|++++.+||++++|
T Consensus        61 M~~~s~~~~~~l~~~~~~--f~~~~~vlDiGGG~G~~~~~l~~~~P~l~~~v~Dlp~vi~~~~~~~ri~~~~gd~~~~~p  138 (244)
T d1fp1d2          61 MVDVCATEMKRMLEIYTG--FEGISTLVDVGGGSGRNLELIISKYPLIKGINFDLPQVIENAPPLSGIEHVGGDMFASVP  138 (244)
T ss_dssp             HHHHHHHHHHHHHHHCCT--TTTCSEEEEETCTTSHHHHHHHHHCTTCEEEEEECHHHHTTCCCCTTEEEEECCTTTCCC
T ss_pred             HHHHHHHHHHHHHHhccc--ccCCcEEEEecCCCcHHHHHHHHHCCCCeEEEecchhhhhccCCCCCeEEecCCcccccc
Confidence            566778888999999984  788899999999999999999999999999999999999998889999999999999999


Q ss_pred             cccEEEeecC
Q 034578           81 NADAVFMKVA   90 (90)
Q Consensus        81 ~~D~i~l~~v   90 (90)
                      .+|+|++++|
T Consensus       139 ~~D~~~l~~v  148 (244)
T d1fp1d2         139 QGDAMILKAV  148 (244)
T ss_dssp             CEEEEEEESS
T ss_pred             cceEEEEehh
Confidence            9999999986



>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rjda_ c.66.1.37 (A:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure