Citrus Sinensis ID: 034948


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------
MGGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHLKK
ccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccc
cccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHcccccc
MGGGNGQKAKMAREKNLEKQKAankgsqletnKKAMSIQCKVCMQtfmcttsevkcrehaeakhpksdiyacfphlkk
mgggngqkakmAREKNLEkqkaankgsqletnkKAMSIQCKVCMQTFMCTTSEVKCREHaeakhpksdiyacfphlkk
MGGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHLKK
************************************SIQCKVCMQTFMCTTSEVKCRE*********DIYACF*****
************************************SIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHLK*
*******************************NKKAMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHLKK
*************************GSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHLK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHLKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query78 2.2.26 [Sep-21-2011]
O6481878 Uncharacterized protein A yes no 1.0 1.0 0.858 1e-33
>sp|O64818|Y2309_ARATH Uncharacterized protein At2g23090 OS=Arabidopsis thaliana GN=At2g23090 PE=1 SV=1 Back     alignment and function desciption
 Score =  141 bits (355), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 67/78 (85%), Positives = 71/78 (91%)

Query: 1  MGGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHA 60
          MGGGN QK+ MAR KNLEK KAA KGSQLE NKKAMSIQCKVCMQTF+CTTSEVKCREHA
Sbjct: 1  MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA 60

Query: 61 EAKHPKSDIYACFPHLKK 78
          EAKHPK+D+ ACFPHLKK
Sbjct: 61 EAKHPKADVVACFPHLKK 78





Arabidopsis thaliana (taxid: 3702)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query78
35649696178 PREDICTED: uncharacterized protein At2g2 1.0 1.0 0.948 2e-36
35654166978 PREDICTED: uncharacterized protein At2g2 1.0 1.0 0.935 3e-36
25562581778 unknown [Glycine max] 1.0 1.0 0.923 1e-35
22406722478 predicted protein [Populus trichocarpa] 1.0 1.0 0.910 4e-35
25558489478 conserved hypothetical protein [Ricinus 0.987 0.987 0.935 7e-35
19446617977 unknown [Arachis hypogaea] 0.974 0.987 0.935 4e-34
22545880078 PREDICTED: uncharacterized protein At2g2 1.0 1.0 0.884 5e-34
22412990678 predicted protein [Populus trichocarpa] 1.0 1.0 0.897 5e-34
386032378 hypothetical protein [Cicer arietinum] 1.0 1.0 0.897 7e-34
25553810278 conserved hypothetical protein [Ricinus 1.0 1.0 0.884 8e-34
>gi|356496961|ref|XP_003517333.1| PREDICTED: uncharacterized protein At2g23090 [Glycine max] Back     alignment and taxonomy information
 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 74/78 (94%), Positives = 78/78 (100%)

Query: 1  MGGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHA 60
          MGGGNGQKAKMAREKNLEKQKAA+KGSQL++NKKAMSIQCKVCMQTFMCTTSEVKCREHA
Sbjct: 1  MGGGNGQKAKMAREKNLEKQKAASKGSQLDSNKKAMSIQCKVCMQTFMCTTSEVKCREHA 60

Query: 61 EAKHPKSDIYACFPHLKK 78
          EAKHPKSD+YACFPHLKK
Sbjct: 61 EAKHPKSDVYACFPHLKK 78




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356541669|ref|XP_003539296.1| PREDICTED: uncharacterized protein At2g23090 [Glycine max] Back     alignment and taxonomy information
>gi|255625817|gb|ACU13253.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224067224|ref|XP_002302417.1| predicted protein [Populus trichocarpa] gi|118482635|gb|ABK93237.1| unknown [Populus trichocarpa] gi|222844143|gb|EEE81690.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255584894|ref|XP_002533162.1| conserved hypothetical protein [Ricinus communis] gi|223527034|gb|EEF29221.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|194466179|gb|ACF74320.1| unknown [Arachis hypogaea] Back     alignment and taxonomy information
>gi|225458800|ref|XP_002285206.1| PREDICTED: uncharacterized protein At2g23090 [Vitis vinifera] gi|147785069|emb|CAN62217.1| hypothetical protein VITISV_021844 [Vitis vinifera] gi|302142219|emb|CBI19422.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224129906|ref|XP_002320700.1| predicted protein [Populus trichocarpa] gi|222861473|gb|EEE99015.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|3860323|emb|CAA10129.1| hypothetical protein [Cicer arietinum] Back     alignment and taxonomy information
>gi|255538102|ref|XP_002510116.1| conserved hypothetical protein [Ricinus communis] gi|223550817|gb|EEF52303.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query78
TAIR|locus:204535978 AT2G23090 "AT2G23090" [Arabido 1.0 1.0 0.858 2e-33
UNIPROTKB|G4MXI374 MGG_01222 "Uncharacterized pro 0.884 0.932 0.478 9.1e-13
ASPGD|ASPL000006859878 AN7617 [Emericella nidulans (t 0.884 0.884 0.478 5.8e-11
WB|WBGene0000722373 C01F6.9 [Caenorhabditis elegan 0.807 0.863 0.352 0.00093
TAIR|locus:2045359 AT2G23090 "AT2G23090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 364 (133.2 bits), Expect = 2.0e-33, P = 2.0e-33
 Identities = 67/78 (85%), Positives = 71/78 (91%)

Query:     1 MGGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHA 60
             MGGGN QK+ MAR KNLEK KAA KGSQLE NKKAMSIQCKVCMQTF+CTTSEVKCREHA
Sbjct:     1 MGGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHA 60

Query:    61 EAKHPKSDIYACFPHLKK 78
             EAKHPK+D+ ACFPHLKK
Sbjct:    61 EAKHPKADVVACFPHLKK 78




GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|G4MXI3 MGG_01222 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000068598 AN7617 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
WB|WBGene00007223 C01F6.9 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O64818Y2309_ARATHNo assigned EC number0.85891.01.0yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_LG_II1091
SubName- Full=Putative uncharacterized protein; (78 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query78
pfam1290740 pfam12907, zf-met2, Zinc-binding 4e-18
>gnl|CDD|205139 pfam12907, zf-met2, Zinc-binding Back     alignment and domain information
 Score = 69.4 bits (170), Expect = 4e-18
 Identities = 28/40 (70%), Positives = 32/40 (80%)

Query: 37 SIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHL 76
          +I CK+CMQTFMCTTSE    EHAE KHPK+D+ ACFP L
Sbjct: 1  NIICKICMQTFMCTTSEKLLTEHAENKHPKTDVEACFPGL 40


This is small family of metazoan zinc-binding proteins. Length = 40

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 78
PF1290740 zf-met2: Zinc-binding 99.91
KOG411874 consensus Uncharacterized conserved protein [Funct 99.82
PF0441938 4F5: 4F5 protein family; InterPro: IPR007513 Membe 98.09
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.69
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 95.39
KOG448870 consensus Small EDRK-rich protein H4F5 [General fu 94.87
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 94.19
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 93.52
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 93.5
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 90.74
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 90.21
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 89.22
smart0035526 ZnF_C2H2 zinc finger. 88.92
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 88.36
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 85.46
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 83.87
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 80.98
PHA0061644 hypothetical protein 80.84
>PF12907 zf-met2: Zinc-binding Back     alignment and domain information
Probab=99.91  E-value=1.3e-25  Score=128.05  Aligned_cols=40  Identities=58%  Similarity=1.007  Sum_probs=38.8

Q ss_pred             cccchhhhhhhhccCChhHHHHHHHhcCCCCCccccCCCC
Q 034948           37 SIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHL   76 (78)
Q Consensus        37 ~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~~CFP~~   76 (78)
                      +|+|+||||+||+|+++++|++|+||||||++|++|||+|
T Consensus         1 ~i~C~iC~qtF~~t~~~~~L~eH~enKHpK~~~~~CFP~l   40 (40)
T PF12907_consen    1 NIICKICRQTFMQTTNEPQLKEHAENKHPKNTFEECFPNL   40 (40)
T ss_pred             CcCcHHhhHHHHhcCCHHHHHHHHHccCCCCCHHHcCCCC
Confidence            5899999999999999999999999999999999999986



>KOG4118 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04419 4F5: 4F5 protein family; InterPro: IPR007513 Members of this family are short proteins that are rich in aspartate, glutamate, lysine and arginine Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG4488 consensus Small EDRK-rich protein H4F5 [General function prediction only] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query78
1wvk_A86 Nmr Solution Structure Of The Partially Disordered 4e-34
>pdb|1WVK|A Chain A, Nmr Solution Structure Of The Partially Disordered Protein At2g23090 From Arabidopsis Thaliana Length = 86 Back     alignment and structure

Iteration: 1

Score = 139 bits (350), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 66/77 (85%), Positives = 70/77 (90%) Query: 2 GGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAE 61 GGGN QK+ MAR KNLEK KAA KGSQLE NKKAMSIQCKVCMQTF+CTTSEVKCREHAE Sbjct: 10 GGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAE 69 Query: 62 AKHPKSDIYACFPHLKK 78 AKHPK+D+ ACFPHLKK Sbjct: 70 AKHPKADVVACFPHLKK 86 Database: pdbaa

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query78
1wvk_A86 AT2G23090/F21P24.15; structural genomics, protein 5e-29
>1wvk_A AT2G23090/F21P24.15; structural genomics, protein structure initiative, cell free, center for eukaryotic structural genomics, CESG; NMR {Arabidopsis thaliana} SCOP: g.82.1.1 Length = 86 Back     alignment and structure
 Score = 97.8 bits (243), Expect = 5e-29
 Identities = 66/77 (85%), Positives = 70/77 (90%)

Query: 2  GGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAE 61
          GGGN QK+ MAR KNLEK KAA KGSQLE NKKAMSIQCKVCMQTF+CTTSEVKCREHAE
Sbjct: 10 GGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAE 69

Query: 62 AKHPKSDIYACFPHLKK 78
          AKHPK+D+ ACFPHLKK
Sbjct: 70 AKHPKADVVACFPHLKK 86


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query78
1wvk_A86 AT2G23090/F21P24.15; structural genomics, protein 100.0
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 98.12
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 97.95
2lv2_A85 Insulinoma-associated protein 1; structural genomi 92.49
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 92.48
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 92.18
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 91.8
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 91.79
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 91.6
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.6
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 91.58
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 91.57
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 91.54
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 91.37
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 91.12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 91.1
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 90.82
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 90.72
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 90.6
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 90.54
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.48
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 90.44
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 90.43
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 90.28
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.26
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 90.25
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 90.01
1paa_A30 Yeast transcription factor ADR1; transcription reg 90.01
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 90.01
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.87
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.81
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.68
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.59
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 89.58
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 89.36
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 89.32
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.28
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 89.24
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 89.14
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 89.11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 89.05
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 89.0
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 88.97
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 88.82
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 88.81
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.79
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 88.69
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.69
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 88.68
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 88.66
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 88.65
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 88.45
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 88.33
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.32
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 88.32
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 88.29
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 88.29
2ct5_A73 Zinc finger BED domain containing protein 1; DREF 88.26
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 88.19
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 88.18
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 88.16
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 88.06
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 87.84
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 87.97
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 87.96
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 87.94
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 87.88
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 87.73
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 87.68
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 87.54
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 87.43
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 87.34
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 87.27
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 87.2
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 87.12
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 87.01
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 87.0
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 86.96
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 86.95
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 86.95
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 86.94
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.89
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 86.86
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.85
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 86.84
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 86.81
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 86.78
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 86.77
1ard_A29 Yeast transcription factor ADR1; transcription reg 86.73
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.64
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 86.59
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 86.59
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 86.57
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 86.56
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 86.53
2lv2_A85 Insulinoma-associated protein 1; structural genomi 86.44
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 86.48
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 86.34
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.25
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 86.19
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 86.08
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 85.96
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 85.95
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 85.94
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 85.87
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 86.0
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 85.76
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 85.69
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.68
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.62
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.38
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.31
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 85.13
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 85.09
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 85.06
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 85.06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 84.82
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 84.77
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 84.75
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.71
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 84.47
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 84.47
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 84.39
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 84.28
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 84.25
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.89
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 83.82
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 83.81
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 83.71
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 83.67
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 83.62
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 83.6
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 83.56
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.49
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 83.49
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 83.45
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 83.39
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 82.72
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 82.69
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 82.59
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 82.51
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 82.45
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 81.68
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 81.55
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 81.51
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 81.39
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 81.33
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 81.26
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 81.21
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 80.97
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.87
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 80.77
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.69
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 80.69
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 80.66
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.17
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 80.03
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 80.02
>1wvk_A AT2G23090/F21P24.15; structural genomics, protein structure initiative, cell free, center for eukaryotic structural genomics, CESG; NMR {Arabidopsis thaliana} SCOP: g.82.1.1 Back     alignment and structure
Probab=100.00  E-value=3.4e-41  Score=217.48  Aligned_cols=76  Identities=86%  Similarity=1.305  Sum_probs=72.3

Q ss_pred             CCccHHHHHHHHHHHHHHHhhhcccCcHHHHHhhccccchhhhhhhhccCChhHHHHHHHhcCCCCCccccCCCCC
Q 034948            2 GGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHLK   77 (78)
Q Consensus         2 g~GNg~ka~~~r~rn~kk~~k~~~~SQlkan~~A~~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~~CFP~~~   77 (78)
                      |||||+|++++|+||+++++++.++|||++|++||+|+|+|||++||+|+++++|++||||||||++|++|||+|+
T Consensus        10 ~~~Ng~ka~qareRNakk~~~~~kkSQlkan~~A~~i~C~VCr~tFm~t~~~~~L~~H~e~KHpK~~~~eCFP~~~   85 (86)
T 1wvk_A           10 GGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAEAKHPKADVVACFPHLK   85 (86)
T ss_dssp             SCCCSGGGTTTSTTTCCCSSSSCSSCSSCCCCTTCCEEETTTTEEECCSSCSHHHHHHHHTCCSCCGGGTTSGGGC
T ss_pred             CCccHHHHHHHHHHHHHhcccccchhhHHHHHHhhCCCChHhHhhHHhcCChHHHHHHHHcCCCCCCHHHHCcCCC
Confidence            7999999999999999988744567999999999999999999999999999999999999999999999999986



>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ct5_A Zinc finger BED domain containing protein 1; DREF homolog, putative C-like transposable element, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.6 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 78
d1wvka_86 g.82.1.1 (A:) Expressed protein At2g23090/F21P24.1 2e-32
>d1wvka_ g.82.1.1 (A:) Expressed protein At2g23090/F21P24.15 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 86 Back     information, alignment and structure

class: Small proteins
fold: Expressed protein At2g23090/F21P24.15
superfamily: Expressed protein At2g23090/F21P24.15
family: Expressed protein At2g23090/F21P24.15
domain: Expressed protein At2g23090/F21P24.15
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score =  105 bits (264), Expect = 2e-32
 Identities = 66/77 (85%), Positives = 70/77 (90%)

Query: 2  GGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAE 61
          GGGN QK+ MAR KNLEK KAA KGSQLE NKKAMSIQCKVCMQTF+CTTSEVKCREHAE
Sbjct: 10 GGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAE 69

Query: 62 AKHPKSDIYACFPHLKK 78
          AKHPK+D+ ACFPHLKK
Sbjct: 70 AKHPKADVVACFPHLKK 86


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query78
d1wvka_86 Expressed protein At2g23090/F21P24.15 {Thale cress 100.0
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.05
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.74
d2ct5a160 Zinc finger BED domain-containing protein 1 {Human 92.37
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 92.08
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 90.07
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 89.21
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 88.82
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 88.47
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 86.67
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 85.78
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 84.39
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 84.34
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 80.99
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 80.15
>d1wvka_ g.82.1.1 (A:) Expressed protein At2g23090/F21P24.15 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Small proteins
fold: Expressed protein At2g23090/F21P24.15
superfamily: Expressed protein At2g23090/F21P24.15
family: Expressed protein At2g23090/F21P24.15
domain: Expressed protein At2g23090/F21P24.15
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=100.00  E-value=1.9e-41  Score=217.24  Aligned_cols=76  Identities=86%  Similarity=1.305  Sum_probs=73.1

Q ss_pred             CCccHHHHHHHHHHHHHHHhhhcccCcHHHHHhhccccchhhhhhhhccCChhHHHHHHHhcCCCCCccccCCCCC
Q 034948            2 GGGNGQKAKMAREKNLEKQKAANKGSQLETNKKAMSIQCKVCMQTFMCTTSEVKCREHAEAKHPKSDIYACFPHLK   77 (78)
Q Consensus         2 g~GNg~ka~~~r~rn~kk~~k~~~~SQlkan~~A~~i~C~vC~~~Fm~t~~~~~L~~H~e~KHpK~~~~~CFP~~~   77 (78)
                      |||||+|++++|+||+++..+++++|||++|++||+|+|.||||+||+|++.++|.||+||||||++|++|||+|.
T Consensus        10 gGGNg~Ka~~~Rern~~k~~~a~k~SQlk~n~~A~~i~C~vCrqtFm~T~~~~~L~eHae~KHpK~~~~eCFP~l~   85 (86)
T d1wvka_          10 GGGNAQKSAMARAKNLEKAKAAGKGSQLEANKKAMSIQCKVCMQTFICTTSEVKCREHAEAKHPKADVVACFPHLK   85 (86)
T ss_dssp             SCCCSGGGTTTSTTTCCCSSSSCSSCSSCCCCTTCCEEETTTTEEECCSSCSHHHHHHHHTCCSCCGGGTTSGGGC
T ss_pred             CCchHHHHHHHHHHHHHhcccCCchhHHHHHHHhhccCcHHHHhHHHHHcchHHHHHHHHccCCCCCHHHhCcccc
Confidence            8999999999999999999866677999999999999999999999999999999999999999999999999985



>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct5a1 g.37.1.6 (A:8-67) Zinc finger BED domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure