Citrus Sinensis ID: 035014

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70------
MSILETQYSEDTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAPGEVRFVDTSSIPTYKQPASAVYKCLNPPNCN
ccEEEEEEEccEEEEEccccccHHHHHHHHHccccccccccccccccEEEEccccccccccccccEEEcccccccc
ccEEEEEccccEEEEEEcccccHHHHHHHHHcccHHHHcHcccccccEEEEcccccccccccccEEEEcccccccc
msiletqysedtviivspdsdnlSILQAGLIGldlrrhrelsfapgevrfvdtssiptykqpasavykclnppncn
msiletqysedtviivspdsdnlSILQAGLIGLDLRRHRELSFapgevrfvdtssiptykqpasavykclnppncn
MSILETQYSEDTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAPGEVRFVDTSSIPTYKQPASAVYKCLNPPNCN
**********DTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAPGEVRFVDTSSIPTYKQPASAVYKC*******
*SILETQYSEDTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAPGEVRFVDTSSIPTYKQPASAVYKCLNPP***
********SEDTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAPGEVRFVDTSSIPTYKQPASAVYKCLNPPNCN
*SILETQYSEDTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAPGEVRFVDTSSIPTYKQPASAVYKCLNPPNC*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSILETQYSEDTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAPGEVRFVDTSSIPTYKQPASAVYKCLNPPNCN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
224133510 229 predicted protein [Populus trichocarpa] 1.0 0.331 0.881 7e-33
255540695 295 phosphoglycerate mutase, putative [Ricin 1.0 0.257 0.842 1e-32
297733795 342 unnamed protein product [Vitis vinifera] 0.986 0.219 0.866 2e-32
449469527 298 PREDICTED: uncharacterized protein LOC10 1.0 0.255 0.868 2e-32
147839111 943 hypothetical protein VITISV_012749 [Viti 1.0 0.080 0.855 2e-32
359491250 297 PREDICTED: uncharacterized protein LOC10 0.986 0.252 0.866 2e-32
356513285 300 PREDICTED: uncharacterized protein LOC10 1.0 0.253 0.883 7e-32
357477375 315 hypothetical protein MTR_4g106970 [Medic 1.0 0.241 0.842 1e-30
357477373 300 hypothetical protein MTR_4g106970 [Medic 1.0 0.253 0.842 1e-30
297797267 295 phosphoglycerate/bisphosphoglycerate mut 1.0 0.257 0.802 4e-30
>gi|224133510|ref|XP_002321587.1| predicted protein [Populus trichocarpa] gi|222868583|gb|EEF05714.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 72/76 (94%)

Query: 1   MSILETQYSEDTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAPGEVRFVDTSSIPTYK 60
           MSILETQYSE+T+IIVSPDSDNL+ILQAGL+GLDLRRHR+LSFAPGEVRFVD S IPTYK
Sbjct: 154 MSILETQYSEETIIIVSPDSDNLTILQAGLVGLDLRRHRDLSFAPGEVRFVDISRIPTYK 213

Query: 61  QPASAVYKCLNPPNCN 76
           QPASAVYKC NPP CN
Sbjct: 214 QPASAVYKCRNPPICN 229

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255540695|ref|XP_002511412.1| phosphoglycerate mutase, putative [Ricinus communis] gi|223550527|gb|EEF52014.1| phosphoglycerate mutase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297733795|emb|CBI15042.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469527|ref|XP_004152471.1| PREDICTED: uncharacterized protein LOC101222124 [Cucumis sativus] Back     alignment and taxonomy information
>gi|147839111|emb|CAN68092.1| hypothetical protein VITISV_012749 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491250|ref|XP_002279799.2| PREDICTED: uncharacterized protein LOC100241599 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356513285|ref|XP_003525344.1| PREDICTED: uncharacterized protein LOC100813102 [Glycine max] Back     alignment and taxonomy information
>gi|357477375|ref|XP_003608973.1| hypothetical protein MTR_4g106970 [Medicago truncatula] gi|355510028|gb|AES91170.1| hypothetical protein MTR_4g106970 [Medicago truncatula] Back     alignment and taxonomy information
>gi|357477373|ref|XP_003608972.1| hypothetical protein MTR_4g106970 [Medicago truncatula] gi|355510027|gb|AES91169.1| hypothetical protein MTR_4g106970 [Medicago truncatula] Back     alignment and taxonomy information
>gi|297797267|ref|XP_002866518.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Arabidopsis lyrata subsp. lyrata] gi|297312353|gb|EFH42777.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
TAIR|locus:2170733297 AT5G62840 "AT5G62840" [Arabido 1.0 0.255 0.789 3.4e-29
TAIR|locus:2170733 AT5G62840 "AT5G62840" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 324 (119.1 bits), Expect = 3.4e-29, P = 3.4e-29
 Identities = 60/76 (78%), Positives = 67/76 (88%)

Query:     1 MSILETQYSEDTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAPGEVRFVDTSSIPTYK 60
             MSILETQYSEDT++IVSPDSDNLS+LQAG+ GLDLRRH EL F PGEVR +D +SIP YK
Sbjct:   222 MSILETQYSEDTIVIVSPDSDNLSVLQAGIQGLDLRRHSELYFGPGEVRLLDANSIPVYK 281

Query:    61 QPASAVYKCLNPPNCN 76
             QPASAVYKC  PPNC+
Sbjct:   282 QPASAVYKCKKPPNCD 297


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.317   0.134   0.388    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       76        76   0.00091  102 3  11 22  0.40    29
                                                     29  0.48    29


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  509 (54 KB)
  Total size of DFA:  93 KB (2068 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  8.16u 0.12s 8.28t   Elapsed:  00:00:01
  Total cpu time:  8.16u 0.12s 8.28t   Elapsed:  00:00:01
  Start:  Fri May 10 04:45:04 2013   End:  Fri May 10 04:45:05 2013
GO:0003824 "catalytic activity" evidence=ISS
GO:0008152 "metabolic process" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0016556 "mRNA modification" evidence=RCA
GO:0030154 "cell differentiation" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XV1465
hypothetical protein (229 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 76
PRK15004199 alpha-ribazole phosphatase; Provisional 98.04
TIGR03162177 ribazole_cobC alpha-ribazole phosphatase. Members 97.72
PRK03482215 phosphoglycerate mutase; Provisional 97.5
PRK14116228 gpmA phosphoglyceromutase; Provisional 97.4
TIGR03848204 MSMEG_4193 probable phosphomutase, MSMEG_4193 fami 97.34
PRK14120249 gpmA phosphoglyceromutase; Provisional 97.22
TIGR01258245 pgm_1 phosphoglycerate mutase, BPG-dependent, fami 97.18
PRK14117230 gpmA phosphoglyceromutase; Provisional 97.08
PRK13462203 acid phosphatase; Provisional 97.07
cd07067153 HP_PGM_like Histidine phosphatase domain found in 97.02
COG0406208 phoE Broad specificity phosphatase PhoE and relate 97.02
PRK14115247 gpmA phosphoglyceromutase; Provisional 97.01
PRK14118227 gpmA phosphoglyceromutase; Provisional 97.01
PTZ00123236 phosphoglycerate mutase like-protein; Provisional 96.99
PRK01295206 phosphoglyceromutase; Provisional 96.87
PRK07238372 bifunctional RNase H/acid phosphatase; Provisional 96.8
PRK14119228 gpmA phosphoglyceromutase; Provisional 96.79
PRK01112228 phosphoglyceromutase; Provisional 96.51
PRK13463203 phosphatase PhoE; Provisional 96.43
PTZ00122299 phosphoglycerate mutase; Provisional 95.41
cd07040153 HP Histidine phosphatase domain found in a functio 95.04
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 84.55
TIGR00249152 sixA phosphohistidine phosphatase SixA. 82.91
>PRK15004 alpha-ribazole phosphatase; Provisional Back     alignment and domain information 
Probab=98.04  E-value=2.8e-06  Score=58.05  Aligned_cols=51  Identities=24%  Similarity=0.264  Sum_probs=46.8

Q ss_pred             ccceeeecCeEEEEcCCCCcHHHHHHHhhCCcccccccccccCceeEEeecC
Q 035014            3 ILETQYSEDTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAPGEVRFVDTS   54 (76)
Q Consensus         3 ~LEtqYsGetIllVSpdgD~LsiL~a~l~G~dLrrHre~~f~pgEVR~vd~~   54 (76)
                      .+++++.+++||||+| |..+.+|.+.++|+++.+..++.+.+|.+..+++.
T Consensus       134 ~l~~~~~~~~iliVsH-g~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~  184 (199)
T PRK15004        134 RLSAFQHYQNLLIVSH-QGVLSLLIARLLGMPAEAMWHFRVEQGCWSAIDIN  184 (199)
T ss_pred             HHHHhCCCCeEEEEcC-hHHHHHHHHHHhCCCHHHHhccccCCceEEEEEec
Confidence            4667788999999999 99999999999999999988899999999999885

>TIGR03162 ribazole_cobC alpha-ribazole phosphatase Back     alignment and domain information
>PRK03482 phosphoglycerate mutase; Provisional Back     alignment and domain information
>PRK14116 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>PRK14120 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>PRK14117 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK13462 acid phosphatase; Provisional Back     alignment and domain information
>cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>PRK14115 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14118 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PTZ00123 phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>PRK01295 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>PRK14119 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK01112 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK13463 phosphatase PhoE; Provisional Back     alignment and domain information
>PTZ00122 phosphoglycerate mutase; Provisional Back     alignment and domain information
>cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>TIGR00249 sixA phosphohistidine phosphatase SixA Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 97.64
3f3k_A265 Uncharacterized protein YKR043C; structural genomi 97.44
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 97.33
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 97.32
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 97.27
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 97.24
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 97.16
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 97.12
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 97.07
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 96.98
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 96.96
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 96.93
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 96.9
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 96.86
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 96.8
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold 96.78
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 96.78
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 96.72
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 96.72
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 96.56
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha- 96.43
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 96.27
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 95.62
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 94.86
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 94.5
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 94.29
3f2i_A172 ALR0221 protein; alpha-beta protein, structural ge 94.09
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 92.49
3fjy_A364 Probable MUTT1 protein; dimer, protein structure i 91.66
3dcy_A275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 85.48
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Back     alignment and structure
Probab=97.64  E-value=4e-05  Score=50.56  Aligned_cols=47  Identities=11%  Similarity=0.155  Sum_probs=43.3

Q ss_pred             eeecCeEEEEcCCCCcHHHHHHHhhCCcccccccccccCceeEEeecC
Q 035014            7 QYSEDTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAPGEVRFVDTS   54 (76)
Q Consensus         7 qYsGetIllVSpdgD~LsiL~a~l~G~dLrrHre~~f~pgEVR~vd~~   54 (76)
                      ++.|++||||+| |..+..|.+.+.|.|+....++.+..|+|..+++.
T Consensus       132 ~~~~~~vlvVsH-g~~ir~ll~~llg~~~~~~~~~~~~n~si~~l~~~  178 (202)
T 3mxo_A          132 QEEDSYEIFICH-ANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIR  178 (202)
T ss_dssp             CCSCEEEEEEEC-HHHHHHHHHHHTTCCGGGGGGBCCCTTCEEEEEEC
T ss_pred             cCCCceEEEEeC-HHHHHHHHHHHhCCCHHHHhhcccCCceEEEEEEc
Confidence            356889999999 99999999999999999988999999999999886
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Back     alignment and structure
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
d1h2ea_207 Broad specificity phosphatase PhoE (YhfR) {Bacillu 97.51
d2hhja1248 Phosphoglycerate mutase {Human (Homo sapiens) [Tax 97.29
d1qhfa_240 Phosphoglycerate mutase {Baker's yeast (Saccharomy 97.06
d1xq9a_241 Phosphoglycerate mutase {Plasmodium falciparum [Ta 96.83
d1riia_243 Phosphoglycerate mutase {Mycobacterium tuberculosi 96.77
d1e58a_247 Phosphoglycerate mutase {Escherichia coli [TaxId: 96.74
d1fzta_211 Phosphoglycerate mutase {Fission yeast (Schizosacc 96.22
d1bifa2219 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.2
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphoglycerate mutase-like
superfamily: Phosphoglycerate mutase-like
family: Cofactor-dependent phosphoglycerate mutase
domain: Broad specificity phosphatase PhoE (YhfR)
species: Bacillus stearothermophilus [TaxId: 1422]

Probab=97.51  E-value=2.2e-05  Score=50.05  Aligned_cols=50  Identities=18%  Similarity=0.212  Sum_probs=40.2

Q ss_pred             cceeeecCeEEEEcCCCCcHHHHHHHhhCCcccccccccccC-ceeEEeecC
Q 035014            4 LETQYSEDTVIIVSPDSDNLSILQAGLIGLDLRRHRELSFAP-GEVRFVDTS   54 (76)
Q Consensus         4 LEtqYsGetIllVSpdgD~LsiL~a~l~G~dLrrHre~~f~p-gEVR~vd~~   54 (76)
                      |..+++|++|||||| |..+..+.+.+.|+++.+.....+-+ +.|..+++.
T Consensus       136 l~~~~~~~~vlvVsH-g~~i~~l~~~l~~~~~~~~~~~~~~~n~sit~~~~~  186 (207)
T d1h2ea_         136 IVDRHEGETVLIVTH-GVVLKTLMAAFKDTPLDHLWSPPYMYGTSVTIIEVD  186 (207)
T ss_dssp             HHHHCTTCEEEEEEC-HHHHHHHHHHHTTCCGGGTTCSCCCCTTCEEEEEEE
T ss_pred             hhhccCCCeEEEEEC-HHHHHHHHHHHhCCCHHHHhhccCCCCceEEEEEEE
Confidence            445689999999999 99999999999999998876654433 677777653
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure