Citrus Sinensis ID: 035166


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-
MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSEMGIEGSASPSLPSKSNDGPDQGSQ
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccc
MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSemgiegsaspslpsksndgpdqgsq
MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSEMGIegsaspslpsksndgpdqgsq
MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSEMGIEGSASPSLPSKSNDGPDQGSQ
***********************************************************************
MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSIND****************************
MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSEMGIE********************
MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSEM***********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAFVQNLLQQMQSRFQTMSESIIAKxxxxxxxxxxxxxxxxxxxxxMGIEGSASPSLPSKSNDGPDQGSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query71 2.2.26 [Sep-21-2011]
Q3ZC2276 Heat shock factor-binding yes no 0.718 0.671 0.588 4e-11
O7550676 Heat shock factor-binding yes no 0.718 0.671 0.588 5e-11
Q5RDI276 Heat shock factor-binding yes no 0.718 0.671 0.588 5e-11
Q8K3X876 Heat shock factor-binding yes no 0.718 0.671 0.549 1e-09
Q9CQZ176 Heat shock factor-binding yes no 0.718 0.671 0.549 1e-09
D4A9E172 Heat shock factor-binding no no 0.676 0.666 0.375 3e-05
C9JCN974 Heat shock factor-binding no no 0.676 0.648 0.375 8e-05
B2RXB272 Heat shock factor-binding no no 0.676 0.666 0.375 8e-05
>sp|Q3ZC22|HSBP1_BOVIN Heat shock factor-binding protein 1 OS=Bos taurus GN=HSBP1 PE=3 SV=1 Back     alignment and function desciption
 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 42/51 (82%)

Query: 1  MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSEMGIE 51
          +T+ VQ LLQQMQ +FQTMS+ II +ID+M SRID+LE++I DL ++ G+E
Sbjct: 12 LTSVVQTLLQQMQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVE 62




Negative regulator of the heat shock response. Negatively affects HSF1 DNA-binding activity. May have a role in the suppression of the activation of the stress response during the aging process.
Bos taurus (taxid: 9913)
>sp|O75506|HSBP1_HUMAN Heat shock factor-binding protein 1 OS=Homo sapiens GN=HSBP1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RDI2|HSBP1_PONAB Heat shock factor-binding protein 1 OS=Pongo abelii GN=HSBP1 PE=3 SV=1 Back     alignment and function description
>sp|Q8K3X8|HSBP1_RAT Heat shock factor-binding protein 1 OS=Rattus norvegicus GN=Hsbp1 PE=3 SV=1 Back     alignment and function description
>sp|Q9CQZ1|HSBP1_MOUSE Heat shock factor-binding protein 1 OS=Mus musculus GN=Hsbp1 PE=2 SV=1 Back     alignment and function description
>sp|D4A9E1|HSBPL_RAT Heat shock factor-binding protein 1-like protein 1 OS=Rattus norvegicus GN=Hsbp1l1 PE=3 SV=1 Back     alignment and function description
>sp|C9JCN9|HSBPL_HUMAN Heat shock factor-binding protein 1-like protein 1 OS=Homo sapiens GN=HSBP1L1 PE=3 SV=2 Back     alignment and function description
>sp|B2RXB2|HSBPL_MOUSE Heat shock factor-binding protein 1-like protein 1 OS=Mus musculus GN=Hsbp1l1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
11848390488 unknown [Populus trichocarpa] gi|1184899 0.985 0.795 0.771 9e-24
22410733388 predicted protein [Populus trichocarpa] 0.985 0.795 0.771 1e-23
22411893673 predicted protein [Populus trichocarpa] 0.985 0.958 0.757 1e-22
35653532188 PREDICTED: heat shock factor-binding pro 0.859 0.693 0.786 8e-21
356502856123 PREDICTED: uncharacterized protein LOC10 0.859 0.495 0.786 8e-21
25564078588 unknown [Glycine max] 0.859 0.693 0.786 1e-20
38852228787 unknown [Lotus japonicus] 0.859 0.701 0.803 1e-20
25562677788 unknown [Glycine max] 0.845 0.681 0.783 3e-20
35650389892 PREDICTED: heat shock factor-binding pro 0.859 0.663 0.803 4e-20
24025588086 heat shock factor binding protein [Arabi 0.901 0.744 0.757 4e-20
>gi|118483904|gb|ABK93842.1| unknown [Populus trichocarpa] gi|118489953|gb|ABK96773.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
 Score =  114 bits (284), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 62/70 (88%)

Query: 1  MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSEMGIEGSASPSLPS 60
          MTAFVQNLLQQMQSRFQTMS+SI+ KIDEMG+RIDELEQSINDLR+EMG+EGS SPS+P 
Sbjct: 16 MTAFVQNLLQQMQSRFQTMSDSIVTKIDEMGNRIDELEQSINDLRTEMGVEGSPSPSVPP 75

Query: 61 KSNDGPDQGS 70
          K  + P  G+
Sbjct: 76 KVKEEPKPGN 85




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224107333|ref|XP_002314449.1| predicted protein [Populus trichocarpa] gi|222863489|gb|EEF00620.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224118936|ref|XP_002331340.1| predicted protein [Populus trichocarpa] gi|222873373|gb|EEF10504.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356535321|ref|XP_003536195.1| PREDICTED: heat shock factor-binding protein 1 [Glycine max] Back     alignment and taxonomy information
>gi|356502856|ref|XP_003520231.1| PREDICTED: uncharacterized protein LOC100800401 [Glycine max] Back     alignment and taxonomy information
>gi|255640785|gb|ACU20676.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388522287|gb|AFK49205.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255626777|gb|ACU13733.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356503898|ref|XP_003520737.1| PREDICTED: heat shock factor-binding protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|240255880|ref|NP_849392.4| heat shock factor binding protein [Arabidopsis thaliana] gi|26453171|dbj|BAC43661.1| unknown protein [Arabidopsis thaliana] gi|28416759|gb|AAO42910.1| At4g15810 [Arabidopsis thaliana] gi|332658254|gb|AEE83654.1| heat shock factor binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
TAIR|locus:100571631586 HSBP "heat shock factor bindin 0.901 0.744 0.757 8e-21
ZFIN|ZDB-GENE-040426-172176 hsbp1b "heat shock factor bind 0.718 0.671 0.607 5e-12
ZFIN|ZDB-GENE-050320-13677 hsbp1a "heat shock factor bind 0.718 0.662 0.588 6.4e-12
UNIPROTKB|Q3ZC2276 HSBP1 "Heat shock factor-bindi 0.718 0.671 0.588 1e-11
UNIPROTKB|O7550676 HSBP1 "Heat shock factor-bindi 0.718 0.671 0.588 1e-11
DICTYBASE|DDB_G0274013102 DDB_G0274013 "heat shock facto 0.563 0.392 0.725 9.4e-11
DICTYBASE|DDB_G0272620102 DDB_G0272620 "heat shock facto 0.563 0.392 0.725 9.4e-11
RGD|62863276 Hsbp1 "heat shock factor bindi 0.845 0.789 0.491 1.5e-10
MGI|MGI:191544676 Hsbp1 "heat shock factor bindi 0.718 0.671 0.549 2e-10
UNIPROTKB|Q9U3B780 hsb-1 "Protein HSB-1" [Caenorh 0.718 0.637 0.509 3.6e-09
TAIR|locus:1005716315 HSBP "heat shock factor binding protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 245 (91.3 bits), Expect = 8.0e-21, P = 8.0e-21
 Identities = 50/66 (75%), Positives = 58/66 (87%)

Query:     1 MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSEMGIEGSASPSLPS 60
             MTAFVQNLLQQMQ+RFQTMS+SII KID+MG RI+ELEQSINDLR+EMG+EG+  P+  S
Sbjct:    16 MTAFVQNLLQQMQTRFQTMSDSIITKIDDMGGRINELEQSINDLRAEMGVEGTPPPA--S 73

Query:    61 KSNDGP 66
             KS D P
Sbjct:    74 KSGDEP 79




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005829 "cytosol" evidence=IDA
GO:0009408 "response to heat" evidence=IMP
GO:0031072 "heat shock protein binding" evidence=IPI
GO:0048316 "seed development" evidence=IMP
GO:0070370 "cellular heat acclimation" evidence=IMP
GO:0005794 "Golgi apparatus" evidence=IDA
ZFIN|ZDB-GENE-040426-1721 hsbp1b "heat shock factor binding protein 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050320-136 hsbp1a "heat shock factor binding protein 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZC22 HSBP1 "Heat shock factor-binding protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O75506 HSBP1 "Heat shock factor-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0274013 DDB_G0274013 "heat shock factor-binding protein 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0272620 DDB_G0272620 "heat shock factor-binding protein 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|628632 Hsbp1 "heat shock factor binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1915446 Hsbp1 "heat shock factor binding protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9U3B7 hsb-1 "Protein HSB-1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8K3X8HSBP1_RATNo assigned EC number0.54900.71830.6710yesno
O75506HSBP1_HUMANNo assigned EC number0.58820.71830.6710yesno
Q3ZC22HSBP1_BOVINNo assigned EC number0.58820.71830.6710yesno
Q9CQZ1HSBP1_MOUSENo assigned EC number0.54900.71830.6710yesno
Q5RDI2HSBP1_PONABNo assigned EC number0.58820.71830.6710yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_kg.C_LG_X0008
SubName- Full=Putative uncharacterized protein; (89 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
pfam0682554 pfam06825, HSBP1, Heat shock factor binding protei 8e-18
PRK12830 417 PRK12830, PRK12830, UDP-N-acetylglucosamine 1-carb 0.003
>gnl|CDD|148437 pfam06825, HSBP1, Heat shock factor binding protein 1 Back     alignment and domain information
 Score = 68.8 bits (169), Expect = 8e-18
 Identities = 36/51 (70%), Positives = 46/51 (90%)

Query: 1  MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSEMGIE 51
          +TAFVQNLLQQMQ++FQTMS++I++KIDEM  RIDELE+SINDL  + G+E
Sbjct: 4  LTAFVQNLLQQMQTKFQTMSDNILSKIDEMSKRIDELEKSINDLMQQAGVE 54


Heat shock factor binding protein 1 (HSBP1) appears to be a negative regulator of the heat shock response. Length = 54

>gnl|CDD|183779 PRK12830, PRK12830, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 71
KOG411773 consensus Heat shock factor binding protein [Trans 99.97
PF0682554 HSBP1: Heat shock factor binding protein 1; InterP 99.96
PF1039347 Matrilin_ccoil: Trimeric coiled-coil oligomerisati 94.57
COG3937108 Uncharacterized conserved protein [Function unknow 94.33
PF06705 247 SF-assemblin: SF-assemblin/beta giardin 92.14
TIGR01834320 PHA_synth_III_E poly(R)-hydroxyalkanoic acid synth 91.36
PF01601 610 Corona_S2: Coronavirus S2 glycoprotein; InterPro: 90.87
TIGR01837118 PHA_granule_1 poly(hydroxyalkanoate) granule-assoc 90.21
PRK13182175 racA polar chromosome segregation protein; Reviewe 88.87
PF1426159 DUF4351: Domain of unknown function (DUF4351) 88.45
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 88.35
PF07304157 SRA1: Steroid receptor RNA activator (SRA1); Inter 88.21
PF01519102 DUF16: Protein of unknown function DUF16; InterPro 87.47
PF05597132 Phasin: Poly(hydroxyalcanoate) granule associated 87.38
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 87.34
PF1004699 BLOC1_2: Biogenesis of lysosome-related organelles 86.7
PF1077971 XhlA: Haemolysin XhlA; InterPro: IPR019715 Haemoly 86.67
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 84.72
PF04513140 Baculo_PEP_C: Baculovirus polyhedron envelope prot 83.53
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 83.38
PF09712293 PHA_synth_III_E: Poly(R)-hydroxyalkanoic acid synt 81.6
PF1374789 DUF4164: Domain of unknown function (DUF4164) 81.5
PF10158131 LOH1CR12: Tumour suppressor protein; InterPro: IPR 80.78
PF0450823 Pox_A_type_inc: Viral A-type inclusion protein rep 80.41
PF0682554 HSBP1: Heat shock factor binding protein 1; InterP 80.36
PF10158131 LOH1CR12: Tumour suppressor protein; InterPro: IPR 80.28
>KOG4117 consensus Heat shock factor binding protein [Transcription; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.97  E-value=1.1e-31  Score=170.38  Aligned_cols=56  Identities=54%  Similarity=0.799  Sum_probs=54.4

Q ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHhhccCCCCCC
Q 035166            1 MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSINDLRSEMGIEGSASP   56 (71)
Q Consensus         1 lT~~Vq~LLqqmQ~kFq~MS~~I~~riDdMg~RIDdLEksI~dLm~qaG~e~~~~~   56 (71)
                      ||.+||+||||.|+|||+||++|++||||||+|||||||||+|||+|+|||++++.
T Consensus        17 LTs~vQ~lLQq~QDkFQtMSDQII~RiDDM~~riDDLEKnIaDLm~qagvE~~~s~   72 (73)
T KOG4117|consen   17 LTSVVQGLLQQTQDKFQTMSDQIIGRIDDMSSRIDDLEKNIADLMTQAGVEELESE   72 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHccccCCCCC
Confidence            68999999999999999999999999999999999999999999999999999875



>PF06825 HSBP1: Heat shock factor binding protein 1; InterPro: IPR009643 Heat shock factor binding protein 1 (HSBP1) appears to be a negative regulator of the heat shock response [] Back     alignment and domain information
>PF10393 Matrilin_ccoil: Trimeric coiled-coil oligomerisation domain of matrilin; InterPro: IPR019466 This entry represents a short domain found the matrilin (cartilage matrix) proteins Back     alignment and domain information
>COG3937 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06705 SF-assemblin: SF-assemblin/beta giardin Back     alignment and domain information
>TIGR01834 PHA_synth_III_E poly(R)-hydroxyalkanoic acid synthase, class III, PhaE subunit Back     alignment and domain information
>PF01601 Corona_S2: Coronavirus S2 glycoprotein; InterPro: IPR002552 The type I glycoprotein S of Coronavirus, trimers of which constitute the typical viral spikes, is assembled into virions through noncovalent interactions with the M protein Back     alignment and domain information
>TIGR01837 PHA_granule_1 poly(hydroxyalkanoate) granule-associated protein Back     alignment and domain information
>PRK13182 racA polar chromosome segregation protein; Reviewed Back     alignment and domain information
>PF14261 DUF4351: Domain of unknown function (DUF4351) Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PF07304 SRA1: Steroid receptor RNA activator (SRA1); InterPro: IPR009917 This entry consists of several hypothetical mammalian steroid receptor RNA activator proteins Back     alignment and domain information
>PF01519 DUF16: Protein of unknown function DUF16; InterPro: IPR002862 Proteins that contain this domain are of unknown function Back     alignment and domain information
>PF05597 Phasin: Poly(hydroxyalcanoate) granule associated protein (phasin); InterPro: IPR008769 Polyhydroxyalkanoates (PHAs) are storage polyesters synthesised by various bacteria as intracellular carbon and energy reserve material Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF10046 BLOC1_2: Biogenesis of lysosome-related organelles complex-1 subunit 2 ; InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [] Back     alignment and domain information
>PF10779 XhlA: Haemolysin XhlA; InterPro: IPR019715 Haemolysin XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes [] Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF04513 Baculo_PEP_C: Baculovirus polyhedron envelope protein, PEP, C terminus ; InterPro: IPR007601 Polyhedra are large crystalline occlusion bodies containing nucleopolyhedrovirus virions, and surrounded by an electron-dense structure called the polyhedron envelope or polyhedron calyx Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>PF09712 PHA_synth_III_E: Poly(R)-hydroxyalkanoic acid synthase subunit (PHA_synth_III_E) Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF10158 LOH1CR12: Tumour suppressor protein; InterPro: IPR018780 This entry represents a region of 130 amino acids that is the most conserved part of some hypothetical proteins involved in loss of heterozygosity, and thus, tumour suppression [] Back     alignment and domain information
>PF04508 Pox_A_type_inc: Viral A-type inclusion protein repeat ; InterPro: IPR007596 The repeat is found in the A-type inclusion protein of the Poxvirus family [] Back     alignment and domain information
>PF06825 HSBP1: Heat shock factor binding protein 1; InterPro: IPR009643 Heat shock factor binding protein 1 (HSBP1) appears to be a negative regulator of the heat shock response [] Back     alignment and domain information
>PF10158 LOH1CR12: Tumour suppressor protein; InterPro: IPR018780 This entry represents a region of 130 amino acids that is the most conserved part of some hypothetical proteins involved in loss of heterozygosity, and thus, tumour suppression [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
3ci9_A48 Crystal Structure Of The Human Hsbp1 Length = 48 5e-09
>pdb|3CI9|A Chain A, Crystal Structure Of The Human Hsbp1 Length = 48 Back     alignment and structure

Iteration: 1

Score = 55.8 bits (133), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 25/41 (60%), Positives = 35/41 (85%) Query: 1 MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSI 41 +T+ VQ LLQQMQ +FQT+S+ II +ID+M SRID+LE++I Sbjct: 7 LTSVVQTLLQQMQDKFQTISDQIIGRIDDMSSRIDDLEKNI 47

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
3ci9_A48 Heat shock factor-binding protein 1; triple helix, 4e-15
>3ci9_A Heat shock factor-binding protein 1; triple helix, nucleus, transcription; 1.80A {Homo sapiens} Length = 48 Back     alignment and structure
 Score = 61.4 bits (149), Expect = 4e-15
 Identities = 25/41 (60%), Positives = 35/41 (85%)

Query: 1  MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSI 41
          +T+ VQ LLQQMQ +FQT+S+ II +ID+M SRID+LE++I
Sbjct: 7  LTSVVQTLLQQMQDKFQTISDQIIGRIDDMSSRIDDLEKNI 47


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
3ci9_A48 Heat shock factor-binding protein 1; triple helix, 99.93
2bez_C77 E2 glycoprotein; coiled coil, membrane fusion, sev 95.62
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 94.76
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 93.11
1wyy_A149 E2 glycoprotein; membrane fusion, severe acute res 93.1
2pnv_A43 Small conductance calcium-activated potassium chan 93.06
2pnv_A43 Small conductance calcium-activated potassium chan 90.96
1aq5_A47 Matrilin-1, CMP, cartilage matrix protein; coiled- 90.41
2ieq_A109 S glycoprotein, spike glycoprotein, peplomer prote 88.1
3ci9_A48 Heat shock factor-binding protein 1; triple helix, 88.03
3n06_A186 Prolactin, PRL; PH dependence, hematopoietic cytok 87.02
1pzq_A60 Erythronolide synthase; four helix bundle, homodim 86.56
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 85.39
3te3_A39 Polycystic kidney disease 2-like 1 protein; trimer 85.23
4gif_A45 Polycystic kidney disease 2-like 1 protein; coiled 83.06
>3ci9_A Heat shock factor-binding protein 1; triple helix, nucleus, transcription; 1.80A {Homo sapiens} Back     alignment and structure
Probab=99.93  E-value=1e-26  Score=136.74  Aligned_cols=42  Identities=60%  Similarity=0.918  Sum_probs=37.4

Q ss_pred             ChHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHH
Q 035166            1 MTAFVQNLLQQMQSRFQTMSESIIAKIDEMGSRIDELEQSIN   42 (71)
Q Consensus         1 lT~~Vq~LLqqmQ~kFq~MS~~I~~riDdMg~RIDdLEksI~   42 (71)
                      ||+|||+||+|||+||++||++|++||||||+|||+||+||+
T Consensus         7 Lt~~vq~LL~qmq~kFq~mS~~I~~riDdM~~RIDdLE~si~   48 (48)
T 3ci9_A            7 LTSVVQTLLQQMQDKFQTISDQIIGRIDDMSSRIDDLEKNIA   48 (48)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC----
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHhhcC
Confidence            689999999999999999999999999999999999999985



>2bez_C E2 glycoprotein; coiled coil, membrane fusion, severe acute respiratory syndrome, viral protein; 1.6A {Sars coronavirus} SCOP: h.3.3.1 PDB: 1zv8_A 1zvb_A Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>1wyy_A E2 glycoprotein; membrane fusion, severe acute respiratory syndrome, viral PR; 2.20A {Sars coronavirus} SCOP: h.3.3.1 PDB: 1wnc_A 2fxp_A Back     alignment and structure
>2pnv_A Small conductance calcium-activated potassium channel protein 2; leucine zipper, SKCA channel, membrane protein; 2.10A {Rattus norvegicus} Back     alignment and structure
>2pnv_A Small conductance calcium-activated potassium channel protein 2; leucine zipper, SKCA channel, membrane protein; 2.10A {Rattus norvegicus} Back     alignment and structure
>1aq5_A Matrilin-1, CMP, cartilage matrix protein; coiled-coil, heptad repeat, interchain disulfide bonds, oligomerization domain, trimer; NMR {Gallus gallus} SCOP: h.1.6.1 Back     alignment and structure
>2ieq_A S glycoprotein, spike glycoprotein, peplomer protein, E2; membrane fusion, virus entry, six-HEL bundle, viral protein; 1.75A {Human coronavirus} Back     alignment and structure
>3ci9_A Heat shock factor-binding protein 1; triple helix, nucleus, transcription; 1.80A {Homo sapiens} Back     alignment and structure
>3n06_A Prolactin, PRL; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3nce_A 3mzg_A 3ncc_A 2q98_A 3d48_P 3ncb_A 3n0p_A 3ncf_A 1n9d_A 1rw5_A 3npz_A 3ew3_A Back     alignment and structure
>1pzq_A Erythronolide synthase; four helix bundle, homodimer, transferase; NMR {Saccharopolyspora erythraea} SCOP: a.34.3.1 Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure
>3te3_A Polycystic kidney disease 2-like 1 protein; trimeric coiled-coil, oligomerization domain, C-terminal CYT regulatory domain, metal transport; 2.69A {Homo sapiens} Back     alignment and structure
>4gif_A Polycystic kidney disease 2-like 1 protein; coiled-coil, trimer, Trp channel, transient receptor potenti channel, polycystic kidney disease (PKD); 2.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
d1f6fa_197 Prolactin (placental lactogen) {Sheep (Ovis aries) 86.59
d1pzqa_60 Erythronolide synthase {Saccharopolyspora erythrae 82.57
d1cnt1_177 Ciliary neurotrophic factor (CNTF) {Human (Homo sa 82.01
>d1f6fa_ a.26.1.1 (A:) Prolactin (placental lactogen) {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
class: All alpha proteins
fold: 4-helical cytokines
superfamily: 4-helical cytokines
family: Long-chain cytokines
domain: Prolactin (placental lactogen)
species: Sheep (Ovis aries) [TaxId: 9940]
Probab=86.59  E-value=1  Score=29.36  Aligned_cols=42  Identities=12%  Similarity=0.256  Sum_probs=33.2

Q ss_pred             HHHHHHHHH---HHHHHHHHHHHHHhhhHHHHHHHHHHHHHhhcc
Q 035166            9 LQQMQSRFQ---TMSESIIAKIDEMGSRIDELEQSINDLRSEMGI   50 (71)
Q Consensus         9 LqqmQ~kFq---~MS~~I~~riDdMg~RIDdLEksI~dLm~qaG~   50 (71)
                      |+.++.-|.   .+++.|++|..+|..++.+|++-|..|+.+.+.
T Consensus        97 L~~L~~~l~~~~~~~~~ilska~ei~~k~~~L~egi~~i~~~~~~  141 (197)
T d1f6fa_          97 LHHAVTELANSKGTSPALLTKAQEIKEKAKVLVDGVEVIQKRIHP  141 (197)
T ss_dssp             HHHHHHHHHC-----CHHHHHHHHHHHHHHHHHHHHHHHHHHHST
T ss_pred             HHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhCC
Confidence            455555554   458899999999999999999999999999863



>d1pzqa_ a.34.3.1 (A:) Erythronolide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1cnt1_ a.26.1.1 (1:) Ciliary neurotrophic factor (CNTF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure