Citrus Sinensis ID: 035032
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| 147779823 | 70 | hypothetical protein VITISV_002769 [Viti | 0.8 | 0.857 | 0.65 | 2e-13 | |
| 359479809 | 70 | PREDICTED: uncharacterized protein LOC10 | 0.8 | 0.857 | 0.633 | 6e-13 | |
| 255559486 | 69 | conserved hypothetical protein [Ricinus | 0.6 | 0.652 | 0.8 | 1e-12 | |
| 224082618 | 77 | predicted protein [Populus trichocarpa] | 0.52 | 0.506 | 0.794 | 1e-09 | |
| 15231209 | 64 | outer envelope membrane protein 7 [Arabi | 0.573 | 0.671 | 0.674 | 2e-09 | |
| 297816518 | 64 | hypothetical protein ARALYDRAFT_485609 [ | 0.573 | 0.671 | 0.674 | 3e-09 | |
| 388512115 | 71 | unknown [Medicago truncatula] | 0.573 | 0.605 | 0.697 | 9e-09 | |
| 315178134 | 76 | chloroplast outer envelope protein 8 [Su | 0.506 | 0.5 | 0.657 | 1e-06 | |
| 357137289 | 126 | PREDICTED: uncharacterized protein LOC10 | 0.586 | 0.349 | 0.511 | 4e-06 | |
| 115448293 | 101 | Os02g0715400 [Oryza sativa Japonica Grou | 0.586 | 0.435 | 0.488 | 2e-05 |
| >gi|147779823|emb|CAN77097.1| hypothetical protein VITISV_002769 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 79.7 bits (195), Expect = 2e-13, Method: Compositional matrix adjust.
Identities = 39/60 (65%), Positives = 44/60 (73%)
Query: 1 MKKALTVVGALAFGWLAIELALKPFLDKVRAAMDKSDPARDPDDAVEGSNEASSESDDAA 60
+K + V GALAFGWLAIELA KPFLDK R+A+DKSDP RDPDD +G S SDD A
Sbjct: 10 LKSVMVVFGALAFGWLAIELAFKPFLDKARSALDKSDPTRDPDDDEDGGTTQRSLSDDEA 69
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359479809|ref|XP_003632356.1| PREDICTED: uncharacterized protein LOC100854564 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255559486|ref|XP_002520763.1| conserved hypothetical protein [Ricinus communis] gi|223540148|gb|EEF41725.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224082618|ref|XP_002306767.1| predicted protein [Populus trichocarpa] gi|222856216|gb|EEE93763.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15231209|ref|NP_190810.1| outer envelope membrane protein 7 [Arabidopsis thaliana] gi|4886285|emb|CAB43440.1| outer envelope membrane protein-like protein [Arabidopsis thaliana] gi|34365645|gb|AAQ65134.1| At3g52420 [Arabidopsis thaliana] gi|51968692|dbj|BAD43038.1| outer envelope membrane protein-like protein [Arabidopsis thaliana] gi|51969766|dbj|BAD43575.1| outer envelope membrane protein-like protein [Arabidopsis thaliana] gi|332645423|gb|AEE78944.1| outer envelope membrane protein 7 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297816518|ref|XP_002876142.1| hypothetical protein ARALYDRAFT_485609 [Arabidopsis lyrata subsp. lyrata] gi|297321980|gb|EFH52401.1| hypothetical protein ARALYDRAFT_485609 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|388512115|gb|AFK44119.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|315178134|gb|ADT82942.1| chloroplast outer envelope protein 8 [Suaeda salsa] | Back alignment and taxonomy information |
|---|
| >gi|357137289|ref|XP_003570233.1| PREDICTED: uncharacterized protein LOC100835108 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|115448293|ref|NP_001047926.1| Os02g0715400 [Oryza sativa Japonica Group] gi|42408032|dbj|BAD09168.1| unknown protein [Oryza sativa Japonica Group] gi|113537457|dbj|BAF09840.1| Os02g0715400 [Oryza sativa Japonica Group] gi|125540891|gb|EAY87286.1| hypothetical protein OsI_08689 [Oryza sativa Indica Group] gi|125583456|gb|EAZ24387.1| hypothetical protein OsJ_08142 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| TAIR|locus:2079929 | 64 | OEP7 "AT3G52420" [Arabidopsis | 0.573 | 0.671 | 0.674 | 5e-12 | |
| TAIR|locus:2077224 | 69 | OEP6 "AT3G63160" [Arabidopsis | 0.453 | 0.492 | 0.588 | 1.9e-05 | |
| TAIR|locus:505006290 | 81 | AT2G34585 "AT2G34585" [Arabido | 0.626 | 0.580 | 0.428 | 3e-05 |
| TAIR|locus:2079929 OEP7 "AT3G52420" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 162 (62.1 bits), Expect = 5.0e-12, P = 5.0e-12
Identities = 29/43 (67%), Positives = 36/43 (83%)
Query: 2 KKALTVVGALAFGWLAIELALKPFLDKVRAAMDKSDPARDPDD 44
K+A VV A+A GWLAIE+A KPFLDK R+++DKSDP +DPDD
Sbjct: 8 KQATVVVAAMALGWLAIEIAFKPFLDKFRSSIDKSDPTKDPDD 50
|
|
| TAIR|locus:2077224 OEP6 "AT3G63160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006290 AT2G34585 "AT2G34585" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
No hit with probability above 80.00
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00