Citrus Sinensis ID: 034673

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MDPEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPNYKNTGNNCIGILADAPRLMKNLKL
ccHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHccccc
ccHHHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHccc
MDPEQNKKFERALAvydkdtpdRWQNVAravgggkspddvKRHYDRLVEDLIFIEsaqfplpnykntgnncigiLADAPRLMKNLKL
mdpeqnkkFERAlavydkdtpdrWQNVaravgggkspddvKRHYDRLVEDLIFIESAqfplpnykntgnNCIGILADAPRLMKNLKL
MDPEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPNYKNTGNNCIGILADAPRLMKNLKL
**************VY*******WQNVARA*********VKRHYDRLVEDLIFIESAQFPLPNYKNTGNNCIGILADA*********
*DPEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPNYK***************LMK****
********FERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPNYKNTGNNCIGILADAPRLMKNLKL
MDPEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPNYKN*********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPNYKNTGNNCIGILADAPRLMKNLKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
Q1A17397 Protein RADIALIS-like 6 O yes no 0.942 0.845 0.662 5e-23
Q8GW75100 Protein RADIALIS-like 5 O no no 0.954 0.83 0.627 3e-21
Q9SIJ5101 Protein RADIALIS-like 2 O no no 0.954 0.821 0.588 5e-21
Q58FS393 Transcription factor RADI N/A no 0.908 0.849 0.583 1e-20
F4JVB8100 Protein RADIALIS-like 1 O no no 0.954 0.83 0.511 5e-20
Q6NNN081 Protein RADIALIS-like 3 O no no 0.758 0.814 0.626 2e-18
Q1G3C477 Protein RADIALIS-like 4 O no no 0.712 0.805 0.603 2e-15
Q8S9H7 307 Transcription factor DIVA N/A no 0.712 0.201 0.460 4e-09
>sp|Q1A173|RADL6_ARATH Protein RADIALIS-like 6 OS=Arabidopsis thaliana GN=RL6 PE=2 SV=1 Back     alignment and function desciption
 Score =  106 bits (264), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 63/83 (75%), Gaps = 1/83 (1%)

Query: 5  QNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPNY 64
          QNK FERALAVYDKDTPDRW NVA+AVGG K+ ++VKRHYD LVEDLI IE+ + PLPNY
Sbjct: 16 QNKMFERALAVYDKDTPDRWHNVAKAVGG-KTVEEVKRHYDILVEDLINIETGRVPLPNY 74

Query: 65 KNTGNNCIGILADAPRLMKNLKL 87
          K   +N   I     R MKNLK+
Sbjct: 75 KTFESNSRSINDFDTRKMKNLKI 97
Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8GW75|RADL5_ARATH Protein RADIALIS-like 5 OS=Arabidopsis thaliana GN=RL5 PE=3 SV=1 Back     alignment and function description
>sp|Q9SIJ5|RADL2_ARATH Protein RADIALIS-like 2 OS=Arabidopsis thaliana GN=RL2 PE=2 SV=1 Back     alignment and function description
>sp|Q58FS3|RAD_ANTMA Transcription factor RADIALIS OS=Antirrhinum majus GN=RAD PE=1 SV=1 Back     alignment and function description
>sp|F4JVB8|RADL1_ARATH Protein RADIALIS-like 1 OS=Arabidopsis thaliana GN=RL1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NNN0|RADL3_ARATH Protein RADIALIS-like 3 OS=Arabidopsis thaliana GN=RL3 PE=2 SV=1 Back     alignment and function description
>sp|Q1G3C4|RADL4_ARATH Protein RADIALIS-like 4 OS=Arabidopsis thaliana GN=RL4 PE=2 SV=1 Back     alignment and function description
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
22406212399 predicted protein [Populus trichocarpa] 0.942 0.828 0.726 1e-26
25553867294 DNA binding protein, putative [Ricinus c 0.816 0.755 0.805 8e-25
35947534696 PREDICTED: uncharacterized protein LOC10 0.931 0.843 0.642 2e-22
22408567882 predicted protein [Populus trichocarpa] 0.770 0.817 0.764 3e-22
255536847107 DNA binding protein, putative [Ricinus c 0.816 0.663 0.641 1e-21
356544482100 PREDICTED: uncharacterized protein LOC10 0.942 0.82 0.635 2e-21
22407783899 predicted protein [Populus trichocarpa] 0.942 0.828 0.607 2e-21
14532724797 RAD-like 6 protein [Arabidopsis thaliana 0.942 0.845 0.662 2e-21
29784227195 myb family transcription factor [Arabido 0.919 0.842 0.666 6e-21
449462230101 PREDICTED: transcription factor RADIALIS 0.977 0.841 0.579 9e-21
>gi|224062123|ref|XP_002300766.1| predicted protein [Populus trichocarpa] gi|222842492|gb|EEE80039.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  124 bits (310), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/84 (72%), Positives = 72/84 (85%), Gaps = 2/84 (2%)

Query: 4  EQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPN 63
          +QNK FE+ALAVYDKDTPDRWQNVA+AVGG KSP++VKRHYDRLVEDL++IES Q PLPN
Sbjct: 17 KQNKLFEKALAVYDKDTPDRWQNVAKAVGG-KSPEEVKRHYDRLVEDLVYIESGQAPLPN 75

Query: 64 YKNTGNNCIGILADAPRLMKNLKL 87
          YK +G+N  G L +  RL +NLKL
Sbjct: 76 YKPSGSNGRG-LVEEQRLTRNLKL 98

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255538672|ref|XP_002510401.1| DNA binding protein, putative [Ricinus communis] gi|223551102|gb|EEF52588.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359475346|ref|XP_003631666.1| PREDICTED: uncharacterized protein LOC100853961 [Vitis vinifera] gi|297741469|emb|CBI32600.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224085678|ref|XP_002307660.1| predicted protein [Populus trichocarpa] gi|222857109|gb|EEE94656.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255536847|ref|XP_002509490.1| DNA binding protein, putative [Ricinus communis] gi|223549389|gb|EEF50877.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356544482|ref|XP_003540679.1| PREDICTED: uncharacterized protein LOC100785292 [Glycine max] Back     alignment and taxonomy information
>gi|224077838|ref|XP_002305430.1| predicted protein [Populus trichocarpa] gi|222848394|gb|EEE85941.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|145327247|ref|NP_001077825.1| RAD-like 6 protein [Arabidopsis thaliana] gi|122177743|sp|Q1A173.1|RADL6_ARATH RecName: Full=Protein RADIALIS-like 6; Short=AtRL6; Short=Protein RAD-like 6; AltName: Full=Protein RADIALIS-LIKE SANT/MYB 3; Short=Protein RSM3 gi|87133603|gb|ABD24442.1| RAD-like protein 6 [Arabidopsis thaliana] gi|332197573|gb|AEE35694.1| RAD-like 6 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297842271|ref|XP_002889017.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata] gi|297334858|gb|EFH65276.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449462230|ref|XP_004148844.1| PREDICTED: transcription factor RADIALIS-like [Cucumis sativus] gi|449507322|ref|XP_004162999.1| PREDICTED: transcription factor RADIALIS-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
TAIR|locus:202518297 RL6 "RAD-like 6" [Arabidopsis 0.942 0.845 0.662 7.8e-23
TAIR|locus:2016417100 RL5 "RAD-like 5" [Arabidopsis 0.954 0.83 0.627 1.9e-21
TAIR|locus:2049374101 MEE3 "MATERNAL EFFECT EMBRYO A 0.954 0.821 0.588 3e-21
UNIPROTKB|Q58FS393 RAD "Transcription factor RADI 0.908 0.849 0.583 3.9e-21
TAIR|locus:2136283100 RL1 "RAD-like 1" [Arabidopsis 0.954 0.83 0.511 1.5e-19
TAIR|locus:211526081 RL3 "RAD-like 3" [Arabidopsis 0.758 0.814 0.626 1.9e-19
TAIR|locus:401071363177 RL4 "RAD-like 4" [Arabidopsis 0.712 0.805 0.603 8.6e-17
TAIR|locus:2166459 277 AT5G05790 [Arabidopsis thalian 0.712 0.223 0.555 4.3e-13
TAIR|locus:2042872 298 AT2G38090 [Arabidopsis thalian 0.689 0.201 0.557 6.9e-12
TAIR|locus:2074723 263 AT3G11280 [Arabidopsis thalian 0.689 0.228 0.491 3.3e-11
TAIR|locus:2025182 RL6 "RAD-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 264 (98.0 bits), Expect = 7.8e-23, P = 7.8e-23
 Identities = 55/83 (66%), Positives = 63/83 (75%)

Query:     5 QNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPNY 64
             QNK FERALAVYDKDTPDRW NVA+AVGG K+ ++VKRHYD LVEDLI IE+ + PLPNY
Sbjct:    16 QNKMFERALAVYDKDTPDRWHNVAKAVGG-KTVEEVKRHYDILVEDLINIETGRVPLPNY 74

Query:    65 KNTGNNCIGILADAPRLMKNLKL 87
             K   +N   I     R MKNLK+
Sbjct:    75 KTFESNSRSINDFDTRKMKNLKI 97
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0009507 "chloroplast" evidence=ISM
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2016417 RL5 "RAD-like 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049374 MEE3 "MATERNAL EFFECT EMBRYO ARREST 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q58FS3 RAD "Transcription factor RADIALIS" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2136283 RL1 "RAD-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2115260 RL3 "RAD-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713631 RL4 "RAD-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166459 AT5G05790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2074723 AT3G11280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58FS3RAD_ANTMANo assigned EC number0.58330.90800.8494N/Ano
Q1A173RADL6_ARATHNo assigned EC number0.66260.94250.8453yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00020323
hypothetical protein (99 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.16
KOG0724 335 consensus Zuotin and related molecular chaperones 99.03
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.88
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.84
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.0
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.2
PLN03212249 Transcription repressor MYB5; Provisional 97.1
PLN03212 249 Transcription repressor MYB5; Provisional 96.98
PLN03091 459 hypothetical protein; Provisional 96.85
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.64
KOG4167 907 consensus Predicted DNA-binding protein, contains 96.64
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 96.54
PLN03091 459 hypothetical protein; Provisional 96.49
KOG0048238 consensus Transcription factor, Myb superfamily [T 96.26
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.8
KOG1279 506 consensus Chromatin remodeling factor subunit and 95.23
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 92.2
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 92.13
KOG0049 939 consensus Transcription factor, Myb superfamily [T 91.55
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 89.28
smart0059589 MADF subfamily of SANT domain. 89.17
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 89.13
KOG1194 534 consensus Predicted DNA-binding protein, contains 88.87
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 87.95
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information 
Probab=99.16  E-value=1.4e-10  Score=67.33  Aligned_cols=44  Identities=27%  Similarity=0.663  Sum_probs=40.4

Q ss_pred             CCHHHHHHHHHHHhhcCCCCChHHHHHHHHcCCCCCHHHHHHHHHHH
Q 034673            1 MDPEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRL   47 (87)
Q Consensus         1 ~T~eenK~FE~ALa~~~~~tpdRWekIA~~VpgGKS~~evk~hY~~L   47 (87)
                      .|.+|+++|..|+..|+.+   +|..||..||+|||..+|+.||..|
T Consensus         4 Wt~eE~~~l~~~v~~~g~~---~W~~Ia~~~~~~Rt~~qc~~~~~~~   47 (48)
T PF00249_consen    4 WTEEEDEKLLEAVKKYGKD---NWKKIAKRMPGGRTAKQCRSRYQNL   47 (48)
T ss_dssp             S-HHHHHHHHHHHHHSTTT---HHHHHHHHHSSSSTHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHhCCc---HHHHHHHHcCCCCCHHHHHHHHHhh
Confidence            4899999999999999977   8999999999889999999999876

These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B ....
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
2cjj_A93 Crystal Structure Of The Myb Domain Of The Rad Tran 1e-21
4eef_G74 Crystal Structure Of The Designed Inhibitor Protein 5e-06
2m2e_A73 Solution Nmr Structure Of The Sant Domain Of Human 1e-04
>pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 Back     alignment and structure 
Iteration: 1

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 64/84 (76%), Gaps = 5/84 (5%)
Query: 4  EQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPN 63
          ++NK FERALAVYDKDTPDRW NVARAV  G++P++VK+HY+ LVED+ +IES + P PN
Sbjct: 14 KENKAFERALAVYDKDTPDRWANVARAV-EGRTPEEVKKHYEILVEDIKYIESGKVPFPN 72
Query: 64 YKNTGNNCIGILADAPRLMKNLKL 87
          Y+ TG N   +  D  R  +NLK+
Sbjct: 73 YRTTGGN---MKTDEKRF-RNLKI 92
>pdb|4EEF|G Chain G, Crystal Structure Of The Designed Inhibitor Protein F-Hb80.4 In Complex With The 1918 Influenza Virus Hemagglutinin. Length = 74 Back     alignment and structure
>pdb|2M2E|A Chain A, Solution Nmr Structure Of The Sant Domain Of Human Dnajc2, Northeast Structural Genomics Consortium Target Hr8254a Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
2cjj_A93 Radialis; plant development, DNA-binding protein, 1e-31
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 2e-23
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 4e-19
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 6e-05
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 8e-05
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 5e-04
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 6e-04
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
 Score =  104 bits (262), Expect = 1e-31
 Identities = 47/85 (55%), Positives = 63/85 (74%), Gaps = 5/85 (5%)

Query: 3  PEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLP 62
           ++NK FERALAVYDKDTPDRW NVARAV  G++P++VK+HY+ LVED+ +IES + P P
Sbjct: 13 AKENKAFERALAVYDKDTPDRWANVARAV-EGRTPEEVKKHYEILVEDIKYIESGKVPFP 71

Query: 63 NYKNTGNNCIGILADAPRLMKNLKL 87
          NY+ TG N    +    +  +NLK+
Sbjct: 72 NYRTTGGN----MKTDEKRFRNLKI 92
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.97
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.93
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.86
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 99.85
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.76
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.43
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.35
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.1
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.07
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 98.96
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 98.91
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.9
2crg_A70 Metastasis associated protein MTA3; transcription 98.87
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 98.82
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 98.77
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 98.66
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 98.63
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.58
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.54
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.5
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 98.49
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.42
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.4
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.38
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.37
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 97.67
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.29
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.27
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.24
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 98.22
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.21
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.2
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.2
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.01
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 98.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 97.99
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 97.96
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 97.87
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.72
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 97.41
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.35
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 97.12
4b4c_A 211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.91
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 96.89
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 96.64
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 96.58
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 96.37
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 96.14
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.07
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 95.75
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 94.44
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 92.34
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 91.33
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 89.9
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 87.61
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 81.71
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 80.94
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.97  E-value=1.6e-30  Score=172.34  Aligned_cols=82  Identities=57%  Similarity=1.038  Sum_probs=58.8

Q ss_pred             CCHHHHHHHHHHHhhcCCCCChHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHHhCCCCCCCCCCCCCCCccccCChHH
Q 034673            1 MDPEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPLPNYKNTGNNCIGILADAPR   80 (87)
Q Consensus         1 ~T~eenK~FE~ALa~~~~~tpdRWekIA~~VpgGKS~~evk~hY~~LveDV~~IEsg~v~~P~y~~~~~~~~~~~~~~~~   80 (87)
                      .|.+||++||+||+.|++++|+||++||++|| |||..||++||..|++||..||+|+||+|+|.+.+    ++..++++
T Consensus        11 WT~eEd~~L~~al~~~~~~~~~rW~~IA~~vp-GRT~~q~k~ry~~l~~dv~~iesg~vp~P~y~~~~----~~~~~~~~   85 (93)
T 2cjj_A           11 WSAKENKAFERALAVYDKDTPDRWANVARAVE-GRTPEEVKKHYEILVEDIKYIESGKVPFPNYRTTG----GNMKTDEK   85 (93)
T ss_dssp             CCHHHHHHHHHHHHHSCTTCTTHHHHHHHHST-TCCHHHHHHHHHHHHHHHHHHHHSSCCC-------------------
T ss_pred             CCHHHHHHHHHHHHHcCCCCCchHHHHHHHcC-CCCHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCC----CCcccHHH
Confidence            48999999999999999999999999999999 89999999999999999999999999999998653    56778889


Q ss_pred             HhhccCC
Q 034673           81 LMKNLKL   87 (87)
Q Consensus        81 ~~~~~~~   87 (87)
                      ||++|+|
T Consensus        86 ~~~~~~~   92 (93)
T 2cjj_A           86 RFRNLKI   92 (93)
T ss_dssp             -------
T ss_pred             HHhcccC
Confidence            9999986
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 87
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 6e-17
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-12
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-05
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 3e-05
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: DnaJ homolog subfamily C member 1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 65.6 bits (160), Expect = 6e-17
 Identities = 12/49 (24%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 3  PEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDL 51
           E   +  R++  +   TP RW+ +A  +  G+S  DV     +L + +
Sbjct: 6  EEDLSQLTRSMVKFPGGTPGRWEKIAHEL--GRSVTDVTTKAKQLKDSV 52
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.89
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.8
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.56
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 98.9
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.87
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 98.86
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.76
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.61
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.59
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.51
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.48
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.25
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 98.21
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.19
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 97.94
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 97.9
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 97.45
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 96.69
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 93.74
d1lvaa364 C-terminal fragment of elongation factor SelB {Moo 89.06
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 85.2
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 81.69
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]

Probab=99.89  E-value=2.7e-23  Score=126.16  Aligned_cols=59  Identities=64%  Similarity=1.135  Sum_probs=58.0

Q ss_pred             CHHHHHHHHHHHhhcCCCCChHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHHhCCCCC
Q 034673            2 DPEQNKKFERALAVYDKDTPDRWQNVARAVGGGKSPDDVKRHYDRLVEDLIFIESAQFPL   61 (87)
Q Consensus         2 T~eenK~FE~ALa~~~~~tpdRWekIA~~VpgGKS~~evk~hY~~LveDV~~IEsg~v~~   61 (87)
                      |.+|+++|+.|++.|+++++++|.+||..|| |||..+|+.||..|++||+.||+|+|||
T Consensus         5 T~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~-gRt~~qc~~r~~~L~~dik~iesg~vpf   63 (63)
T d2cjja1           5 SAKENKAFERALAVYDKDTPDRWANVARAVE-GRTPEEVKKHYEILVEDIKYIESGKVPF   63 (63)
T ss_dssp             CHHHHHHHHHHHHHSCTTCTTHHHHHHHHST-TCCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred             CHHHHHHHHHHHHHHCCCCchHHHHHHHHcC-CCCHHHHHHHHHHHHHHhhccccCCCCC
Confidence            8999999999999999999999999999999 9999999999999999999999999997
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure