Citrus Sinensis ID: 034948
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 78 | ||||||
| 356496961 | 78 | PREDICTED: uncharacterized protein At2g2 | 1.0 | 1.0 | 0.948 | 2e-36 | |
| 356541669 | 78 | PREDICTED: uncharacterized protein At2g2 | 1.0 | 1.0 | 0.935 | 3e-36 | |
| 255625817 | 78 | unknown [Glycine max] | 1.0 | 1.0 | 0.923 | 1e-35 | |
| 224067224 | 78 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.910 | 4e-35 | |
| 255584894 | 78 | conserved hypothetical protein [Ricinus | 0.987 | 0.987 | 0.935 | 7e-35 | |
| 194466179 | 77 | unknown [Arachis hypogaea] | 0.974 | 0.987 | 0.935 | 4e-34 | |
| 225458800 | 78 | PREDICTED: uncharacterized protein At2g2 | 1.0 | 1.0 | 0.884 | 5e-34 | |
| 224129906 | 78 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.897 | 5e-34 | |
| 3860323 | 78 | hypothetical protein [Cicer arietinum] | 1.0 | 1.0 | 0.897 | 7e-34 | |
| 255538102 | 78 | conserved hypothetical protein [Ricinus | 1.0 | 1.0 | 0.884 | 8e-34 |
| >gi|356496961|ref|XP_003517333.1| PREDICTED: uncharacterized protein At2g23090 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 156 bits (394), Expect = 2e-36, Method: Compositional matrix adjust.
Identities = 74/78 (94%), Positives = 78/78 (100%)
Query: 1 MGGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHA 60
MGGGNGQKAKMAREKNLEKQKAA+KGSQL++NKKAMSIQCKVCMQTFMCTTSEVKCREHA
Sbjct: 1 MGGGNGQKAKMAREKNLEKQKAASKGSQLDSNKKAMSIQCKVCMQTFMCTTSEVKCREHA 60
Query: 61 EAKHPKSDIYACFPHLKK 78
EAKHPKSD+YACFPHLKK
Sbjct: 61 EAKHPKSDVYACFPHLKK 78
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356541669|ref|XP_003539296.1| PREDICTED: uncharacterized protein At2g23090 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255625817|gb|ACU13253.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224067224|ref|XP_002302417.1| predicted protein [Populus trichocarpa] gi|118482635|gb|ABK93237.1| unknown [Populus trichocarpa] gi|222844143|gb|EEE81690.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255584894|ref|XP_002533162.1| conserved hypothetical protein [Ricinus communis] gi|223527034|gb|EEF29221.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|194466179|gb|ACF74320.1| unknown [Arachis hypogaea] | Back alignment and taxonomy information |
|---|
| >gi|225458800|ref|XP_002285206.1| PREDICTED: uncharacterized protein At2g23090 [Vitis vinifera] gi|147785069|emb|CAN62217.1| hypothetical protein VITISV_021844 [Vitis vinifera] gi|302142219|emb|CBI19422.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224129906|ref|XP_002320700.1| predicted protein [Populus trichocarpa] gi|222861473|gb|EEE99015.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|3860323|emb|CAA10129.1| hypothetical protein [Cicer arietinum] | Back alignment and taxonomy information |
|---|
| >gi|255538102|ref|XP_002510116.1| conserved hypothetical protein [Ricinus communis] gi|223550817|gb|EEF52303.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 78 | ||||||
| TAIR|locus:2045359 | 78 | AT2G23090 "AT2G23090" [Arabido | 1.0 | 1.0 | 0.858 | 2e-33 | |
| UNIPROTKB|G4MXI3 | 74 | MGG_01222 "Uncharacterized pro | 0.884 | 0.932 | 0.478 | 9.1e-13 | |
| ASPGD|ASPL0000068598 | 78 | AN7617 [Emericella nidulans (t | 0.884 | 0.884 | 0.478 | 5.8e-11 | |
| WB|WBGene00007223 | 73 | C01F6.9 [Caenorhabditis elegan | 0.807 | 0.863 | 0.352 | 0.00093 |
| TAIR|locus:2045359 AT2G23090 "AT2G23090" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 364 (133.2 bits), Expect = 2.0e-33, P = 2.0e-33
Identities = 67/78 (85%), Positives = 71/78 (91%)
Query: 1 MGGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHA 60
MGGGN QK+ MAR KNLEK KAA KGSQLE NKKAMSIQCKVCMQTF+CTTSEVKCREHA
Sbjct: 1 MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA 60
Query: 61 EAKHPKSDIYACFPHLKK 78
EAKHPK+D+ ACFPHLKK
Sbjct: 61 EAKHPKADVVACFPHLKK 78
|
|
| UNIPROTKB|G4MXI3 MGG_01222 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000068598 AN7617 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00007223 C01F6.9 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pg.C_LG_II1091 | SubName- Full=Putative uncharacterized protein; (78 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 78 | |||
| pfam12907 | 40 | pfam12907, zf-met2, Zinc-binding | 4e-18 |
| >gnl|CDD|205139 pfam12907, zf-met2, Zinc-binding | Back alignment and domain information |
|---|
Score = 69.4 bits (170), Expect = 4e-18
Identities = 28/40 (70%), Positives = 32/40 (80%)
Query: 37 SIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHL 76
+I CK+CMQTFMCTTSE EHAE KHPK+D+ ACFP L
Sbjct: 1 NIICKICMQTFMCTTSEKLLTEHAENKHPKTDVEACFPGL 40
|
This is small family of metazoan zinc-binding proteins. Length = 40 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| PF12907 | 40 | zf-met2: Zinc-binding | 99.91 | |
| KOG4118 | 74 | consensus Uncharacterized conserved protein [Funct | 99.82 | |
| PF04419 | 38 | 4F5: 4F5 protein family; InterPro: IPR007513 Membe | 98.09 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 95.69 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 95.39 | |
| KOG4488 | 70 | consensus Small EDRK-rich protein H4F5 [General fu | 94.87 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 94.19 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 93.52 | |
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 93.5 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 90.74 | |
| PF02892 | 45 | zf-BED: BED zinc finger; InterPro: IPR003656 Zinc | 90.21 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 89.22 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 88.92 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 88.36 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 85.46 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 83.87 | |
| smart00614 | 50 | ZnF_BED BED zinc finger. DNA-binding domain in chr | 80.98 | |
| PHA00616 | 44 | hypothetical protein | 80.84 |
| >PF12907 zf-met2: Zinc-binding | Back alignment and domain information |
|---|
Probab=99.91 E-value=1.3e-25 Score=128.05 Aligned_cols=40 Identities=58% Similarity=1.007 Sum_probs=38.8
Q ss_pred cccchhhhhhhhccCChhHHHHHHHhcCCCCCccccCCCC
Q 034948 37 SIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHL 76 (78)
Q Consensus 37 ~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~~CFP~~ 76 (78)
+|+|+||||+||+|+++++|++|+||||||++|++|||+|
T Consensus 1 ~i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~CFP~l 40 (40)
T PF12907_consen 1 NIICKICRQTFMQTTNEPQLKEHAENKHPKNTFEECFPNL 40 (40)
T ss_pred CcCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHcCCCC
Confidence 5899999999999999999999999999999999999986
|
|
| >KOG4118 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04419 4F5: 4F5 protein family; InterPro: IPR007513 Members of this family are short proteins that are rich in aspartate, glutamate, lysine and arginine | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >KOG4488 consensus Small EDRK-rich protein H4F5 [General function prediction only] | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >smart00614 ZnF_BED BED zinc finger | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 78 | ||||
| 1wvk_A | 86 | Nmr Solution Structure Of The Partially Disordered | 4e-34 |
| >pdb|1WVK|A Chain A, Nmr Solution Structure Of The Partially Disordered Protein At2g23090 From Arabidopsis Thaliana Length = 86 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 78 | |||
| 1wvk_A | 86 | AT2G23090/F21P24.15; structural genomics, protein | 5e-29 |
| >1wvk_A AT2G23090/F21P24.15; structural genomics, protein structure initiative, cell free, center for eukaryotic structural genomics, CESG; NMR {Arabidopsis thaliana} SCOP: g.82.1.1 Length = 86 | Back alignment and structure |
|---|
Score = 97.8 bits (243), Expect = 5e-29
Identities = 66/77 (85%), Positives = 70/77 (90%)
Query: 2 GGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAE 61
GGGN QK+ MAR KNLEK KAA KGSQLE NKKAMSIQCKVCMQTF+CTTSEVKCREHAE
Sbjct: 10 GGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAE 69
Query: 62 AKHPKSDIYACFPHLKK 78
AKHPK+D+ ACFPHLKK
Sbjct: 70 AKHPKADVVACFPHLKK 86
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| 1wvk_A | 86 | AT2G23090/F21P24.15; structural genomics, protein | 100.0 | |
| 2jvx_A | 28 | NF-kappa-B essential modulator; CCHC classical zin | 98.12 | |
| 3mjh_B | 34 | Early endosome antigen 1; protein-zinc finger comp | 97.95 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 92.49 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 92.48 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 92.18 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 91.8 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.79 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 91.6 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.6 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.58 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 91.57 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.54 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.37 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 91.12 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 91.1 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.82 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.72 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 90.6 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 90.54 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 90.48 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 90.44 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 90.43 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.28 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.26 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 90.25 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 90.01 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 90.01 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 90.01 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.87 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.81 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.68 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.59 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.58 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 89.36 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 89.32 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.28 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 89.24 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 89.14 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 89.11 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 89.05 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 89.0 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 88.97 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 88.82 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 88.81 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 88.79 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 88.69 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.69 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 88.68 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 88.66 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 88.65 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 88.45 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 88.33 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.32 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 88.32 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 88.29 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 88.29 | |
| 2ct5_A | 73 | Zinc finger BED domain containing protein 1; DREF | 88.26 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 88.19 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 88.18 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 88.16 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 88.06 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 87.84 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 88.04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.97 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 87.96 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 87.94 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 87.88 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 87.73 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 87.68 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 87.54 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 87.43 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 87.34 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 87.27 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 87.2 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 87.12 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 87.01 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 87.0 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 86.96 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 86.95 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 86.95 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 86.94 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 86.89 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 86.86 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 86.85 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 86.84 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 86.81 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 86.78 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 86.77 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 86.73 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 86.64 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 86.59 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 86.59 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 86.57 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 86.56 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 86.53 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 86.44 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 86.48 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 86.34 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 86.25 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 86.19 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 86.08 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 85.96 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 85.95 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 85.94 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 85.87 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 86.0 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 85.76 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 85.69 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 85.68 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 85.62 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 85.38 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 85.31 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 85.13 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 85.09 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 85.06 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 85.06 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 84.82 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 84.77 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 84.75 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 84.71 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 84.47 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 84.47 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 84.39 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 84.28 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 84.25 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 83.89 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 83.82 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 83.81 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 83.71 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 83.67 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 83.62 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 83.6 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 83.56 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 83.49 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 83.49 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 83.45 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 83.39 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 82.72 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 82.69 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 82.59 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 82.51 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 82.45 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 81.68 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 81.55 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 81.51 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 81.39 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 81.33 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 81.26 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 81.21 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 80.97 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 80.87 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 80.77 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 80.69 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 80.69 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 80.66 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 80.17 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 80.03 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 80.02 |
| >1wvk_A AT2G23090/F21P24.15; structural genomics, protein structure initiative, cell free, center for eukaryotic structural genomics, CESG; NMR {Arabidopsis thaliana} SCOP: g.82.1.1 | Back alignment and structure |
|---|
Probab=100.00 E-value=3.4e-41 Score=217.48 Aligned_cols=76 Identities=86% Similarity=1.305 Sum_probs=72.3
Q ss_pred CCccHHHHHHHHHHHHHHHhhhcccCcHHHHHhhccccchhhhhhhhccCChhHHHHHHHhcCCCCCccccCCCCC
Q 034948 2 GGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHLK 77 (78)
Q Consensus 2 g~GNg~ka~~~r~rn~kk~~k~~~~SQlkan~~A~~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~~CFP~~~ 77 (78)
|||||+|++++|+||+++++++.++|||++|++||+|+|+|||++||+|+++++|++||||||||++|++|||+|+
T Consensus 10 ~~~Ng~ka~qareRNakk~~~~~kkSQlkan~~A~~i~C~VCr~tFm~t~~~~~L~~H~e~KHpK~~~~eCFP~~~ 85 (86)
T 1wvk_A 10 GGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAEAKHPKADVVACFPHLK 85 (86)
T ss_dssp SCCCSGGGTTTSTTTCCCSSSSCSSCSSCCCCTTCCEEETTTTEEECCSSCSHHHHHHHHTCCSCCGGGTTSGGGC
T ss_pred CCccHHHHHHHHHHHHHhcccccchhhHHHHHHhhCCCChHhHhhHHhcCChHHHHHHHHcCCCCCCHHHHCcCCC
Confidence 7999999999999999988744567999999999999999999999999999999999999999999999999986
|
| >2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A | Back alignment and structure |
|---|
| >3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct5_A Zinc finger BED domain containing protein 1; DREF homolog, putative C-like transposable element, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.6 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 78 | ||||
| d1wvka_ | 86 | g.82.1.1 (A:) Expressed protein At2g23090/F21P24.1 | 2e-32 |
| >d1wvka_ g.82.1.1 (A:) Expressed protein At2g23090/F21P24.15 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 86 | Back information, alignment and structure |
|---|
class: Small proteins fold: Expressed protein At2g23090/F21P24.15 superfamily: Expressed protein At2g23090/F21P24.15 family: Expressed protein At2g23090/F21P24.15 domain: Expressed protein At2g23090/F21P24.15 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 105 bits (264), Expect = 2e-32
Identities = 66/77 (85%), Positives = 70/77 (90%)
Query: 2 GGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAE 61
GGGN QK+ MAR KNLEK KAA KGSQLE NKKAMSIQCKVCMQTF+CTTSEVKCREHAE
Sbjct: 10 GGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAE 69
Query: 62 AKHPKSDIYACFPHLKK 78
AKHPK+D+ ACFPHLKK
Sbjct: 70 AKHPKADVVACFPHLKK 86
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| d1wvka_ | 86 | Expressed protein At2g23090/F21P24.15 {Thale cress | 100.0 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 95.05 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 93.74 | |
| d2ct5a1 | 60 | Zinc finger BED domain-containing protein 1 {Human | 92.37 | |
| d2ghfa2 | 36 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 92.08 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 90.07 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 89.21 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 88.82 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 88.47 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 86.67 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 85.78 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 84.39 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 84.34 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 80.99 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 80.15 |
| >d1wvka_ g.82.1.1 (A:) Expressed protein At2g23090/F21P24.15 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Expressed protein At2g23090/F21P24.15 superfamily: Expressed protein At2g23090/F21P24.15 family: Expressed protein At2g23090/F21P24.15 domain: Expressed protein At2g23090/F21P24.15 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=100.00 E-value=1.9e-41 Score=217.24 Aligned_cols=76 Identities=86% Similarity=1.305 Sum_probs=73.1
Q ss_pred CCccHHHHHHHHHHHHHHHhhhcccCcHHHHHhhccccchhhhhhhhccCChhHHHHHHHhcCCCCCccccCCCCC
Q 034948 2 GGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHLK 77 (78)
Q Consensus 2 g~GNg~ka~~~r~rn~kk~~k~~~~SQlkan~~A~~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~~CFP~~~ 77 (78)
|||||+|++++|+||+++..+++++|||++|++||+|+|.||||+||+|++.++|.||+||||||++|++|||+|.
T Consensus 10 gGGNg~Ka~~~Rern~~k~~~a~k~SQlk~n~~A~~i~C~vCrqtFm~T~~~~~L~eHae~KHpK~~~~eCFP~l~ 85 (86)
T d1wvka_ 10 GGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAEAKHPKADVVACFPHLK 85 (86)
T ss_dssp SCCCSGGGTTTSTTTCCCSSSSCSSCSSCCCCTTCCEEETTTTEEECCSSCSHHHHHHHHTCCSCCGGGTTSGGGC
T ss_pred CCchHHHHHHHHHHHHHhcccCCchhHHHHHHHhhccCcHHHHhHHHHHcchHHHHHHHHccCCCCCHHHhCcccc
Confidence 8999999999999999999866677999999999999999999999999999999999999999999999999985
|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct5a1 g.37.1.6 (A:8-67) Zinc finger BED domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|