>gi|225451463|ref|XP_002270423.1| PREDICTED: protein transport protein Sec61 subunit gamma isoform 1 [Vitis vinifera] gi|359488485|ref|XP_003633765.1| PREDICTED: protein transport protein Sec61 subunit gamma isoform 2 [Vitis vinifera] gi|147815338|emb|CAN67771.1| hypothetical protein VITISV_010522 [Vitis vinifera] gi|296082338|emb|CBI21343.3| unnamed protein product [Vitis vinifera]
>gi|357492957|ref|XP_003616767.1| Protein transport protein SEC61 gamma subunit [Medicago truncatula] gi|355518102|gb|AES99725.1| Protein transport protein SEC61 gamma subunit [Medicago truncatula]
>gi|449455852|ref|XP_004145664.1| PREDICTED: protein transport protein Sec61 subunit gamma-like isoform 1 [Cucumis sativus] gi|449455854|ref|XP_004145665.1| PREDICTED: protein transport protein Sec61 subunit gamma-like isoform 2 [Cucumis sativus] gi|449502009|ref|XP_004161518.1| PREDICTED: protein transport protein Sec61 subunit gamma-like isoform 1 [Cucumis sativus] gi|449502012|ref|XP_004161519.1| PREDICTED: protein transport protein Sec61 subunit gamma-like isoform 2 [Cucumis sativus]
>gi|356501180|ref|XP_003519405.1| PREDICTED: protein transport protein Sec61 subunit gamma-like [Glycine max] gi|356543409|ref|XP_003540153.1| PREDICTED: protein transport protein Sec61 subunit gamma-like [Glycine max] gi|356554605|ref|XP_003545635.1| PREDICTED: protein transport protein Sec61 subunit gamma [Glycine max] gi|357479489|ref|XP_003610030.1| Protein transport protein SEC61 gamma subunit [Medicago truncatula] gi|357492959|ref|XP_003616768.1| Protein transport protein SEC61 gamma subunit [Medicago truncatula] gi|355511085|gb|AES92227.1| Protein transport protein SEC61 gamma subunit [Medicago truncatula] gi|355518103|gb|AES99726.1| Protein transport protein SEC61 gamma subunit [Medicago truncatula]
>gi|226504500|ref|NP_001148682.1| protein transport protein SEC61 gamma subunit [Zea mays] gi|242096570|ref|XP_002438775.1| hypothetical protein SORBIDRAFT_10g026000 [Sorghum bicolor] gi|195609874|gb|ACG26767.1| protein transport protein SEC61 gamma subunit [Zea mays] gi|195618380|gb|ACG31020.1| protein transport protein SEC61 gamma subunit [Zea mays] gi|195621374|gb|ACG32517.1| protein transport protein SEC61 gamma subunit [Zea mays] gi|195624782|gb|ACG34221.1| protein transport protein SEC61 gamma subunit [Zea mays] gi|241916998|gb|EER90142.1| hypothetical protein SORBIDRAFT_10g026000 [Sorghum bicolor] gi|413955006|gb|AFW87655.1| hypothetical protein ZEAMMB73_686875 [Zea mays]
>gi|226508450|ref|NP_001147308.1| protein transport protein SEC61 gamma subunit [Zea mays] gi|195609738|gb|ACG26699.1| protein transport protein SEC61 gamma subunit [Zea mays] gi|413943503|gb|AFW76152.1| protein transport protein SEC61 gamma subunit [Zea mays]
This model describes archaeal SEC61-like and eukaryotic SEC61 but not bacterial secE proteins, for which a Pfam pfam00584 (SecE) has been created [Protein fate, Protein and peptide secretion and trafficking]. Length = 61
>gnl|CDD|201325 pfam00584, SecE, SecE/Sec61-gamma subunits of protein translocation complex
Score = 46.4 bits (111), Expect = 7e-09
Identities = 15/55 (27%), Positives = 25/55 (45%)
Query: 11 LRDFAKDSLRLVKRCHKPDRKEFTKVAFRTAIGFVVMGFVGFFVKLIFIPINNII 65
+ F K+ +K+ P RKE K + +VM + V L+F + N+I
Sbjct: 2 IIKFFKEVKAELKKVVWPTRKETLKTTVVVLVFVLVMALFLWLVDLVFGWLVNLI 56
SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex. Length = 56
>PF00584 SecE: SecE/Sec61-gamma subunits of protein translocation complex; InterPro: IPR001901 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway
Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component []. From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins. The translocase protein subunits are encoded on the bacterial chromosome. The translocase itself comprises 7 proteins, including a chaperone protein (SecB), an ATPase (SecA), an integral membrane complex (SecCY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) []. The chaperone protein SecB [] is a highly acidic homotetrameric protein that exists as a "dimer of dimers" in the bacterial cytoplasm. SecB maintains preproteins in an unfolded state after translation, and targets these to the peripheral membrane protein ATPase SecA for secretion []. SecE, part of the main SecYEG translocase complex, is ~106 residues in length, and spans the inner membrane of the Gram-negative bacterial envelope. Together with SecY and SecG, SecE forms a multimeric channel through which preproteins are translocated, using both proton motive forces and ATP-driven secretion. The latter is mediated by SecA. In eukaryotes, the evolutionary related protein sec61-gamma plays a role in protein translocation through the endoplasmic reticulum; it is part of a trimeric complex that also consist of sec61-alpha and beta []. Both secE and sec61-gamma are small proteins of about 60 to 90 amino acids that contain a single transmembrane region at their C-terminal extremity (Escherichia coli secE is an exception, in that it possess an extra N-terminal segment of 60 residues that contains two additional transmembrane domains) [].; GO: 0006605 protein targeting, 0006886 intracellular protein transport, 0016020 membrane; PDB: 3J01_B 2WW9_B 2WWA_B 3DL8_C 2WWB_B 3DIN_G 2ZJS_E 2ZQP_E.
>PF00957 Synaptobrevin: Synaptobrevin; InterPro: IPR001388 Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis
Vesicle function is mediated by proteins in their membranes, although the precise nature of the protein-protein interactions underlying this are still uncertain []. Synaptobrevin may play a role in the molecular events underlying neurotransmitter release and vesicle recycling and may be involved in the regulation of membrane flow in the nerve terminal, a process mediated by interaction with low molecular weight GTP-binding proteins []. Synaptic vesicle-associated membrane proteins (VAMPs) from Torpedo californica (Pacific electric ray) and SNC1 from yeast are related to synaptobrevin.; GO: 0016192 vesicle-mediated transport, 0016021 integral to membrane; PDB: 3EGX_C 2NUP_C 3EGD_C 2NUT_C 1IOU_A 1H8M_A 3B5N_A 3ZYM_A 2NPS_A 1SFC_E ....
This model represents exclusively the bacterial (and some organellar) SecE protein. SecE is part of the core heterotrimer, SecYEG, of the Sec preprotein translocase system. Other components are the ATPase SecA, a cytosolic chaperone SecB, and an accessory complex of SecDF and YajC.
>COG0690 SecE Preprotein translocase subunit SecE [Intracellular trafficking and secretion]
SEC61gamma, protein transport protein SEC61 subuni
3e-33
2ww9_B
80
Protein transport protein SSS1; ribonucleoprotein,
1e-32
1rh5_B
74
Preprotein translocase SECE subunit; protein trans
7e-14
3mp7_B
61
Preprotein translocase subunit SECE; protein trans
6e-07
>2wwb_B SEC61gamma, protein transport protein SEC61 subunit gamma; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Canis lupus familiaris} Length = 68
>2wwb_B SEC61gamma, protein transport protein SEC61 subunit gamma; ribosome, protein EXIT tunnel, cotranslational protein translocation, protein conducting channel; 6.48A {Canis lupus familiaris}
>2ww9_B Protein transport protein SSS1; ribonucleoprotein, transmembrane, phospho signal sequence, membrane, ribosome, transport; 8.60A {Saccharomyces cerevisiae} PDB: 2wwa_B