Citrus Sinensis ID: 035428
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 57 | ||||||
| 356557870 | 723 | PREDICTED: amyrin synthase LUP2-like [Gl | 0.807 | 0.063 | 0.695 | 1e-12 | |
| 75226567 | 758 | RecName: Full=Lupeol synthase; Short=GgL | 0.789 | 0.059 | 0.733 | 1e-11 | |
| 360038892 | 758 | lupeol synthase [Glycyrrhiza uralensis] | 0.789 | 0.059 | 0.733 | 1e-11 | |
| 83638481 | 594 | beta-amyrin synthase, partial [Gypsophil | 0.807 | 0.077 | 0.695 | 1e-11 | |
| 122210891 | 769 | RecName: Full=Lupeol synthase gi|8246880 | 0.807 | 0.059 | 0.717 | 1e-11 | |
| 255572809 | 741 | Cycloartenol synthase, putative [Ricinus | 0.807 | 0.062 | 0.717 | 1e-11 | |
| 403377890 | 779 | RecName: Full=Taraxerol synthase; Short= | 0.824 | 0.060 | 0.659 | 2e-11 | |
| 2598587 | 472 | cycloartenol synthase [Medicago truncatu | 0.789 | 0.095 | 0.711 | 4e-11 | |
| 357513605 | 718 | Beta-amyrin synthase [Medicago truncatul | 0.824 | 0.065 | 0.638 | 4e-11 | |
| 223469143 | 762 | putative beta amyrin synthase [Malus x d | 0.824 | 0.061 | 0.659 | 5e-11 |
| >gi|356557870|ref|XP_003547233.1| PREDICTED: amyrin synthase LUP2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 77.4 bits (189), Expect = 1e-12, Method: Compositional matrix adjust.
Identities = 32/46 (69%), Positives = 40/46 (86%)
Query: 1 MMPSEIVGEKMEPERFYDAVNYILSMQSETGGVPAWEPRRAPSWLE 46
MMP EIVGEKMEPE+ YD+V++ILS+QS+ GG+PAWEP R+ WLE
Sbjct: 460 MMPQEIVGEKMEPEKLYDSVDFILSLQSKNGGIPAWEPVRSQKWLE 505
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|75226567|sp|Q764T8.1|LUPS_GLYGL RecName: Full=Lupeol synthase; Short=GgLUS1 gi|41687978|dbj|BAD08587.1| lupeol synthase [Glycyrrhiza glabra] | Back alignment and taxonomy information |
|---|
| >gi|360038892|dbj|BAL41371.1| lupeol synthase [Glycyrrhiza uralensis] | Back alignment and taxonomy information |
|---|
| >gi|83638481|gb|ABC33922.1| beta-amyrin synthase, partial [Gypsophila paniculata] | Back alignment and taxonomy information |
|---|
| >gi|122210891|sp|Q2XPU7.1|LUPS_RICCO RecName: Full=Lupeol synthase gi|82468803|gb|ABB76766.1| lupeol synthase [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255572809|ref|XP_002527337.1| Cycloartenol synthase, putative [Ricinus communis] gi|223533337|gb|EEF35089.1| Cycloartenol synthase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|403377890|sp|E2IUA6.1|TARS_KALDA RecName: Full=Taraxerol synthase; Short=KdTAS gi|300807974|gb|ADK35123.1| taraxerol synthase [Kalanchoe daigremontiana] | Back alignment and taxonomy information |
|---|
| >gi|2598587|emb|CAA75588.1| cycloartenol synthase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357513605|ref|XP_003627091.1| Beta-amyrin synthase [Medicago truncatula] gi|355521113|gb|AET01567.1| Beta-amyrin synthase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|223469143|gb|ACM89978.1| putative beta amyrin synthase [Malus x domestica] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 57 | ||||||
| UNIPROTKB|Q2XPU7 | 769 | Q2XPU7 "Lupeol synthase" [Rici | 0.807 | 0.059 | 0.717 | 7.6e-13 | |
| UNIPROTKB|E2IUA6 | 779 | E2IUA6 "Taraxerol synthase" [K | 0.824 | 0.060 | 0.659 | 1e-12 | |
| UNIPROTKB|Q764T8 | 758 | LUS1 "Lupeol synthase" [Glycyr | 0.789 | 0.059 | 0.733 | 1.6e-12 | |
| UNIPROTKB|Q9LRH7 | 764 | OSCPSM "Mixed-amyrin synthase" | 0.824 | 0.061 | 0.638 | 7e-12 | |
| UNIPROTKB|Q8W3Z2 | 755 | OSCBPW "Lupeol synthase" [Betu | 0.789 | 0.059 | 0.688 | 8.8e-12 | |
| UNIPROTKB|Q8W3Z1 | 779 | OSCBPY "Beta-amyrin synthase" | 0.894 | 0.065 | 0.615 | 9.2e-12 | |
| TAIR|locus:2207300 | 763 | LUP2 "lupeol synthase 2" [Arab | 0.824 | 0.061 | 0.595 | 1.9e-11 | |
| UNIPROTKB|A8CDT3 | 761 | LUS "Lupeol synthase" [Bruguie | 0.807 | 0.060 | 0.652 | 3e-11 | |
| UNIPROTKB|A8CDT2 | 759 | BAS "Beta-amyrin synthase" [Br | 0.824 | 0.061 | 0.638 | 5e-11 | |
| UNIPROTKB|E2IUA9 | 765 | E2IUA9 "Lupeol synthase" [Kala | 0.824 | 0.061 | 0.595 | 6.4e-11 |
| UNIPROTKB|Q2XPU7 Q2XPU7 "Lupeol synthase" [Ricinus communis (taxid:3988)] | Back alignment and assigned GO terms |
|---|
Score = 181 (68.8 bits), Expect = 7.6e-13, P = 7.6e-13
Identities = 33/46 (71%), Positives = 38/46 (82%)
Query: 1 MMPSEIVGEKMEPERFYDAVNYILSMQSETGGVPAWEPRRAPSWLE 46
MMP EIVGEKMEPE+ YD+VN ILS+QS+ GG AWEP RA SW+E
Sbjct: 498 MMPPEIVGEKMEPEKVYDSVNVILSLQSQNGGFTAWEPARAGSWME 543
|
|
| UNIPROTKB|E2IUA6 E2IUA6 "Taraxerol synthase" [Kalanchoe daigremontiana (taxid:23013)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q764T8 LUS1 "Lupeol synthase" [Glycyrrhiza glabra (taxid:49827)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9LRH7 OSCPSM "Mixed-amyrin synthase" [Pisum sativum (taxid:3888)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8W3Z2 OSCBPW "Lupeol synthase" [Betula platyphylla (taxid:78630)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8W3Z1 OSCBPY "Beta-amyrin synthase" [Betula platyphylla (taxid:78630)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2207300 LUP2 "lupeol synthase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8CDT3 LUS "Lupeol synthase" [Bruguiera gymnorhiza (taxid:39984)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A8CDT2 BAS "Beta-amyrin synthase" [Bruguiera gymnorhiza (taxid:39984)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2IUA9 E2IUA9 "Lupeol synthase" [Kalanchoe daigremontiana (taxid:23013)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00017057001 | SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (754 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 57 | |||
| PLN02993 | 763 | PLN02993, PLN02993, lupeol synthase | 3e-17 | |
| PLN03012 | 759 | PLN03012, PLN03012, Camelliol C synthase | 2e-16 | |
| cd02892 | 634 | cd02892, SQCY_1, Squalene cyclase (SQCY) domain su | 5e-13 | |
| cd02889 | 348 | cd02889, SQCY, Squalene cyclase (SQCY) domain; fou | 5e-12 | |
| TIGR01787 | 621 | TIGR01787, squalene_cyclas, squalene/oxidosqualene | 1e-08 | |
| TIGR03463 | 634 | TIGR03463, osq_cycl, 2,3-oxidosqualene cyclase | 1e-05 |
| >gnl|CDD|215537 PLN02993, PLN02993, lupeol synthase | Back alignment and domain information |
|---|
Score = 73.0 bits (179), Expect = 3e-17
Identities = 29/47 (61%), Positives = 40/47 (85%)
Query: 1 MMPSEIVGEKMEPERFYDAVNYILSMQSETGGVPAWEPRRAPSWLEV 47
MMP+++VG+K++PE+ YD+VN +LS+QSE GGV AWEP RA WLE+
Sbjct: 500 MMPADVVGQKIDPEQLYDSVNLLLSLQSENGGVTAWEPVRAYKWLEL 546
|
Length = 763 |
| >gnl|CDD|166653 PLN03012, PLN03012, Camelliol C synthase | Back alignment and domain information |
|---|
| >gnl|CDD|239222 cd02892, SQCY_1, Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold | Back alignment and domain information |
|---|
| >gnl|CDD|239219 cd02889, SQCY, Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold | Back alignment and domain information |
|---|
| >gnl|CDD|233578 TIGR01787, squalene_cyclas, squalene/oxidosqualene cyclases | Back alignment and domain information |
|---|
| >gnl|CDD|234220 TIGR03463, osq_cycl, 2,3-oxidosqualene cyclase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 57 | |||
| PLN02993 | 763 | lupeol synthase | 99.8 | |
| PLN03012 | 759 | Camelliol C synthase | 99.8 | |
| KOG0497 | 760 | consensus Oxidosqualene-lanosterol cyclase and rel | 99.64 | |
| TIGR03463 | 634 | osq_cycl 2,3-oxidosqualene cyclase. This model ide | 99.55 | |
| TIGR01787 | 621 | squalene_cyclas squalene/oxidosqualene cyclases. T | 99.41 | |
| TIGR01507 | 635 | hopene_cyclase squalene-hopene cyclase. SHC is an | 99.15 | |
| cd02892 | 634 | SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; | 99.13 | |
| TIGR02474 | 290 | pec_lyase pectate lyase, PelA/Pel-15E family. Memb | 98.79 | |
| COG1657 | 517 | SqhC Squalene cyclase [Lipid metabolism] | 98.15 | |
| cd02889 | 348 | SQCY Squalene cyclase (SQCY) domain; found in clas | 98.04 | |
| cd02891 | 282 | A2M_like Proteins similar to alpha2-macroglobulin | 97.96 | |
| PF13249 | 113 | Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B | 97.93 | |
| cd02897 | 292 | A2M_2 Proteins similar to alpha2-macroglobulin (al | 97.91 | |
| PF13249 | 113 | Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B | 97.74 | |
| ) (2,3-epoxysqualene-cycloartenol cyclase) is a plant enzyme that catalyzes the cyclization of (S)-2,3-epoxysqualene to cycloartenol.; GO: 0003824 catalytic activity; PDB: 2IEJ_B 1LD7_B 1LD8_B 2H6G_B 1TN6_B 1S63_B 1MZC_B 2H6I_B 2H6F_B 1JCQ_B ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF00432">PF00432 | 44 | Prenyltrans: Prenyltransferase and squalene oxidas | 97.59 | |
| PF13243 | 109 | Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A | 97.55 | |
| cd02896 | 297 | complement_C3_C4_C5 Proteins similar to C3, C4 and | 97.36 | |
| cd02896 | 297 | complement_C3_C4_C5 Proteins similar to C3, C4 and | 97.25 | |
| TIGR01507 | 635 | hopene_cyclase squalene-hopene cyclase. SHC is an | 97.23 | |
| PLN03012 | 759 | Camelliol C synthase | 97.23 | |
| cd02897 | 292 | A2M_2 Proteins similar to alpha2-macroglobulin (al | 97.21 | |
| PLN02993 | 763 | lupeol synthase | 97.1 | |
| PF13243 | 109 | Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A | 97.05 | |
| cd02889 | 348 | SQCY Squalene cyclase (SQCY) domain; found in clas | 97.01 | |
| cd00688 | 300 | ISOPREN_C2_like This group contains class II terpe | 97.01 | |
| cd02890 | 286 | PTase Protein prenyltransferase (PTase) domain, be | 96.97 | |
| TIGR03463 | 634 | osq_cycl 2,3-oxidosqualene cyclase. This model ide | 96.88 | |
| TIGR01787 | 621 | squalene_cyclas squalene/oxidosqualene cyclases. T | 96.62 | |
| cd00688 | 300 | ISOPREN_C2_like This group contains class II terpe | 96.55 | |
| cd02892 | 634 | SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; | 96.4 | |
| PLN03201 | 316 | RAB geranylgeranyl transferase beta-subunit; Provi | 96.01 | |
| PF09492 | 289 | Pec_lyase: Pectic acid lyase; InterPro: IPR012669 | 95.88 | |
| cd02890 | 286 | PTase Protein prenyltransferase (PTase) domain, be | 95.83 | |
| cd02893 | 299 | FTase Protein farnesyltransferase (FTase)_like pro | 95.66 | |
| PF07678 | 246 | A2M_comp: A-macroglobulin complement component; In | 95.36 | |
| cd02893 | 299 | FTase Protein farnesyltransferase (FTase)_like pro | 95.3 | |
| cd02894 | 287 | GGTase-II Geranylgeranyltransferase type II (GGTas | 95.25 | |
| cd02894 | 287 | GGTase-II Geranylgeranyltransferase type II (GGTas | 94.94 | |
| PF07678 | 246 | A2M_comp: A-macroglobulin complement component; In | 94.83 | |
| PLN03201 | 316 | RAB geranylgeranyl transferase beta-subunit; Provi | 94.63 | |
| PLN02710 | 439 | farnesyltranstransferase subunit beta | 94.47 | |
| cd02891 | 282 | A2M_like Proteins similar to alpha2-macroglobulin | 94.36 | |
| KOG0497 | 760 | consensus Oxidosqualene-lanosterol cyclase and rel | 94.0 | |
| cd02895 | 307 | GGTase-I Geranylgeranyltransferase types I (GGTase | 93.65 | |
| KOG0366 | 329 | consensus Protein geranylgeranyltransferase type I | 93.32 | |
| COG1689 | 274 | Uncharacterized protein conserved in archaea [Func | 93.15 | |
| PLN02710 | 439 | farnesyltranstransferase subunit beta | 92.96 | |
| COG5029 | 342 | CAL1 Prenyltransferase, beta subunit [Posttranslat | 92.75 | |
| cd02895 | 307 | GGTase-I Geranylgeranyltransferase types I (GGTase | 90.47 | |
| KOG0366 | 329 | consensus Protein geranylgeranyltransferase type I | 90.01 | |
| KOG0365 | 423 | consensus Beta subunit of farnesyltransferase [Pos | 88.17 | |
| COG2373 | 1621 | Large extracellular alpha-helical protein [General | 87.54 | |
| KOG3760 | 594 | consensus Heparan sulfate-glucuronic acid C5-epime | 83.91 | |
| PF15144 | 88 | DUF4576: Domain of unknown function (DUF4576) | 82.11 | |
| COG1657 | 517 | SqhC Squalene cyclase [Lipid metabolism] | 80.82 |
| >PLN02993 lupeol synthase | Back alignment and domain information |
|---|
Probab=99.80 E-value=2.4e-20 Score=143.75 Aligned_cols=55 Identities=51% Similarity=1.002 Sum_probs=52.3
Q ss_pred CCccccCCCCChHHHHHHHHHHHHhhcCCCCcccccCCCCcccccccCccccccC
Q 035428 2 MPSEIVGEKMEPERFYDAVNYILSMQSETGGVPAWEPRRAPSWLEVKITSTYTKS 56 (57)
Q Consensus 2 ~~~~~~g~~i~~~rl~daVd~lLsmQN~dGG~aafE~~r~~~~Le~lnpae~f~~ 56 (57)
+|++++|+++.+++|+|||||||+|||+||||+|||++|++.|||+|||+|+|+.
T Consensus 501 ~~~~~~~~~~~~~~l~~av~wlL~mQn~dGG~aafe~~~~~~~le~ln~ae~f~~ 555 (763)
T PLN02993 501 MPADVVGQKIDPEQLYDSVNLLLSLQSENGGVTAWEPVRAYKWLELLNPTDFFAN 555 (763)
T ss_pred CccccccccchHHHHHHHHHHHHhhccCCCCEEeeeCCCchhHHHcCCHHHhhcC
Confidence 5678899999999999999999999999999999999999999999999999864
|
|
| >PLN03012 Camelliol C synthase | Back alignment and domain information |
|---|
| >KOG0497 consensus Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03463 osq_cycl 2,3-oxidosqualene cyclase | Back alignment and domain information |
|---|
| >TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases | Back alignment and domain information |
|---|
| >TIGR01507 hopene_cyclase squalene-hopene cyclase | Back alignment and domain information |
|---|
| >cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold | Back alignment and domain information |
|---|
| >TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family | Back alignment and domain information |
|---|
| >COG1657 SqhC Squalene cyclase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold | Back alignment and domain information |
|---|
| >cd02891 A2M_like Proteins similar to alpha2-macroglobulin (alpha (2)-M) | Back alignment and domain information |
|---|
| >PF13249 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 1O6Q_B 1H35_C 1H3A_C 1SQC_A 1UMP_A 1O6H_C 1O79_B 1GSZ_C 1H37_C | Back alignment and domain information |
|---|
| >cd02897 A2M_2 Proteins similar to alpha2-macroglobulin (alpha (2)-M) | Back alignment and domain information |
|---|
| >PF13249 Prenyltrans_2: Prenyltransferase-like; PDB: 1O6R_B 1O6Q_B 1H35_C 1H3A_C 1SQC_A 1UMP_A 1O6H_C 1O79_B 1GSZ_C 1H37_C | Back alignment and domain information |
|---|
| >PF00432 Prenyltrans: Prenyltransferase and squalene oxidase repeat This Prosite family is a subset of the Pfam family | Back alignment and domain information |
|---|
| >PF13243 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 3SAE_A 3SDV_A 3SDT_A 3SDQ_A 3SDU_A | Back alignment and domain information |
|---|
| >cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement | Back alignment and domain information |
|---|
| >cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement | Back alignment and domain information |
|---|
| >TIGR01507 hopene_cyclase squalene-hopene cyclase | Back alignment and domain information |
|---|
| >PLN03012 Camelliol C synthase | Back alignment and domain information |
|---|
| >cd02897 A2M_2 Proteins similar to alpha2-macroglobulin (alpha (2)-M) | Back alignment and domain information |
|---|
| >PLN02993 lupeol synthase | Back alignment and domain information |
|---|
| >PF13243 Prenyltrans_1: Prenyltransferase-like; PDB: 3SDR_A 3SAE_A 3SDV_A 3SDT_A 3SDQ_A 3SDU_A | Back alignment and domain information |
|---|
| >cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold | Back alignment and domain information |
|---|
| >cd00688 ISOPREN_C2_like This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement | Back alignment and domain information |
|---|
| >cd02890 PTase Protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) | Back alignment and domain information |
|---|
| >TIGR03463 osq_cycl 2,3-oxidosqualene cyclase | Back alignment and domain information |
|---|
| >TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases | Back alignment and domain information |
|---|
| >cd00688 ISOPREN_C2_like This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement | Back alignment and domain information |
|---|
| >cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold | Back alignment and domain information |
|---|
| >PLN03201 RAB geranylgeranyl transferase beta-subunit; Provisional | Back alignment and domain information |
|---|
| >PF09492 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 Members of this family are isozymes of pectate lyase (4 | Back alignment and domain information |
|---|
| >cd02890 PTase Protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) | Back alignment and domain information |
|---|
| >cd02893 FTase Protein farnesyltransferase (FTase)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) | Back alignment and domain information |
|---|
| >PF07678 A2M_comp: A-macroglobulin complement component; InterPro: IPR011626 This domain covers the complement component region of the alpha-2-macroglobulin family | Back alignment and domain information |
|---|
| >cd02893 FTase Protein farnesyltransferase (FTase)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) | Back alignment and domain information |
|---|
| >cd02894 GGTase-II Geranylgeranyltransferase type II (GGTase-II)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) | Back alignment and domain information |
|---|
| >cd02894 GGTase-II Geranylgeranyltransferase type II (GGTase-II)_like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) | Back alignment and domain information |
|---|
| >PF07678 A2M_comp: A-macroglobulin complement component; InterPro: IPR011626 This domain covers the complement component region of the alpha-2-macroglobulin family | Back alignment and domain information |
|---|
| >PLN03201 RAB geranylgeranyl transferase beta-subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02710 farnesyltranstransferase subunit beta | Back alignment and domain information |
|---|
| >cd02891 A2M_like Proteins similar to alpha2-macroglobulin (alpha (2)-M) | Back alignment and domain information |
|---|
| >KOG0497 consensus Oxidosqualene-lanosterol cyclase and related proteins [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02895 GGTase-I Geranylgeranyltransferase types I (GGTase-I)-like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) | Back alignment and domain information |
|---|
| >KOG0366 consensus Protein geranylgeranyltransferase type II, beta subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1689 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
| >PLN02710 farnesyltranstransferase subunit beta | Back alignment and domain information |
|---|
| >COG5029 CAL1 Prenyltransferase, beta subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02895 GGTase-I Geranylgeranyltransferase types I (GGTase-I)-like proteins containing the protein prenyltransferase (PTase) domain, beta subunit (alpha 6 - alpha 6 barrel fold) | Back alignment and domain information |
|---|
| >KOG0366 consensus Protein geranylgeranyltransferase type II, beta subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0365 consensus Beta subunit of farnesyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2373 Large extracellular alpha-helical protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3760 consensus Heparan sulfate-glucuronic acid C5-epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF15144 DUF4576: Domain of unknown function (DUF4576) | Back alignment and domain information |
|---|
| >COG1657 SqhC Squalene cyclase [Lipid metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 57 | |||
| 1w6k_A | 732 | Lanosterol synthase; cyclase, cholesterol, monotop | 4e-09 | |
| 2sqc_A | 631 | Squalene-hopene cyclase; isomerase, triterpene cyc | 2e-08 |
| >1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Length = 732 | Back alignment and structure |
|---|
Score = 49.1 bits (116), Expect = 4e-09
Identities = 15/45 (33%), Positives = 22/45 (48%)
Query: 2 MPSEIVGEKMEPERFYDAVNYILSMQSETGGVPAWEPRRAPSWLE 46
V E + ER DAV +L+M++ GG +E +R LE
Sbjct: 469 EKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLE 513
|
| >2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* Length = 631 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 57 | |||
| 1w6k_A | 732 | Lanosterol synthase; cyclase, cholesterol, monotop | 99.28 | |
| 1gxm_A | 332 | Pectate lyase; mechanism, elimination; 1.32A {Cell | 99.08 | |
| 1r76_A | 408 | Pectate lyase; A-helical structure; 2.65A {Azospir | 99.02 | |
| 1hzf_A | 367 | Complement factor C4A; alpha-alpha 6 barrel, immun | 98.58 | |
| 2sqc_A | 631 | Squalene-hopene cyclase; isomerase, triterpene cyc | 98.57 | |
| 2h6f_B | 437 | Protein farnesyltransferase beta subunit; ftase, f | 98.41 | |
| 1qqf_A | 277 | Protein (complement C3DG); alpha-alpha barrel, imm | 98.37 | |
| 2wy7_A | 310 | Complement C3D fragment; immune system, immune res | 98.3 | |
| 3q7a_B | 520 | Farnesyltransferase beta subunit; protein prenyltr | 98.1 | |
| 1n4q_B | 377 | Geranyltransferase type-I beta subunit; protein ge | 98.04 | |
| 2pn5_A | 1325 | TEP1R, thioester-containing protein I; FULL-length | 97.83 | |
| 4acq_A | 1451 | Alpha-2-macroglobulin; hydrolase inhibitor, protei | 97.53 | |
| 2hr0_B | 915 | Complement C3 alpha' chain; complement component C | 97.53 | |
| 1n4q_B | 377 | Geranyltransferase type-I beta subunit; protein ge | 97.02 | |
| 3dss_B | 331 | Geranylgeranyl transferase type-2 subunit beta; pr | 96.79 | |
| 3dss_B | 331 | Geranylgeranyl transferase type-2 subunit beta; pr | 96.61 | |
| 3q7a_B | 520 | Farnesyltransferase beta subunit; protein prenyltr | 96.48 | |
| 2sqc_A | 631 | Squalene-hopene cyclase; isomerase, triterpene cyc | 96.44 | |
| 1w6k_A | 732 | Lanosterol synthase; cyclase, cholesterol, monotop | 96.24 | |
| 2h6f_B | 437 | Protein farnesyltransferase beta subunit; ftase, f | 96.24 | |
| 1hzf_A | 367 | Complement factor C4A; alpha-alpha 6 barrel, immun | 95.89 | |
| 1qqf_A | 277 | Protein (complement C3DG); alpha-alpha barrel, imm | 95.85 | |
| 4fxk_B | 767 | Complement C4-A alpha chain; immune system, proteo | 95.77 | |
| 2wy7_A | 310 | Complement C3D fragment; immune system, immune res | 95.51 | |
| 2b39_A | 1661 | C3; thioester, immune defense, immune system; HET: | 94.73 | |
| 3cu7_A | 1676 | Complement C5; Mg domain, inflammation, anaphylato | 93.92 | |
| 3dra_B | 390 | Geranylgeranyltransferase type I beta subunit; ger | 92.14 | |
| 3prx_B | 1642 | Cobra venom factor; immune system, complement, imm | 92.11 | |
| 1r76_A | 408 | Pectate lyase; A-helical structure; 2.65A {Azospir | 92.04 | |
| 4acq_A | 1451 | Alpha-2-macroglobulin; hydrolase inhibitor, protei | 91.19 | |
| 2hr0_B | 915 | Complement C3 alpha' chain; complement component C | 88.88 | |
| 1gxm_A | 332 | Pectate lyase; mechanism, elimination; 1.32A {Cell | 86.52 | |
| 2pn5_A | 1325 | TEP1R, thioester-containing protein I; FULL-length | 86.36 | |
| 3pya_A | 727 | ENT-copalyl diphosphate synthase, chloroplastic; c | 83.93 | |
| 3p5p_A | 764 | Taxadiene synthase; class I and II terpene cyclase | 83.76 | |
| 3sdr_A | 817 | Alpha-bisabolene synthase; lyase, terpene synthase | 83.07 | |
| 3s9v_A | 785 | Abietadiene synthase, chloroplastic; alpha bundle/ | 82.66 | |
| 2bb6_A | 414 | TCII, TC II, transcobalamin II; alpha_6 - alpha_6 | 81.11 |
| >1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* | Back alignment and structure |
|---|
Probab=99.28 E-value=2.8e-12 Score=96.53 Aligned_cols=49 Identities=31% Similarity=0.458 Sum_probs=46.2
Q ss_pred CCCCChHHHHHHHHHHHHhhcCCCCcccccCCCCcccccccCccccccC
Q 035428 8 GEKMEPERFYDAVNYILSMQSETGGVPAWEPRRAPSWLEVKITSTYTKS 56 (57)
Q Consensus 8 g~~i~~~rl~daVd~lLsmQN~dGG~aafE~~r~~~~Le~lnpae~f~~ 56 (57)
|+++..+++.+||+||+++||+||||++||++++..|++.+||+|+|..
T Consensus 475 g~~~~~~~i~~av~wLls~Q~~DGgw~a~~~~~~~~~l~~i~~~e~fg~ 523 (732)
T 1w6k_A 475 TEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGD 523 (732)
T ss_dssp CSCCCHHHHHHHHHHHHTTCCTTSCBCSSSCCCSCGGGGGGCCCSSCSS
T ss_pred cchhhHHHHHHHHHHHHHhcCCCCCEEeecCCCchHHHhhCcchhcccc
Confidence 6678899999999999999999999999999999999999999998864
|
| >1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A* | Back alignment and structure |
|---|
| >1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 | Back alignment and structure |
|---|
| >1hzf_A Complement factor C4A; alpha-alpha 6 barrel, immune system; 2.30A {Homo sapiens} SCOP: a.102.4.4 | Back alignment and structure |
|---|
| >2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* | Back alignment and structure |
|---|
| >2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3pz4_B* 3e33_B* 1d8e_B* ... | Back alignment and structure |
|---|
| >1qqf_A Protein (complement C3DG); alpha-alpha barrel, immune system; 1.45A {Rattus norvegicus} SCOP: a.102.4.4 PDB: 1qsj_A 3d5r_A 2noj_A 2gox_A 3d5s_A 1c3d_A 2xqw_A | Back alignment and structure |
|---|
| >2wy7_A Complement C3D fragment; immune system, immune response, innate immunity, complement inflammatory response; 1.70A {Homo sapiens} PDB: 2wy8_A 3oed_A 3oxu_A 3rj3_A 1ghq_A* 1w2s_A | Back alignment and structure |
|---|
| >3q7a_B Farnesyltransferase beta subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_B* 3q78_B* 3q79_B* 3q75_B* 3q7f_B* 3sfx_B* 3sfy_B* | Back alignment and structure |
|---|
| >1n4q_B Geranyltransferase type-I beta subunit; protein geranylgeranyltransferase type-I, ggtase; HET: MGM GER; 2.40A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1n4p_B* 1n4r_B* 1n4s_B* 1s64_B* 1tnb_B* 1tno_B* 1tnu_B* 1tny_B* 1tnz_B* | Back alignment and structure |
|---|
| >2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4acq_A Alpha-2-macroglobulin; hydrolase inhibitor, proteinase inhibitor, irreversible PROT inhibitor, conformational change, blood plasma inhibitor; HET: MEQ NAG MAN; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2hr0_B Complement C3 alpha' chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2icf_B* 2wii_B* 2win_B* 3g6j_B 3l5n_B* 2a73_B* 2i07_B* 2xwj_B* 2xwb_B* 2a74_C* 2ice_C* 2qki_C* 3l3o_F* 3nms_C* 3nsa_C* 3ohx_C* 3t4a_C 2ice_B* 3l3o_B* 3nms_B* ... | Back alignment and structure |
|---|
| >1n4q_B Geranyltransferase type-I beta subunit; protein geranylgeranyltransferase type-I, ggtase; HET: MGM GER; 2.40A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1n4p_B* 1n4r_B* 1n4s_B* 1s64_B* 1tnb_B* 1tno_B* 1tnu_B* 1tny_B* 1tnz_B* | Back alignment and structure |
|---|
| >3dss_B Geranylgeranyl transferase type-2 subunit beta; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1ltx_B* 3c72_B* 1dce_B 3dst_B* 3dsu_B* 3dsv_B* 3dsw_B* 3dsx_B* 3hxb_B* 3hxc_B* 3hxd_B* 3hxe_B* 3hxf_B* 3pz1_B* 3pz2_B* 3pz3_B* 4ehm_B* 4gts_B* 4gtt_B* 4gtv_B* | Back alignment and structure |
|---|
| >3dss_B Geranylgeranyl transferase type-2 subunit beta; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} SCOP: a.102.4.3 PDB: 1ltx_B* 3c72_B* 1dce_B 3dst_B* 3dsu_B* 3dsv_B* 3dsw_B* 3dsx_B* 3hxb_B* 3hxc_B* 3hxd_B* 3hxe_B* 3hxf_B* 3pz1_B* 3pz2_B* 3pz3_B* 4ehm_B* 4gts_B* 4gtt_B* 4gtv_B* | Back alignment and structure |
|---|
| >3q7a_B Farnesyltransferase beta subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_B* 3q78_B* 3q79_B* 3q75_B* 3q7f_B* 3sfx_B* 3sfy_B* | Back alignment and structure |
|---|
| >2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A* | Back alignment and structure |
|---|
| >1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* | Back alignment and structure |
|---|
| >2h6f_B Protein farnesyltransferase beta subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.102.4.3 PDB: 1jcq_B* 1ld7_B* 1mzc_B* 1s63_B* 1sa4_B* 1tn6_B* 2f0y_B* 1ld8_B* 2iej_B* 3e37_B* 2h6h_B* 2h6g_B* 2h6i_B* 1o1t_B* 1o1s_B* 1o1r_B* 3eu5_B* 3pz4_B* 3e33_B* 1d8e_B* ... | Back alignment and structure |
|---|
| >1hzf_A Complement factor C4A; alpha-alpha 6 barrel, immune system; 2.30A {Homo sapiens} SCOP: a.102.4.4 | Back alignment and structure |
|---|
| >1qqf_A Protein (complement C3DG); alpha-alpha barrel, immune system; 1.45A {Rattus norvegicus} SCOP: a.102.4.4 PDB: 1qsj_A 3d5r_A 2noj_A 2gox_A 3d5s_A 1c3d_A 2xqw_A | Back alignment and structure |
|---|
| >4fxk_B Complement C4-A alpha chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_B* | Back alignment and structure |
|---|
| >2wy7_A Complement C3D fragment; immune system, immune response, innate immunity, complement inflammatory response; 1.70A {Homo sapiens} PDB: 2wy8_A 3oed_A 3oxu_A 3rj3_A 1ghq_A* 1w2s_A | Back alignment and structure |
|---|
| >2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage of basic residues, complement alternate pathway, glycoprotein, immune response; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 4e0s_A* 3prx_A* 3pvm_A* 4a5w_A* 1xwe_A | Back alignment and structure |
|---|
| >3dra_B Geranylgeranyltransferase type I beta subunit; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3prx_B Cobra venom factor; immune system, complement, immune SYS complex; HET: NAG; 4.30A {Naja kaouthia} PDB: 3pvm_B* | Back alignment and structure |
|---|
| >1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 | Back alignment and structure |
|---|
| >4acq_A Alpha-2-macroglobulin; hydrolase inhibitor, proteinase inhibitor, irreversible PROT inhibitor, conformational change, blood plasma inhibitor; HET: MEQ NAG MAN; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2hr0_B Complement C3 alpha' chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2icf_B* 2wii_B* 2win_B* 3g6j_B 3l5n_B* 2a73_B* 2i07_B* 2xwj_B* 2xwb_B* 2a74_C* 2ice_C* 2qki_C* 3l3o_F* 3nms_C* 3nsa_C* 3ohx_C* 3t4a_C 2ice_B* 3l3o_B* 3nms_B* ... | Back alignment and structure |
|---|
| >1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A* | Back alignment and structure |
|---|
| >2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3pya_A ENT-copalyl diphosphate synthase, chloroplastic; class I and II terpene cyclase fold, class II diterpene CYCL DXXDD motif; HET: AG8 1PE; 2.25A {Arabidopsis thaliana} PDB: 3pyb_A* | Back alignment and structure |
|---|
| >3p5p_A Taxadiene synthase; class I and II terpene cyclase fold, diterpene cyclase, DDXX NSE/DTE motif, 3-azacopalyl diphosphate; HET: A3C; 1.82A {Taxus brevifolia} PDB: 3p5r_A* | Back alignment and structure |
|---|
| >3sdr_A Alpha-bisabolene synthase; lyase, terpene synthase; HET: 210; 1.86A {Abies grandis} PDB: 3sdq_A 3sae_A* 3sdt_A* 3sdu_A* 3sdv_A* | Back alignment and structure |
|---|
| >3s9v_A Abietadiene synthase, chloroplastic; alpha bundle/barrel, lyase, isomerase; 2.30A {Abies grandis} | Back alignment and structure |
|---|
| >2bb6_A TCII, TC II, transcobalamin II; alpha_6 - alpha_6 barrel, transport protein; HET: B12; 2.00A {Bos taurus} PDB: 2bbc_A* 2v3n_A* 2v3p_A* 2bb5_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 57 | ||||
| d1w6ka1 | 448 | a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase { | 7e-11 | |
| d2sqca1 | 352 | a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cycla | 2e-08 | |
| d1gxma_ | 324 | a.102.5.1 (A:) Polygalacturonic acid lyase (pectat | 4e-05 |
| >d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 448 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha/alpha toroid superfamily: Terpenoid cyclases/Protein prenyltransferases family: Terpene synthases domain: Lanosterol synthase species: Human (Homo sapiens) [TaxId: 9606]
Score = 52.8 bits (126), Expect = 7e-11
Identities = 15/49 (30%), Positives = 23/49 (46%)
Query: 1 MMPSEIVGEKMEPERFYDAVNYILSMQSETGGVPAWEPRRAPSWLEVKI 49
V E + ER DAV +L+M++ GG +E +R LE+
Sbjct: 184 QEKCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLN 232
|
| >d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Length = 352 | Back information, alignment and structure |
|---|
| >d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} Length = 324 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 57 | |||
| d1w6ka1 | 448 | Lanosterol synthase {Human (Homo sapiens) [TaxId: | 99.62 | |
| d2sqca1 | 352 | Squalene-hopene cyclase {Alicyclobacillus acidocal | 99.33 | |
| d1gxma_ | 324 | Polygalacturonic acid lyase (pectate lyase) {Cellv | 98.79 | |
| d1r76a_ | 408 | Polygalacturonic acid lyase (pectate lyase) {Azosp | 98.28 | |
| d2sqca1 | 352 | Squalene-hopene cyclase {Alicyclobacillus acidocal | 97.74 | |
| d2sqca2 | 271 | Squalene-hopene cyclase {Alicyclobacillus acidocal | 97.66 | |
| d1c3da_ | 294 | C3D, a C3 fragment and ligand for complement recep | 97.53 | |
| d1w6ka2 | 279 | Lanosterol synthase {Human (Homo sapiens) [TaxId: | 97.49 | |
| d1hzfa_ | 326 | C4adg fragment of complement factor C4a {Human (Ho | 97.41 | |
| d2sqca2 | 271 | Squalene-hopene cyclase {Alicyclobacillus acidocal | 97.37 | |
| d2h6fb1 | 401 | Protein farnesyltransferase, beta-subunit {Human ( | 97.03 | |
| d1w6ka1 | 448 | Lanosterol synthase {Human (Homo sapiens) [TaxId: | 96.9 | |
| d3dssb1 | 325 | Rab geranylgeranyltransferase, beta subunit {Rat ( | 96.52 | |
| d3dssb1 | 325 | Rab geranylgeranyltransferase, beta subunit {Rat ( | 96.4 | |
| d1n4qb_ | 346 | Protein farnesyltransferase, beta-subunit {Rat (Ra | 94.98 | |
| d2h6fb1 | 401 | Protein farnesyltransferase, beta-subunit {Human ( | 94.13 | |
| d1hzfa_ | 326 | C4adg fragment of complement factor C4a {Human (Ho | 92.58 | |
| d1n4qb_ | 346 | Protein farnesyltransferase, beta-subunit {Rat (Ra | 90.95 | |
| d1r76a_ | 408 | Polygalacturonic acid lyase (pectate lyase) {Azosp | 89.51 | |
| d1c3da_ | 294 | C3D, a C3 fragment and ligand for complement recep | 88.63 | |
| d1ia6a_ | 431 | Nonprocessive cellulase Cel9M {Clostridium cellulo | 87.45 | |
| d1gxma_ | 324 | Polygalacturonic acid lyase (pectate lyase) {Cellv | 86.54 | |
| d1c6sa_ | 87 | Cytochrome c6 (synonym: cytochrome c553) {Cyanobac | 86.12 | |
| d1ctja_ | 89 | Cytochrome c6 (synonym: cytochrome c553) {Monoraph | 85.64 | |
| d1ks8a_ | 433 | Endo-b-1,4-glucanase {Termite (Nasutitermes takasa | 85.43 | |
| d1cf7b_ | 82 | Cell cycle transcription factor DP-2 {Human (Homo | 85.41 | |
| d1g87a1 | 454 | Endo/exocellulase:cellobiose E-4, N-terminal domai | 83.94 | |
| d1tf4a1 | 460 | Endo/exocellulase:cellobiose E-4, N-terminal domai | 80.65 |
| >d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha/alpha toroid superfamily: Terpenoid cyclases/Protein prenyltransferases family: Terpene synthases domain: Lanosterol synthase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.62 E-value=1.1e-16 Score=113.54 Aligned_cols=51 Identities=31% Similarity=0.448 Sum_probs=47.8
Q ss_pred ccCCCCChHHHHHHHHHHHHhhcCCCCcccccCCCCcccccccCccccccC
Q 035428 6 IVGEKMEPERFYDAVNYILSMQSETGGVPAWEPRRAPSWLEVKITSTYTKS 56 (57)
Q Consensus 6 ~~g~~i~~~rl~daVd~lLsmQN~dGG~aafE~~r~~~~Le~lnpae~f~~ 56 (57)
.+++++.+++|++||+|||+|||+||||++||++++..|||.+||+++|..
T Consensus 189 ~~~~~~~~~~i~~av~wLl~mQn~dGGw~afd~~~~~~~l~~~~~~~~~~~ 239 (448)
T d1w6ka1 189 HVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSEVFGD 239 (448)
T ss_dssp TCCSCCCHHHHHHHHHHHHTTCCTTSCBCSSSCCCSCGGGGGGCCCSSCSS
T ss_pred cccccccHHHHHHHHHHHHHhcCCCCCeeeccCCCChhhhhcccchhhhhc
Confidence 357889999999999999999999999999999999999999999999864
|
| >d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} | Back information, alignment and structure |
|---|
| >d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} | Back information, alignment and structure |
|---|
| >d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d2sqca2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1c3da_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w6ka2 a.102.4.2 (A:100-378) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hzfa_ a.102.4.4 (A:) C4adg fragment of complement factor C4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sqca2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dssb1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3dssb1 a.102.4.3 (B:7-331) Rab geranylgeranyltransferase, beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1n4qb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2h6fb1 a.102.4.3 (B:521-921) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hzfa_ a.102.4.4 (A:) C4adg fragment of complement factor C4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n4qb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} | Back information, alignment and structure |
|---|
| >d1c3da_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ia6a_ a.102.1.2 (A:) Nonprocessive cellulase Cel9M {Clostridium cellulolyticum [TaxId: 1521]} | Back information, alignment and structure |
|---|
| >d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]} | Back information, alignment and structure |
|---|
| >d1c6sa_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Cyanobacterium (Synechococcus elongatus) [TaxId: 32046]} | Back information, alignment and structure |
|---|
| >d1ctja_ a.3.1.1 (A:) Cytochrome c6 (synonym: cytochrome c553) {Monoraphidium braunii [TaxId: 34112]} | Back information, alignment and structure |
|---|
| >d1ks8a_ a.102.1.2 (A:) Endo-b-1,4-glucanase {Termite (Nasutitermes takasagoensis) [TaxId: 62960]} | Back information, alignment and structure |
|---|
| >d1cf7b_ a.4.5.17 (B:) Cell cycle transcription factor DP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g87a1 a.102.1.2 (A:3-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]} | Back information, alignment and structure |
|---|
| >d1tf4a1 a.102.1.2 (A:1-460) Endo/exocellulase:cellobiose E-4, N-terminal domain {Thermomonospora fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|