Citrus Sinensis ID: 034952

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------
MVPLGEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEFSL
cccccEEEEEEEEEccccEEEEEEccccccccEEEEEEccccccHHHHHHHHHHHHHccEEEEEEEHHHHHHcccccc
ccccccEEEEEEEccccEEEEEEEccccccccEEEEEEEEEcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcc
mvplgeiiSEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEFSL
MVPLGEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEFSL
MVPLGEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEFSL
******IISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEF**
**PLGEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEFSL
MVPLGEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEFSL
*VPLGEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEFSL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVPLGEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEFSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query78 2.2.26 [Sep-21-2011]
P31166243 Adenine phosphoribosyltra no no 0.666 0.213 0.75 3e-16
Q43199181 Adenine phosphoribosyltra N/A no 0.666 0.287 0.711 2e-14
Q42563192 Adenine phosphoribosyltra no no 0.666 0.270 0.692 5e-13
Q04WP5177 Adenine phosphoribosyltra yes no 0.666 0.293 0.596 9e-13
Q04NG3177 Adenine phosphoribosyltra yes no 0.666 0.293 0.596 9e-13
Q8EXN2177 Adenine phosphoribosyltra yes no 0.666 0.293 0.557 3e-12
Q75FP0177 Adenine phosphoribosyltra yes no 0.666 0.293 0.557 3e-12
A6TQN8170 Adenine phosphoribosyltra yes no 0.782 0.358 0.523 8e-12
Q65U83180 Adenine phosphoribosyltra yes no 0.666 0.288 0.576 1e-11
Q7W3L2191 Adenine phosphoribosyltra yes no 0.641 0.261 0.6 1e-11
>sp|P31166|APT1_ARATH Adenine phosphoribosyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=APT1 PE=1 SV=2 Back     alignment and function desciption
 Score = 84.0 bits (206), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 39/52 (75%), Positives = 46/52 (88%)

Query: 5   GEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGR 56
           G++ISEEYSLEYG D +EMHV AV+ GERA+I+DDL+ATGGTL AAIRLL R
Sbjct: 156 GKVISEEYSLEYGTDTIEMHVGAVEPGERAIIIDDLIATGGTLAAAIRLLER 207
Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 7
>sp|Q43199|APT1_WHEAT Adenine phosphoribosyltransferase 1 OS=Triticum aestivum GN=APT1 PE=2 SV=1 Back     alignment and function description
>sp|Q42563|APT2_ARATH Adenine phosphoribosyltransferase 2 OS=Arabidopsis thaliana GN=APT2 PE=2 SV=1 Back     alignment and function description
>sp|Q04WP5|APT_LEPBL Adenine phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|Q04NG3|APT_LEPBJ Adenine phosphoribosyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|Q8EXN2|APT_LEPIN Adenine phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|Q75FP0|APT_LEPIC Adenine phosphoribosyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|A6TQN8|APT_ALKMQ Adenine phosphoribosyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=apt PE=3 SV=1 Back     alignment and function description
>sp|Q65U83|APT_MANSM Adenine phosphoribosyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=apt PE=3 SV=2 Back     alignment and function description
>sp|Q7W3L2|APT_BORPA Adenine phosphoribosyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=apt PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query78
255538084 253 Adenine phosphoribosyltransferase, putat 0.666 0.205 0.807 8e-17
356514471 235 PREDICTED: adenine phosphoribosyltransfe 0.884 0.293 0.638 3e-16
449450275 260 PREDICTED: adenine phosphoribosyltransfe 0.666 0.2 0.788 7e-16
408455889151 adenine phosphoribosyl transferase, part 0.666 0.344 0.807 8e-16
224129882 255 predicted protein [Populus trichocarpa] 0.858 0.262 0.614 1e-15
388503084 179 unknown [Lotus japonicus] 0.666 0.290 0.807 1e-15
351722933 236 uncharacterized protein LOC100305792 [Gl 0.884 0.292 0.625 1e-15
9802535 223 F17L21.24 [Arabidopsis thaliana] 0.717 0.251 0.736 2e-15
82621166 182 adenine phosphoribosyltransferase-like [ 0.666 0.285 0.826 3e-15
297845694 242 hypothetical protein ARALYDRAFT_472949 [ 0.666 0.214 0.75 6e-15
>gi|255538084|ref|XP_002510107.1| Adenine phosphoribosyltransferase, putative [Ricinus communis] gi|223550808|gb|EEF52294.1| Adenine phosphoribosyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 90.9 bits (224), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 42/52 (80%), Positives = 47/52 (90%)

Query: 5   GEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGR 56
           GE++SEEYSLEYG D MEMHV AVQAGERAL++DDL+ATGGTL AAIRLL R
Sbjct: 167 GEVVSEEYSLEYGTDKMEMHVGAVQAGERALVIDDLIATGGTLCAAIRLLER 218

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356514471|ref|XP_003525929.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|449450275|ref|XP_004142889.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like [Cucumis sativus] gi|449522831|ref|XP_004168429.1| PREDICTED: adenine phosphoribosyltransferase 1, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|408455889|gb|AFU67074.1| adenine phosphoribosyl transferase, partial [Solanum melongena] Back     alignment and taxonomy information
>gi|224129882|ref|XP_002320694.1| predicted protein [Populus trichocarpa] gi|222861467|gb|EEE99009.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388503084|gb|AFK39608.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|351722933|ref|NP_001236749.1| uncharacterized protein LOC100305792 [Glycine max] gi|255626617|gb|ACU13653.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|9802535|gb|AAF99737.1|AC004557_16 F17L21.24 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|82621166|gb|ABB86271.1| adenine phosphoribosyltransferase-like [Solanum tuberosum] Back     alignment and taxonomy information
>gi|297845694|ref|XP_002890728.1| hypothetical protein ARALYDRAFT_472949 [Arabidopsis lyrata subsp. lyrata] gi|297336570|gb|EFH66987.1| hypothetical protein ARALYDRAFT_472949 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query78
TAIR|locus:2127480183 APT3 "adenine phosphoribosyl t 0.666 0.284 0.711 1.4e-14
TAIR|locus:2135550182 APT4 "adenine phosphoribosyl t 0.666 0.285 0.692 6.2e-14
TAIR|locus:2016309192 APT2 "adenine phosphoribosyl t 0.666 0.270 0.692 2.1e-13
TAIR|locus:2147967191 APT5 "adenine phosphoribosyltr 0.641 0.261 0.66 2.4e-12
UNIPROTKB|P69503183 apt "adenine phosphoribosyltra 0.653 0.278 0.549 4.5e-11
FB|FBgn0000109182 Aprt "Adenine phosphoribosyltr 0.666 0.285 0.5 1.5e-10
TIGR_CMR|SPO_3066179 SPO_3066 "adenine phosphoribos 0.666 0.290 0.538 2e-10
ZFIN|ZDB-GENE-040426-1492177 aprt "adenine phosphoribosyl t 0.641 0.282 0.6 6.6e-10
TIGR_CMR|BA_4638170 BA_4638 "adenine phosphoribosy 0.628 0.288 0.530 8.4e-10
UNIPROTKB|P63544170 apt "Adenine phosphoribosyltra 0.628 0.288 0.530 1.1e-09
TAIR|locus:2127480 APT3 "adenine phosphoribosyl transferase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 186 (70.5 bits), Expect = 1.4e-14, P = 1.4e-14
 Identities = 37/52 (71%), Positives = 43/52 (82%)

Query:     5 GEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGR 56
             GE I EEY LEYG D +EMH+ AV+AG+RAL+VDDL+ATGGTL AAI LL R
Sbjct:    97 GETIFEEYELEYGNDRLEMHIGAVEAGDRALVVDDLIATGGTLCAAINLLER 148
GO:0003999 "adenine phosphoribosyltransferase activity" evidence=IEA;ISS;IDA
GO:0005737 "cytoplasm" evidence=ISM;IEA
GO:0006168 "adenine salvage" evidence=IEA;TAS
GO:0009116 "nucleoside metabolic process" evidence=IEA
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2135550 APT4 "adenine phosphoribosyl transferase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016309 APT2 "adenine phosphoribosyl transferase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147967 APT5 "adenine phosphoribosyltransferase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P69503 apt "adenine phosphoribosyltransferase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
FB|FBgn0000109 Aprt "Adenine phosphoribosyltransferase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3066 SPO_3066 "adenine phosphoribosyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1492 aprt "adenine phosphoribosyl transferase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4638 BA_4638 "adenine phosphoribosyltransferase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
UNIPROTKB|P63544 apt "Adenine phosphoribosyltransferase" [Streptococcus pneumoniae TIGR4 (taxid:170187)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_XIV0085
adenine phosphoribosyltransferase (EC-2.4.2.7) (256 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.III.614.1
GMP synthetase (EC-6.3.5.2) (434 aa)
   • •• 0.941
gw1.VIII.102.1
hypothetical protein (223 aa)
     •• 0.911
gw1.X.4176.1
hypothetical protein (223 aa)
     •• 0.910
estExt_fgenesh4_pm.C_LG_X0439
aminoimidazolecarboximide ribonucleotide transformylase/inosine monophosphate cyclohydrolase (E [...] (545 aa)
     •• 0.907
gw1.X.1884.1
adenylosuccinate lyase (EC-4.3.2.2) (472 aa)
     •• 0.902
gw1.XVIII.3392.1
nucleotide kinase (EC-2.7.4.3) (500 aa)
     •• 0.900
fgenesh4_pm.C_LG_XVI000442
AMP deaminase (EC-3.5.4.6) (797 aa)
     •  0.900
gw1.X.2474.1
adenylate kinase family protein (EC-2.7.4.3) (240 aa)
     •  0.899
gw1.VIII.2309.1
adenylate kinase family protein (EC-2.7.4.3) (240 aa)
     •  0.899
grail3.0041012602
hypothetical protein (265 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query78
PLN02293187 PLN02293, PLN02293, adenine phosphoribosyltransfer 2e-26
PRK02304175 PRK02304, PRK02304, adenine phosphoribosyltransfer 2e-22
TIGR01090169 TIGR01090, apt, adenine phosphoribosyltransferase 1e-19
COG0503179 COG0503, Apt, Adenine/guanine phosphoribosyltransf 4e-15
PRK12560187 PRK12560, PRK12560, adenine phosphoribosyltransfer 3e-07
pfam00156123 pfam00156, Pribosyltran, Phosphoribosyl transferas 4e-07
cd06223130 cd06223, PRTases_typeI, Phosphoribosyl transferase 1e-06
PRK00934285 PRK00934, PRK00934, ribose-phosphate pyrophosphoki 4e-04
TIGR01251308 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosph 7e-04
COG0462314 COG0462, PrsA, Phosphoribosylpyrophosphate synthet 8e-04
PRK07322178 PRK07322, PRK07322, adenine phosphoribosyltransfer 0.002
PRK06031233 PRK06031, PRK06031, phosphoribosyltransferase; Pro 0.004
PRK07199301 PRK07199, PRK07199, phosphoribosylpyrophosphate sy 0.004
>gnl|CDD|177930 PLN02293, PLN02293, adenine phosphoribosyltransferase Back     alignment and domain information 
 Score = 94.7 bits (236), Expect = 2e-26
 Identities = 38/53 (71%), Positives = 44/53 (83%)

Query: 5   GEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRF 57
           GE+ISEEY LEYG D +EMHV AV+ GERAL++DDL+ATGGTL AAI LL R 
Sbjct: 99  GEVISEEYVLEYGTDCLEMHVGAVEPGERALVIDDLIATGGTLCAAINLLERA 151

Length = 187
>gnl|CDD|235028 PRK02304, PRK02304, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|233267 TIGR01090, apt, adenine phosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|223577 COG0503, Apt, Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|183595 PRK12560, PRK12560, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215757 pfam00156, Pribosyltran, Phosphoribosyl transferase domain Back     alignment and domain information
>gnl|CDD|206754 cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain Back     alignment and domain information
>gnl|CDD|234868 PRK00934, PRK00934, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|130318 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosphokinase Back     alignment and domain information
>gnl|CDD|223538 COG0462, PrsA, Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|180928 PRK07322, PRK07322, adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235678 PRK06031, PRK06031, phosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|235960 PRK07199, PRK07199, phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 78
KOG1712183 consensus Adenine phosphoribosyl transferases [Nuc 99.84
PLN02293187 adenine phosphoribosyltransferase 99.64
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and 99.62
TIGR01744191 XPRTase xanthine phosphoribosyltransferase. This m 99.58
PRK02304175 adenine phosphoribosyltransferase; Provisional 99.55
TIGR01743268 purR_Bsub pur operon repressor, Bacillus subtilis 99.54
TIGR01090169 apt adenine phosphoribosyltransferase. A phylogene 99.54
PRK09213271 pur operon repressor; Provisional 99.54
PRK09219189 xanthine phosphoribosyltransferase; Validated 99.53
PRK12560187 adenine phosphoribosyltransferase; Provisional 99.5
PRK13810187 orotate phosphoribosyltransferase; Provisional 99.46
PRK13812176 orotate phosphoribosyltransferase; Provisional 99.4
COG0461201 PyrE Orotate phosphoribosyltransferase [Nucleotide 99.4
PRK13811170 orotate phosphoribosyltransferase; Provisional 99.36
PRK13809206 orotate phosphoribosyltransferase; Provisional 99.35
PRK08558238 adenine phosphoribosyltransferase; Provisional 99.34
TIGR00336173 pyrE orotate phosphoribosyltransferase. The conser 99.33
PRK05500477 bifunctional orotidine 5'-phosphate decarboxylase/ 99.3
PF00156125 Pribosyltran: Phosphoribosyl transferase domain; I 99.28
PRK07322178 adenine phosphoribosyltransferase; Provisional 99.23
TIGR00201190 comF comF family protein. This protein is found in 99.19
PRK06031233 phosphoribosyltransferase; Provisional 99.19
PRK02277200 orotate phosphoribosyltransferase-like protein; Pr 99.16
TIGR01367187 pyrE_Therm orotate phosphoribosyltransferase, Ther 99.14
PRK00455202 pyrE orotate phosphoribosyltransferase; Validated 99.13
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Pr 99.11
TIGR01203166 HGPRTase hypoxanthine phosphoribosyltransferase. S 99.03
PLN02238189 hypoxanthine phosphoribosyltransferase 99.0
COG1040225 ComFC Predicted amidophosphoribosyltransferases [G 99.0
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleo 98.97
PRK05205176 bifunctional pyrimidine regulatory protein PyrR ur 98.96
PRK11595227 DNA utilization protein GntX; Provisional 98.95
PTZ00149241 hypoxanthine phosphoribosyltransferase; Provisiona 98.9
PRK15423178 hypoxanthine phosphoribosyltransferase; Provisiona 98.86
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisiona 98.77
PRK02269320 ribose-phosphate pyrophosphokinase; Provisional 98.71
PTZ00271211 hypoxanthine-guanine phosphoribosyltransferase; Pr 98.71
PRK00934285 ribose-phosphate pyrophosphokinase; Provisional 98.7
PLN02297326 ribose-phosphate pyrophosphokinase 98.68
PRK09246501 amidophosphoribosyltransferase; Provisional 98.67
PRK08525445 amidophosphoribosyltransferase; Provisional 98.67
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 98.65
PRK07272484 amidophosphoribosyltransferase; Provisional 98.64
TIGR01091207 upp uracil phosphoribosyltransferase. that include 98.64
PRK00129209 upp uracil phosphoribosyltransferase; Reviewed 98.61
PRK02458323 ribose-phosphate pyrophosphokinase; Provisional 98.6
PLN02440479 amidophosphoribosyltransferase 98.59
PRK00553332 ribose-phosphate pyrophosphokinase; Provisional 98.58
TIGR01134442 purF amidophosphoribosyltransferase. Alternate nam 98.57
PRK09177156 xanthine-guanine phosphoribosyltransferase; Valida 98.57
COG0462314 PrsA Phosphoribosylpyrophosphate synthetase [Nucle 98.57
COG0634178 Hpt Hypoxanthine-guanine phosphoribosyltransferase 98.57
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 98.56
PRK05793469 amidophosphoribosyltransferase; Provisional 98.56
PRK06781471 amidophosphoribosyltransferase; Provisional 98.55
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 98.54
PRK06388474 amidophosphoribosyltransferase; Provisional 98.52
PRK08341442 amidophosphoribosyltransferase; Provisional 98.51
PRK07349500 amidophosphoribosyltransferase; Provisional 98.51
PLN02541244 uracil phosphoribosyltransferase 98.5
PLN02369302 ribose-phosphate pyrophosphokinase 98.49
PRK07631475 amidophosphoribosyltransferase; Provisional 98.49
PTZ00145439 phosphoribosylpyrophosphate synthetase; Provisiona 98.47
PRK06827382 phosphoribosylpyrophosphate synthetase; Provisiona 98.47
PRK02812330 ribose-phosphate pyrophosphokinase; Provisional 98.45
TIGR01251308 ribP_PPkin ribose-phosphate pyrophosphokinase. In 98.39
PF14572184 Pribosyl_synth: Phosphoribosyl synthetase-associat 98.36
PRK09123479 amidophosphoribosyltransferase; Provisional 98.36
PRK07847510 amidophosphoribosyltransferase; Provisional 98.33
COG2065179 PyrR Pyrimidine operon attenuation protein/uracil 98.25
KOG3367216 consensus Hypoxanthine-guanine phosphoribosyltrans 98.0
COG2236192 Predicted phosphoribosyltransferases [General func 97.88
PF14681207 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V 97.81
COG1926220 Predicted phosphoribosyltransferases [General func 97.72
COG0035210 Upp Uracil phosphoribosyltransferase [Nucleotide t 97.72
PF15609191 PRTase_2: Phosphoribosyl transferase 97.59
KOG1448316 consensus Ribose-phosphate pyrophosphokinase [Nucl 97.31
COG0034470 PurF Glutamine phosphoribosylpyrophosphate amidotr 96.99
KOG0572474 consensus Glutamine phosphoribosylpyrophosphate am 96.65
KOG1017267 consensus Predicted uracil phosphoribosyltransfera 93.54
PF15610274 PRTase_3: PRTase ComF-like 91.73
KOG1503354 consensus Phosphoribosylpyrophosphate synthetase-a 89.62
>KOG1712 consensus Adenine phosphoribosyl transferases [Nucleotide transport and metabolism] Back     alignment and domain information 
Probab=99.84  E-value=5.7e-21  Score=132.33  Aligned_cols=72  Identities=47%  Similarity=0.736  Sum_probs=70.5

Q ss_pred             CCceeeeeeeeccccceeEEEEccccCCCCEEEEEeccccchHHHHHHHHHHhchhcCCCeEEEEEEEEecCCCC
Q 034952            3 PLGEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEFS   77 (78)
Q Consensus         3 ~pg~~i~~~y~~~~g~~~~~~~~~~~~~g~~vlIVDDvitTG~Ti~~~~~~l~~~~~~g~~~~~~~~~v~~~~~~   77 (78)
                      +||++++++|.+|||.+.+||+.+++.+|+||+||||+++||+|+.+|.+++.+.   |++++.|.|+++.++|+
T Consensus        94 LPG~~i~~~Y~lEYg~d~~Emq~~Ai~~g~rvvvVDDllATGGTl~AA~~Ll~r~---ga~vvE~~~vieL~~Lk  165 (183)
T KOG1712|consen   94 LPGEVISESYELEYGEDRFEMQKGAIKPGQRVVVVDDLLATGGTLAAATELLERV---GAEVVECACVIELPELK  165 (183)
T ss_pred             CCCceeEEEEeeecCccceeeeccccCCCCeEEEEechhhcCccHHHHHHHHHHh---ccEEEEEEEEEEccccC
Confidence            6999999999999999999999999999999999999999999999999999999   99999999999999885

>PLN02293 adenine phosphoribosyltransferase Back     alignment and domain information
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01744 XPRTase xanthine phosphoribosyltransferase Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01743 purR_Bsub pur operon repressor, Bacillus subtilis type Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase Back     alignment and domain information
>PRK09213 pur operon repressor; Provisional Back     alignment and domain information
>PRK09219 xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK12560 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13810 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13809 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>PF00156 Pribosyltran: Phosphoribosyl transferase domain; InterPro: IPR000836 The name PRT comes from phosphoribosyltransferase (PRTase) enzymes, which carry out phosphoryl transfer reactions on 5-phosphoribosyl-alpha1-pyrophosphate PRPP, an activated form of ribose-5-phosphate Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR00201 comF comF family protein Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>PLN02238 hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK11595 DNA utilization protein GntX; Provisional Back     alignment and domain information
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK15423 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PLN02297 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK09246 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08525 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK07272 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01091 upp uracil phosphoribosyltransferase Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PLN02440 amidophosphoribosyltransferase Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>TIGR01134 purF amidophosphoribosyltransferase Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK05793 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06781 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK06388 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08341 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PLN02541 uracil phosphoribosyltransferase Back     alignment and domain information
>PLN02369 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PF14572 Pribosyl_synth: Phosphoribosyl synthetase-associated domain; PDB: 2H07_B 2H06_B 3S5J_B 2HCR_A 3EFH_A 2H08_A 1DKR_B 1DKU_B 1IBS_B 2JI4_A Back     alignment and domain information
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07847 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3367 consensus Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PF14681 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C Back     alignment and domain information
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF15609 PRTase_2: Phosphoribosyl transferase Back     alignment and domain information
>KOG1448 consensus Ribose-phosphate pyrophosphokinase [Nucleotide transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0572 consensus Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1017 consensus Predicted uracil phosphoribosyltransferase [General function prediction only] Back     alignment and domain information
>PF15610 PRTase_3: PRTase ComF-like Back     alignment and domain information
>KOG1503 consensus Phosphoribosylpyrophosphate synthetase-associated protein [Amino acid transport and metabolism; Nucleotide transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query78
2dy0_A190 Crystal Structure Of Project Jw0458 From Escherichi 1e-11
1ore_A180 Human Adenine Phosphoribosyltransferase Length = 18 2e-09
>pdb|2DY0|A Chain A, Crystal Structure Of Project Jw0458 From Escherichia Coli Length = 190 Back     alignment and structure 
Iteration: 1

 Score = 65.1 bits (157), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 40/52 (76%)
Query: 6   EIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRF 57
           E ISE Y LEYG D +E+HV A++ G++ L+VDDL+ATGGT+ A ++L+ R 
Sbjct: 101 ETISETYDLEYGTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRL 152
>pdb|1ORE|A Chain A, Human Adenine Phosphoribosyltransferase Length = 180 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query78
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 3e-24
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 6e-24
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 2e-23
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 8e-21
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleot 2e-20
1o57_A291 PUR operon repressor; purine operon repressor, hel 4e-16
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabol 3e-14
1vch_A175 Phosphoribosyltransferase-related protein; structu 2e-06
1vdm_A153 Purine phosphoribosyltransferase; structural genom 1e-04
2xbu_A221 Hypoxanthine-guanine phosphoribosyltransferase; gl 2e-04
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Length = 190 Back     alignment and structure
 Score = 88.4 bits (220), Expect = 3e-24
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 4/65 (6%)

Query: 5   GEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLL----GRFVSF 60
            E ISE Y LEYG D +E+HV A++ G++ L+VDDL+ATGGT+ A ++L+    G     
Sbjct: 100 RETISETYDLEYGTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRLGGEVADA 159

Query: 61  NFHLE 65
            F + 
Sbjct: 160 AFIIN 164
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Length = 180 Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Length = 187 Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Length = 186 Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Length = 236 Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Length = 291 Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Length = 197 Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Length = 175 Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Length = 153 Back     alignment and structure
>2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Length = 221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query78
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 99.64
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 99.63
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleot 99.57
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 99.56
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 99.56
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabol 99.43
1o57_A291 PUR operon repressor; purine operon repressor, hel 99.42
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, o 99.36
1vch_A175 Phosphoribosyltransferase-related protein; structu 99.34
2p1z_A180 Phosphoribosyltransferase; STRU genomics, PSI-2, p 99.32
1vdm_A153 Purine phosphoribosyltransferase; structural genom 99.3
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid 99.3
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; 99.25
3ozf_A250 Hypoxanthine-guanine-xanthine phosphoribosyltrans; 99.24
2wns_A205 Orotate phosphoribosyltransferase; alternative spl 99.23
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; 99.23
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; 99.21
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; 99.2
1a3c_A181 PYRR, pyrimidine operon regulatory protein PYRR; t 99.19
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphori 99.19
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltrans 99.18
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HG 99.18
1lh0_A213 OMP synthase; loop closure, monomer closure, orota 99.18
1ufr_A181 TT1027, PYR mRNA-binding attenuation protein; pyri 99.17
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; pr 99.16
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; 99.14
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransfer 99.13
1w30_A201 PYRR bifunctional protein; transferase, glycosyltr 99.12
2ywu_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 99.1
1tc1_A220 Protein (hypoxanthine phosphoribosyltransferase); 99.1
3qw4_B453 UMP synthase; N-terminal orotidine monophosphate d 99.09
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.09
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.08
2jbh_A225 Phosphoribosyltransferase domain-containing prote; 99.07
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural 99.06
1wd5_A208 Hypothetical protein TT1426; structural genomics, 99.05
1z7g_A217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos 99.02
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; 98.89
2xbu_A221 Hypoxanthine-guanine phosphoribosyltransferase; gl 98.82
3lrt_A286 Ribose-phosphate pyrophosphokinase; phosphoribosyl 98.81
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy 98.76
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); 98.75
3acd_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 98.74
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; 98.69
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransfe 98.68
2e55_A208 Uracil phosphoribosyltransferase; structural genom 98.61
1ecf_A 504 Glutamine phosphoribosylpyrophosphate amidotransf; 98.59
2ehj_A208 Uracil phosphoribosyltransferase; structural genom 98.58
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated 98.57
3s5j_B326 Ribose-phosphate pyrophosphokinase 1; nucleotide s 98.56
3dah_A319 Ribose-phosphate pyrophosphokinase; pyrophosphoki 98.55
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structur 98.53
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salva 98.46
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosy 98.43
3dmp_A217 Uracil phosphoribosyltransferase; structural genom 98.3
1dqn_A230 Guanine phosphoribosyltransferase; protein-inhibit 98.29
1xtt_A216 Probable uracil phosphoribosyltransferase; tetrame 97.71
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
Probab=99.64  E-value=9.9e-16  Score=103.75  Aligned_cols=71  Identities=41%  Similarity=0.700  Sum_probs=63.0

Q ss_pred             CCceeeeeeeeccccceeEEEEccccCCCCEEEEEeccccchHHHHHHHHHHhchhcCCCeEEEEEEEEecCCC
Q 034952            3 PLGEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEF   76 (78)
Q Consensus         3 ~pg~~i~~~y~~~~g~~~~~~~~~~~~~g~~vlIVDDvitTG~Ti~~~~~~l~~~~~~g~~~~~~~~~v~~~~~   76 (78)
                      +|+..++..|..+|+.+.++++.....+|++||||||++|||+|+.+++++|+++   |++.+.+++++++.++
T Consensus        98 ~~~~~~~~~~~~~~~~~~~~v~~~~~~~gk~VLlVDDvitTG~Tl~~a~~~L~~~---Ga~~V~~~~l~~~~~~  168 (190)
T 2dy0_A           98 LPRETISETYDLEYGTDQLEIHVDAIKPGDKVLVVDDLLATGGTIEATVKLIRRL---GGEVADAAFIINLFDL  168 (190)
T ss_dssp             CCSCEEEEEEEETTEEEEEEEEGGGCCTTCEEEEEEEEESSCHHHHHHHHHHHHT---TCEEEEEEEEEEEGGG
T ss_pred             CCcccccceehhhcCceEEEEeccccCCcCEEEEEEccccchHHHHHHHHHHHHc---CCEEEEEEEEEEccCc
Confidence            3667788888888988888887556678999999999999999999999999999   9999999999998754
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Back     alignment and structure
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding P pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Back     alignment and structure
>1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Back     alignment and structure
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Back     alignment and structure
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} SCOP: c.61.1.0 Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Back     alignment and structure
>2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Back     alignment and structure
>3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Back     alignment and structure
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Back     alignment and structure
>3acd_A Hypoxanthine-guanine phosphoribosyltransferase; rossmann fold, structural genomics, NPPSFA; HET: IMP; 1.89A {Thermus thermophilus} PDB: 3acc_A* 3acb_A* Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Back     alignment and structure
>1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Back     alignment and structure
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
>3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Back     alignment and structure
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} SCOP: c.61.1.1 Back     alignment and structure
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 78
d1zn7a1178 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sap 1e-08
d1y0ba1191 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransfer 3e-07
d1vcha1174 c.61.1.1 (A:2-175) Putative phosphoribosyltransfer 6e-07
d1g2qa_178 c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Sacch 1e-06
d1l1qa_181 c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [Tax 1e-06
d1qb7a_236 c.61.1.1 (A:) Adenine PRTase {Leishmania donovani 8e-06
d1o57a2202 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C 9e-05
d1nula_150 c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {E 7e-04
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Adenine PRTase
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 47.0 bits (111), Expect = 1e-08
 Identities = 27/53 (50%), Positives = 37/53 (69%)

Query: 5   GEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRF 57
           G  +   YSLEYGK  +E+   A++ G+R ++VDDL+ATGGT+ AA  LLGR 
Sbjct: 92  GPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRL 144
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Length = 191 Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 178 Back     information, alignment and structure
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Length = 181 Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Length = 236 Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 202 Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Length = 150 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query78
d1zn7a1178 Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] 99.72
d1g2qa_178 Adenine PRTase {Baker's yeast (Saccharomyces cerev 99.72
d1l1qa_181 Adenine PRTase {Giardia lamblia [TaxId: 5741]} 99.65
d1o57a2202 Pur operon repressor (PurR), C-terminal domain {Ba 99.58
d1qb7a_236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 99.58
d1y0ba1191 Xanthine phosphoribosyltransferase {Bacillus subti 99.48
d2aeea1208 Orotate PRTase {Streptococcus pyogenes [TaxId: 131 99.36
d1vcha1174 Putative phosphoribosyltransferase TTHA1613 {Therm 99.3
d1lh0a_213 Orotate PRTase {Salmonella typhimurium [TaxId: 903 99.26
d1vdma1153 Pprobable purine phosphoribosyltransferase PH0095 99.19
d1wd5a_208 Putative phosphoribosyltransferase TT1426 (TTHA146 98.94
d1hgxa_173 Hypoxanthine-guanine-xanthine PRTase {Tritrichomon 98.79
d1yfza1178 Xanthine-guanine PRTase (XPRTase) {Thermoanaerobac 98.78
d1u9ya2129 Phosphoribosylpyrophosphate synthetase {Methanocal 98.77
d1tc1a_184 Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 569 98.77
d1ufra_178 Pyrimidine operon regulator PyrR {Thermus thermoph 98.72
d1pzma_183 Hypoxanthine-guanine-xanthine PRTase {Leishmania t 98.71
d2c4ka2184 PRPP synthetase-associated protein 1 {Human (Homo 98.71
d1cjba_228 Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium 98.7
d1z7ga1214 Hypoxanthine-guanine PRTase (HGPRTase) {Human (Hom 98.69
d1j7ja_172 Hypoxanthine PRTase {Salmonella typhimurium [TaxId 98.68
d1dkua2149 Phosphoribosylpyrophosphate synthetase {Bacillus s 98.66
d1w30a_182 Pyrimidine operon regulator PyrR {Mycobacterium tu 98.65
d1fsga_233 Hypoxanthine-guanine-xanthine PRTase {Toxoplasma g 98.65
d1a3ca_178 Pyrimidine operon regulator PyrR {Bacillus subtili 98.6
d1nula_150 Xanthine-guanine PRTase (XPRTase) {Escherichia col 98.19
d1o5oa_210 Uracil PRTase, Upp {Thermotoga maritima [TaxId: 23 97.97
d1i5ea_208 Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 97.96
d1xtta1215 Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId 97.89
d1v9sa1208 Uracil PRTase, Upp {Thermus thermophilus [TaxId: 2 97.87
d1dqna_230 Guanine PRTase {Giardia lamblia [TaxId: 5741]} 97.76
d1bd3a_224 Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811 97.7
d1gph11231 Glutamine PRPP amidotransferase, C-terminal domain 97.42
d1ecfa1243 Glutamine PRPP amidotransferase, C-terminal domain 97.12
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 90.75
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 88.47
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 87.86
d1mb3a_123 Cell division response regulator DivK {Caulobacter 85.97
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 84.97
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 84.95
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 83.51
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosyltransferases (PRTases)
domain: Adenine PRTase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.72  E-value=9.9e-18  Score=112.94  Aligned_cols=72  Identities=42%  Similarity=0.667  Sum_probs=67.3

Q ss_pred             CCceeeeeeeeccccceeEEEEccccCCCCEEEEEeccccchHHHHHHHHHHhchhcCCCeEEEEEEEEecCCCC
Q 034952            3 PLGEIISEEYSLEYGKDVMEMHVCAVQAGERALIVDDLVATGGTLFAAIRLLGRFVSFNFHLERCQKMVLLLEFS   77 (78)
Q Consensus         3 ~pg~~i~~~y~~~~g~~~~~~~~~~~~~g~~vlIVDDvitTG~Ti~~~~~~l~~~~~~g~~~~~~~~~v~~~~~~   77 (78)
                      .|++.++..|..+||...++++.+.+.+|+|||||||++|||+|+.+++++++++   |++++++++++|+.+++
T Consensus        90 ~~~~~~~~~~~~~~~~~~~~~~~~~i~~g~rVlIVDDviaTGgT~~a~~~ll~~~---Ga~vvg~~~ii~~~~~~  161 (178)
T d1zn7a1          90 LPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRL---QAEVLECVSLVELTSLK  161 (178)
T ss_dssp             CCSSEEEEEEEETTEEEEEEEETTSSCTTCEEEEEEEEESSSHHHHHHHHHHHHT---TCEEEEEEEEEEEGGGC
T ss_pred             CCccceeEEeeccccccceeeccCcccCCCeEEEehhhhhhchHHHHHHHHHHHC---CCEEEEEEEEEEcCcCC
Confidence            4678888999999999999999999999999999999999999999999999999   99999999999987653
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Back     information, alignment and structure
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} Back     information, alignment and structure
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} Back     information, alignment and structure
>d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure