Citrus Sinensis ID: 035488

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MPQSFITNDEFLSNRCIWVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPFPEDFPRVPHQFDINPRFNETVQSAKYDETFGFWRIKTISSSDSSFCEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILLILARLILGNVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIRSGDIKVVPGIKKFSPGKVELVNGQVLEIDSVVLATGYRSNVPSWLKENEFFSENGIPKNPFPNGWKGKTGLYAVGFTKRGLSGASLDAMSVALDIAKSWKEETKQKKKSIASRQRRCISHF
ccccccccccccccccccccccEEEcccHHHHHHHHHHHHcccccEEEEccccccccccccccccEEEEcccccccccccccccccccccccccHHHHHHHHHHHcEEcccccEEEEEEEEcccccEEEEEEEccEEEEEEcccccccccccccccccccEEEEccccccccccccccEEEEcccccHHHHHHHHHccccccEEEEccccEEEEEEEcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHcccccccccccccccccccccEEcHHHHHHHHcccEEEEccccEEEcccEEEccccEEcccEEEEcccccccccccccccccccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHHccccHHHHccccHHHHHHHccc
cccHcccccccccccEEEEccEEEEcccHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHcEEEEccccHHccccccccccccccccccccEEEEEEEEEEEEEEccccccEEEEEEccccccccEEEEEEEEEEEEccccccccccccccHHHcccEEEEcccccccHHccccEEEEEEccccHcHHHHHHHHccccEEEEEEccEEEEcHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHccccccccEEccccHHHHccccEEEEccEEEEEccEEEEEcccEEEEEEEEEEcccccccccccccccEEEccccccccccccccccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHccccccccccccHHccc
mpqsfitndeflsnrciwvngpvivgagpSGLAVAAGlknqgvpfIILERANCIASLWQnrtydrlklhlpkqfcqlpnfpfpedfprvphqfdinprfnetvqsakydetfgfwriktisssdssfceVEYICRWLVVAtgenaekiepefeglqhfegnvmhagdyksgasyrgkRVLVVGCGNSGMEVSLDLcnhnakpsmvvrssvhvlprevlgkSTFQLAVLMMKYFPLWLVDKILLILARLILGnvekyglkrpptgpielknnegktpvldigalqkirsgdikvvpgikkfspgkvelvngqvlEIDSVVLAtgyrsnvpswlkeneffsengipknpfpngwkgktglyAVGFtkrglsgaSLDAMSVALDIAKSWKEETKQKKKSIASRQRRCISHF
MPQSFITNDEFLSNRCIWVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPFPEDFPRVPHQFDINPRFNETVQSAKYDETFGFWRIKtisssdssfcEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILLILARLILGNVekyglkrpptgpielknnegktpVLDIGalqkirsgdikvvpgikkfspgkvelvngqVLEIDSVVLATGYRSNVPSWLKENEFFSENGIPKNPFPNGWKGKTGLYAVGFTKRGLSGASLDAMSVALDIAKSWkeetkqkkksiasrqrrcishf
MPQSFITNDEFLSNRCIWVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPFPEDFPRVPHQFDINPRFNETVQSAKYDETFGFWRIKTISSSDSSFCEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILLILARLILGNVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIRSGDIKVVPGIKKFSPGKVELVNGQVLEIDSVVLATGYRSNVPSWLKENEFFSENGIPKNPFPNGWKGKTGLYAVGFTKRGLSGASLDAMSVALDIAkswkeetkqkkksIASRQRRCISHF
*****ITNDEFLSNRCIWVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPFPEDFPRVPHQFDINPRFNETVQSAKYDETFGFWRIKTISSSDSSFCEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILLILARLILGNVEKYGLKR*************KTPVLDIGALQKIRSGDIKVVPGIKKFSPGKVELVNGQVLEIDSVVLATGYRSNVPSWLKENEFFSENGIPKNPFPNGWKGKTGLYAVGFTKRGLSGASLDAMSVALDIA*************************
****************IWVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPFPEDFPRVPHQFDINPRFNETVQSAKYDETFGFWRIKTISSSDSSFCEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILLILARLILGNVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIRSGDIKVVPGIKKFSPGKVELVNGQVLEIDSVVLATGYRSNVPSWLKENEFFSENGIPKNPFPNGWKGKTGLYAVGFTKRGLSGASLDAMSVALDIAKS****************RRCISHF
MPQSFITNDEFLSNRCIWVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPFPEDFPRVPHQFDINPRFNETVQSAKYDETFGFWRIKTISSSDSSFCEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILLILARLILGNVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIRSGDIKVVPGIKKFSPGKVELVNGQVLEIDSVVLATGYRSNVPSWLKENEFFSENGIPKNPFPNGWKGKTGLYAVGFTKRGLSGASLDAMSVALDIAKSWK*********************
***********LSNRCIWVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPFPEDFPRVPHQFDINPRFNETVQSAKYDETFGFWRIKTISSSDSSFCEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILLILARLILGNVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIRSGDIKVVPGIKKFSPGKVELVNGQVLEIDSVVLATGYRSNVPSWLKENEFFSENGIPKNPFPNGWKGKTGLYAVGFTKRGLSGASLDAMSVALDIAKSWKEETKQKKKSI***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQSFITNDEFLSNRCIWVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPFPEDFPRVPHQFDINPRFNETVQSAKYDETFGFWRIKTISSSDSSFCEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILLILARLILGNVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIRSGDIKVVPGIKKFSPGKVELVNGQVLEIDSVVLATGYRSNVPSWLKENEFFSENGIPKNPFPNGWKGKTGLYAVGFTKRGLSGASLDAMSVALDIAKSWKEETKQKKKSIASRQRRCISHF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query408 2.2.26 [Sep-21-2011]
O23024437 Flavin-containing monooxy yes no 0.977 0.913 0.757 0.0
O49312431 Putative flavin-containin no no 0.990 0.937 0.742 1e-179
Q9SVU0426 Flavin-containing monooxy no no 0.980 0.938 0.678 1e-168
Q9LKC0424 Flavin-containing monooxy no no 0.977 0.941 0.676 1e-159
O64489421 Flavin-containing monooxy no no 0.975 0.945 0.647 1e-158
Q8VZ59417 Flavin-containing monooxy no no 0.924 0.904 0.569 1e-131
Q9LFM5411 Flavin-containing monooxy no no 0.887 0.880 0.577 1e-128
Q9SZY8414 Flavin-containing monooxy no no 0.936 0.922 0.508 1e-122
Q9SVQ1415 Flavin-containing monooxy no no 0.899 0.884 0.545 1e-121
Q9LPL3391 Putative flavin-containin no no 0.860 0.897 0.446 7e-90
>sp|O23024|YUC3_ARATH Flavin-containing monooxygenase YUCCA3 OS=Arabidopsis thaliana GN=YUC3 PE=2 SV=1 Back     alignment and function desciption
 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/413 (75%), Positives = 354/413 (85%), Gaps = 14/413 (3%)

Query: 10  EFLSNRCIWVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLH 69
           +  S RCIWVNGPVIVGAGPSGLAVAAGLK +GVPFIILERANCIASLWQNRTYDRLKLH
Sbjct: 25  DIFSRRCIWVNGPVIVGAGPSGLAVAAGLKREGVPFIILERANCIASLWQNRTYDRLKLH 84

Query: 70  LPKQFCQLPNFPFPEDFPRVPHQF-------------DINPRFNETVQSAKYDETFGFWR 116
           LPKQFCQLPN+PFP++FP  P +F             DINP+FNETVQSAKYDETFG WR
Sbjct: 85  LPKQFCQLPNYPFPDEFPEYPTKFQFIQYLESYAANFDINPKFNETVQSAKYDETFGLWR 144

Query: 117 IKTISSSDS-SFCEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYR 175
           +KTIS+      CE EYICRW+VVATGENAEK+ P+FEGL+ F G+V+HAGDYKSG  Y+
Sbjct: 145 VKTISNMGQLGSCEFEYICRWIVVATGENAEKVVPDFEGLEDFGGDVLHAGDYKSGGRYQ 204

Query: 176 GKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPL 235
           GK+VLVVGCGNSGMEVSLDL NH A PSMVVRS+VHVLPRE+ GKSTF+L V MMKY P+
Sbjct: 205 GKKVLVVGCGNSGMEVSLDLYNHGANPSMVVRSAVHVLPREIFGKSTFELGVTMMKYMPV 264

Query: 236 WLVDKILLILARLILGNVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIRSGDIKVVP 295
           WL DK +L LAR+ILGN +KYGLKRP  GP+ELKN EGKTPVLDIGAL KIRSG IK+VP
Sbjct: 265 WLADKTILFLARIILGNTDKYGLKRPKIGPLELKNKEGKTPVLDIGALPKIRSGKIKIVP 324

Query: 296 GIKKFSPGKVELVNGQVLEIDSVVLATGYRSNVPSWLKENEFFSENGIPKNPFPNGWKGK 355
           GI KF  GKVEL++G+VLEIDSV+LATGYRSNVPSWLK+N+FFS++GIPKNPFPNGWKG+
Sbjct: 325 GIIKFGKGKVELIDGRVLEIDSVILATGYRSNVPSWLKDNDFFSDDGIPKNPFPNGWKGE 384

Query: 356 TGLYAVGFTKRGLSGASLDAMSVALDIAKSWKEETKQKKKSIASRQRRCISHF 408
            GLYAVGFT++GL GASLDAMSVA DIA  WKEE+KQ+KK+ A+R RRCISHF
Sbjct: 385 AGLYAVGFTRKGLFGASLDAMSVAHDIANRWKEESKQQKKTAAARHRRCISHF 437
Involved in auxin biosynthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: -
>sp|O49312|YUC7_ARATH Putative flavin-containing monooxygenase YUCCA7 OS=Arabidopsis thaliana GN=YUC7 PE=3 SV=1 Back     alignment and function description
>sp|Q9SVU0|YUC8_ARATH Flavin-containing monooxygenase YUCCA8 OS=Arabidopsis thaliana GN=YUC8 PE=2 SV=1 Back     alignment and function description
>sp|Q9LKC0|YUC5_ARATH Flavin-containing monooxygenase YUCCA5 OS=Arabidopsis thaliana GN=YUC5 PE=2 SV=1 Back     alignment and function description
>sp|O64489|YUC9_ARATH Flavin-containing monooxygenase YUCCA9 OS=Arabidopsis thaliana GN=YUC9 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZ59|YUC6_ARATH Flavin-containing monooxygenase YUCCA6 OS=Arabidopsis thaliana GN=YUC6 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFM5|YUC4_ARATH Flavin-containing monooxygenase YUCCA4 OS=Arabidopsis thaliana GN=YUC4 PE=2 SV=1 Back     alignment and function description
>sp|Q9SZY8|YUC1_ARATH Flavin-containing monooxygenase YUCCA1 OS=Arabidopsis thaliana GN=YUC1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVQ1|YUC2_ARATH Flavin-containing monooxygenase YUCCA2 OS=Arabidopsis thaliana GN=YUC2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LPL3|YUC11_ARATH Putative flavin-containing monooxygenase YUCCA11 OS=Arabidopsis thaliana GN=YUC11 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
224100011421 flavine-containing monoxygenase [Populus 1.0 0.969 0.776 0.0
255554302421 monooxygenase, putative [Ricinus communi 1.0 0.969 0.800 0.0
381216453428 YUC4 [Fragaria vesca] 0.987 0.941 0.776 0.0
449432480431 PREDICTED: flavin-containing monooxygena 0.985 0.932 0.757 0.0
356533385441 PREDICTED: flavin-containing monooxygena 0.997 0.922 0.75 0.0
297843272437 flavin-containing monooxygenase [Arabido 1.0 0.933 0.749 0.0
15219767437 YUCCA family monooxygenase [Arabidopsis 0.977 0.913 0.757 0.0
224107585422 flavine-containing monoxygenase [Populus 0.982 0.950 0.802 0.0
356575190429 PREDICTED: flavin-containing monooxygena 0.997 0.948 0.762 0.0
255560293423 monooxygenase, putative [Ricinus communi 0.982 0.947 0.714 1e-178
>gi|224100011|ref|XP_002311709.1| flavine-containing monoxygenase [Populus trichocarpa] gi|222851529|gb|EEE89076.1| flavine-containing monoxygenase [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/421 (77%), Positives = 365/421 (86%), Gaps = 13/421 (3%)

Query: 1   MPQSFITNDEFLSNRCIWVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQN 60
           M Q+   + +F + RCIWVNGPVIVGAGPSGLAV +GL+ QGVPF++LERANCIASLWQN
Sbjct: 1   MFQTSGPDHDFFARRCIWVNGPVIVGAGPSGLAVGSGLRGQGVPFVMLERANCIASLWQN 60

Query: 61  RTYDRLKLHLPKQFCQLPNFPFPEDFPRVP-------------HQFDINPRFNETVQSAK 107
           RTYDRLKLH+PKQFCQLP+FPFPEDFP  P               F+INP FNETVQSAK
Sbjct: 61  RTYDRLKLHIPKQFCQLPSFPFPEDFPEYPTKYQFINYLESYAKHFNINPHFNETVQSAK 120

Query: 108 YDETFGFWRIKTISSSDSSFCEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGD 167
           YDETFG WR+KT+S+S S+  EVEYICRWLVVATGENAEK  PEFEGLQ F G+VMHA D
Sbjct: 121 YDETFGLWRVKTVSTSSSNPSEVEYICRWLVVATGENAEKFSPEFEGLQDFGGHVMHACD 180

Query: 168 YKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAV 227
           YKSG SY G+RVLVVGCGNSGMEVSLDLCNHNA PSMVVRSSVHVLPRE+LG+STF+LAV
Sbjct: 181 YKSGESYHGERVLVVGCGNSGMEVSLDLCNHNASPSMVVRSSVHVLPREILGRSTFELAV 240

Query: 228 LMMKYFPLWLVDKILLILARLILGNVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIR 287
            MMK+ PLW+VDKILL+ A LILGN+EKYGL RP  GP++LKN +GKTPVLDIGAL+KIR
Sbjct: 241 TMMKWLPLWMVDKILLLFAWLILGNLEKYGLTRPCLGPLQLKNTQGKTPVLDIGALEKIR 300

Query: 288 SGDIKVVPGIKKFSPGKVELVNGQVLEIDSVVLATGYRSNVPSWLKENEFFSENGIPKNP 347
           SG IKVVPGIK+FS GK ELVNG++L+IDSV+LATGYRSNVPSWLKENEFFSE+GIPKN 
Sbjct: 301 SGKIKVVPGIKRFSSGKAELVNGEILQIDSVILATGYRSNVPSWLKENEFFSEDGIPKNQ 360

Query: 348 FPNGWKGKTGLYAVGFTKRGLSGASLDAMSVALDIAKSWKEETKQKKKSIASRQRRCISH 407
           FPNGWKG  GLYAVGFTKRGLSGASLDA+SVA DIAKSWKEETKQKK ++A+R RRCISH
Sbjct: 361 FPNGWKGNAGLYAVGFTKRGLSGASLDAISVAFDIAKSWKEETKQKKITVAARHRRCISH 420

Query: 408 F 408
           F
Sbjct: 421 F 421

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255554302|ref|XP_002518191.1| monooxygenase, putative [Ricinus communis] gi|223542787|gb|EEF44324.1| monooxygenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|381216453|gb|AFG16917.1| YUC4 [Fragaria vesca] Back     alignment and taxonomy information
>gi|449432480|ref|XP_004134027.1| PREDICTED: flavin-containing monooxygenase YUCCA3-like [Cucumis sativus] gi|449487492|ref|XP_004157653.1| PREDICTED: flavin-containing monooxygenase YUCCA3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356533385|ref|XP_003535245.1| PREDICTED: flavin-containing monooxygenase YUCCA3-like [Glycine max] Back     alignment and taxonomy information
>gi|297843272|ref|XP_002889517.1| flavin-containing monooxygenase [Arabidopsis lyrata subsp. lyrata] gi|297335359|gb|EFH65776.1| flavin-containing monooxygenase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15219767|ref|NP_171955.1| YUCCA family monooxygenase [Arabidopsis thaliana] gi|75318059|sp|O23024.1|YUC3_ARATH RecName: Full=Flavin-containing monooxygenase YUCCA3 gi|2494132|gb|AAB80641.1| Contains similarity to human dimethylaniline monooxygenase (gb|M64082) [Arabidopsis thaliana] gi|16555356|gb|AAL23752.1| flavin-containing monooxygenase YUCCA3 [Arabidopsis thaliana] gi|40823347|gb|AAR92277.1| At1g04610 [Arabidopsis thaliana] gi|46518417|gb|AAS99690.1| At1g04610 [Arabidopsis thaliana] gi|110737444|dbj|BAF00666.1| putative dimethylaniline monooxygenase [Arabidopsis thaliana] gi|332189600|gb|AEE27721.1| YUCCA family monooxygenase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224107585|ref|XP_002314526.1| flavine-containing monoxygenase [Populus trichocarpa] gi|222863566|gb|EEF00697.1| flavine-containing monoxygenase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356575190|ref|XP_003555725.1| PREDICTED: flavin-containing monooxygenase YUCCA3-like [Glycine max] Back     alignment and taxonomy information
>gi|255560293|ref|XP_002521164.1| monooxygenase, putative [Ricinus communis] gi|223539733|gb|EEF41315.1| monooxygenase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
TAIR|locus:2197863437 YUC3 "YUCCA 3" [Arabidopsis th 1.0 0.933 0.728 7.6e-167
TAIR|locus:2046545431 YUC7 "AT2G33230" [Arabidopsis 0.990 0.937 0.723 1.7e-162
TAIR|locus:2117783426 YUC8 "AT4G28720" [Arabidopsis 0.977 0.936 0.665 1.8e-149
TAIR|locus:2149524424 YUC5 "AT5G43890" [Arabidopsis 0.958 0.922 0.674 3.1e-147
TAIR|locus:2020250421 YUC9 "AT1G04180" [Arabidopsis 0.973 0.942 0.634 6.8e-143
TAIR|locus:2147962411 YUC4 "AT5G11320" [Arabidopsis 0.877 0.871 0.583 1.8e-117
TAIR|locus:2119340415 YUC2 "YUCCA2" [Arabidopsis tha 0.914 0.898 0.538 1.1e-112
TAIR|locus:2131322414 YUC1 "YUCCA 1" [Arabidopsis th 0.879 0.867 0.531 7e-109
TAIR|locus:2026967391 YUC11 "AT1G21430" [Arabidopsis 0.860 0.897 0.446 1.9e-83
TAIR|locus:2028558383 YUC10 "AT1G48910" [Arabidopsis 0.865 0.921 0.432 5.4e-79
TAIR|locus:2197863 YUC3 "YUCCA 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1623 (576.4 bits), Expect = 7.6e-167, P = 7.6e-167
 Identities = 308/423 (72%), Positives = 347/423 (82%)

Query:     1 MPQSFITN-DEFLSNRCIWVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQ 59
             M Q+ I    +  S RCIWVNGPVIVGAGPSGLAVAAGLK +GVPFIILERANCIASLWQ
Sbjct:    15 MFQNLIPEGSDIFSRRCIWVNGPVIVGAGPSGLAVAAGLKREGVPFIILERANCIASLWQ 74

Query:    60 NRTYDRLKLHLPKQFCQLPNFPFPEDFPRVPHQF-------------DINPRFNETVQSA 106
             NRTYDRLKLHLPKQFCQLPN+PFP++FP  P +F             DINP+FNETVQSA
Sbjct:    75 NRTYDRLKLHLPKQFCQLPNYPFPDEFPEYPTKFQFIQYLESYAANFDINPKFNETVQSA 134

Query:   107 KYDETFGFWRIKTISSSDS-SFCEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHA 165
             KYDETFG WR+KTIS+      CE EYICRW+VVATGENAEK+ P+FEGL+ F G+V+HA
Sbjct:   135 KYDETFGLWRVKTISNMGQLGSCEFEYICRWIVVATGENAEKVVPDFEGLEDFGGDVLHA 194

Query:   166 GDYKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQL 225
             GDYKSG  Y+GK+VLVVGCGNSGMEVSLDL NH A PSMVVRS+VHVLPRE+ GKSTF+L
Sbjct:   195 GDYKSGGRYQGKKVLVVGCGNSGMEVSLDLYNHGANPSMVVRSAVHVLPREIFGKSTFEL 254

Query:   226 AVLMMKYFPLWLVDKILLILARLILGNVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQK 285
              V MMKY P+WL DK +L LAR+ILGN +KYGLKRP  GP+ELKN EGKTPVLDIGAL K
Sbjct:   255 GVTMMKYMPVWLADKTILFLARIILGNTDKYGLKRPKIGPLELKNKEGKTPVLDIGALPK 314

Query:   286 IRSGDIKVVPGIKKFSPGKVELVNGQVLEIDSVVLATGYRSNVPSWLKENEFFSENGIPK 345
             IRSG IK+VPGI KF  GKVEL++G+VLEIDSV+LATGYRSNVPSWLK+N+FFS++GIPK
Sbjct:   315 IRSGKIKIVPGIIKFGKGKVELIDGRVLEIDSVILATGYRSNVPSWLKDNDFFSDDGIPK 374

Query:   346 NPFPNGWKGKTGLYAVGFTKRGLSGASLDAMSVALDIAXXXXXXXXXXXXXIASRQRRCI 405
             NPFPNGWKG+ GLYAVGFT++GL GASLDAMSVA DIA              A+R RRCI
Sbjct:   375 NPFPNGWKGEAGLYAVGFTRKGLFGASLDAMSVAHDIANRWKEESKQQKKTAAARHRRCI 434

Query:   406 SHF 408
             SHF
Sbjct:   435 SHF 437
GO:0004499 "N,N-dimethylaniline monooxygenase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009851 "auxin biosynthetic process" evidence=IMP
TAIR|locus:2046545 YUC7 "AT2G33230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117783 YUC8 "AT4G28720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149524 YUC5 "AT5G43890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020250 YUC9 "AT1G04180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147962 YUC4 "AT5G11320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119340 YUC2 "YUCCA2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131322 YUC1 "YUCCA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026967 YUC11 "AT1G21430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028558 YUC10 "AT1G48910" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O23024YUC3_ARATH1, ., 1, 4, ., 1, 3, ., -0.75780.97790.9130yesno
O49312YUC7_ARATH1, ., 1, 4, ., 1, 3, ., -0.74220.99010.9373nono

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.13LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
FML6
flavine-containing monoxygenase (421 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pg.C_scaffold_803000002
hypothetical protein (316 aa)
     •  0.899

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in 2e-47
pfam00743 532 pfam00743, FMO-like, Flavin-binding monooxygenase- 3e-23
TIGR04046400 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxido 4e-15
pfam13738202 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulp 3e-14
TIGR04018316 TIGR04018, Bthiol_YpdA, putative bacillithiol syst 3e-14
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslat 3e-11
pfam13434335 pfam13434, K_oxygenase, L-lysine 6-monooxygenase ( 2e-10
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 3e-10
COG3486436 COG3486, IucD, Lysine/ornithine N-monooxygenase [S 5e-07
TIGR01292299 TIGR01292, TRX_reduct, thioredoxin-disulfide reduc 8e-07
PLN02172461 PLN02172, PLN02172, flavin-containing monooxygenas 1e-06
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 3e-06
PRK08132 547 PRK08132, PRK08132, FAD-dependent oxidoreductase; 9e-06
PRK10262321 PRK10262, PRK10262, thioredoxin reductase; Provisi 3e-05
PRK06126 545 PRK06126, PRK06126, hypothetical protein; Provisio 2e-04
PRK06184 502 PRK06184, PRK06184, hypothetical protein; Provisio 5e-04
PRK08243392 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygen 0.001
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 0.001
PRK09126392 PRK09126, PRK09126, hypothetical protein; Provisio 0.003
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase 0.004
>gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information 
 Score =  167 bits (425), Expect = 2e-47
 Identities = 95/346 (27%), Positives = 148/346 (42%), Gaps = 41/346 (11%)

Query: 23  VIVGAGPSGLAVAAGLKNQGVP-FIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFP 81
            I+GAG SGLA A  LK  GVP F+I E+ + +   W+   Y  L+L  PK     P  P
Sbjct: 12  AIIGAGQSGLAAAYALKQAGVPDFVIFEKRDDVGGTWRYNRYPGLRLDSPKWLLGFPFLP 71

Query: 82  FP--EDFPRVPH----------QFDINP--RFNETVQSAKYDETFGFWRIKTISSSDSSF 127
           F   E F               ++ +    RFN  V+ A +DE    W + T        
Sbjct: 72  FRWDEAFAPFAEIKDYIKDYLEKYGLRFQIRFNTRVEVADWDEDTKRWTVTTSDGG---- 127

Query: 128 CEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNS 187
              E    ++VVATG  +E   P+F GL  F+G ++H+ D+ +    RGKRVLV+G G S
Sbjct: 128 -TGELTADFVVVATGHLSEPYIPDFAGLDEFKGRILHSADWPNPEDLRGKRVLVIGAGAS 186

Query: 188 GMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILLILA- 246
            ++++ +L    A  ++  RS  H+LP+ +LG+       L       W + +  ++ A 
Sbjct: 187 AVDIAPELAEVGASVTLSQRSPPHILPKPLLGEEVGGRLALRRALPAGWALRRGRVLDAL 246

Query: 247 ------RLILGNVEKYGLKRP----------PTGPIELKNN---EGKTPVLDIGALQKIR 287
                        +K                     +L  +        V D    +   
Sbjct: 247 LPGAGYLPAFPAPDKRVEALLRAALRFLVLDAGVREDLGPDYAPGDGRLVPDGDLFEAGA 306

Query: 288 SGDIKVVPG-IKKFSPGKVELVNGQVLEIDSVVLATGYRSNVPSWL 332
           SGD++VV   I +F+ G + L +G+  E D ++ ATG  +N  S  
Sbjct: 307 SGDVEVVTEIIDRFTEGGILLDSGREEEADVIITATGLDANDLSGA 352

Length = 443
>gnl|CDD|109787 pfam00743, FMO-like, Flavin-binding monooxygenase-like Back     alignment and domain information
>gnl|CDD|234447 TIGR04046, MSMEG_0569_nitr, flavin-dependent oxidoreductase, MSMEG_0569 family Back     alignment and domain information
>gnl|CDD|222355 pfam13738, Pyr_redox_3, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|188533 TIGR04018, Bthiol_YpdA, putative bacillithiol system oxidoreductase, YpdA family Back     alignment and domain information
>gnl|CDD|223566 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222125 pfam13434, K_oxygenase, L-lysine 6-monooxygenase (NADPH-requiring) Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|226017 COG3486, IucD, Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|233345 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236158 PRK08132, PRK08132, FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|182343 PRK10262, PRK10262, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|235704 PRK06126, PRK06126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235728 PRK06184, PRK06184, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236198 PRK08243, PRK08243, 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237942 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 408
PF00743 531 FMO-like: Flavin-binding monooxygenase-like; Inter 100.0
PLN02172461 flavin-containing monooxygenase FMO GS-OX 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 100.0
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 100.0
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 100.0
PRK13512 438 coenzyme A disulfide reductase; Provisional 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 100.0
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 100.0
PLN02507 499 glutathione reductase 100.0
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 100.0
PRK05249 461 soluble pyridine nucleotide transhydrogenase; Prov 100.0
PRK06116450 glutathione reductase; Validated 100.0
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 100.0
PRK08010 441 pyridine nucleotide-disulfide oxidoreductase; Prov 100.0
PRK14989 847 nitrite reductase subunit NirD; Provisional 100.0
PTZ00318424 NADH dehydrogenase-like protein; Provisional 100.0
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 100.0
TIGR02053 463 MerA mercuric reductase. This model represents the 100.0
PRK06370 463 mercuric reductase; Validated 100.0
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 100.0
PRK14694 468 putative mercuric reductase; Provisional 100.0
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 100.0
PRK06416 462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06467 471 dihydrolipoamide dehydrogenase; Reviewed 99.98
TIGR01423 486 trypano_reduc trypanothione-disulfide reductase. T 99.98
PRK14727 479 putative mercuric reductase; Provisional 99.98
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.98
PRK13748 561 putative mercuric reductase; Provisional 99.98
PRK06115 466 dihydrolipoamide dehydrogenase; Reviewed 99.98
PRK09564 444 coenzyme A disulfide reductase; Reviewed 99.98
PRK12831464 putative oxidoreductase; Provisional 99.97
PLN02546 558 glutathione reductase 99.97
PTZ00058 561 glutathione reductase; Provisional 99.97
PRK07818 466 dihydrolipoamide dehydrogenase; Reviewed 99.97
PRK07845 466 flavoprotein disulfide reductase; Reviewed 99.97
PRK06292 460 dihydrolipoamide dehydrogenase; Validated 99.97
PRK05976 472 dihydrolipoamide dehydrogenase; Validated 99.97
PRK07846 451 mycothione reductase; Reviewed 99.97
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 99.97
PRK06327 475 dihydrolipoamide dehydrogenase; Validated 99.97
TIGR01350 461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.97
TIGR01438 484 TGR thioredoxin and glutathione reductase selenopr 99.97
PTZ00052 499 thioredoxin reductase; Provisional 99.97
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 99.97
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 99.97
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 99.97
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 99.97
PRK12779 944 putative bifunctional glutamate synthase subunit b 99.97
PTZ00153 659 lipoamide dehydrogenase; Provisional 99.97
KOG0405 478 consensus Pyridine nucleotide-disulphide oxidoredu 99.97
PRK06912 458 acoL dihydrolipoamide dehydrogenase; Validated 99.96
TIGR03452 452 mycothione_red mycothione reductase. Mycothiol, a 99.96
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 99.96
PRK12814 652 putative NADPH-dependent glutamate synthase small 99.96
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 99.96
PRK12770352 putative glutamate synthase subunit beta; Provisio 99.96
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 99.96
KOG0404322 consensus Thioredoxin reductase [Posttranslational 99.96
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 99.95
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 99.95
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 99.95
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 99.95
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.95
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 99.94
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 99.94
KOG1335 506 consensus Dihydrolipoamide dehydrogenase [Energy p 99.94
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 99.94
PRK13984604 putative oxidoreductase; Provisional 99.94
PRK12771564 putative glutamate synthase (NADPH) small subunit; 99.93
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 99.93
KOG4716 503 consensus Thioredoxin reductase [Posttranslational 99.93
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 99.93
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 99.93
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 99.93
PLN02852491 ferredoxin-NADP+ reductase 99.92
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 99.91
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 99.88
KOG03992142 consensus Glutamate synthase [Amino acid transport 99.83
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 99.83
KOG1346 659 consensus Programmed cell death 8 (apoptosis-induc 99.81
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 99.8
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 99.77
PRK06567 1028 putative bifunctional glutamate synthase subunit b 99.76
PTZ00188506 adrenodoxin reductase; Provisional 99.74
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 99.71
COG4529474 Uncharacterized protein conserved in bacteria [Fun 99.62
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 99.61
PRK09897534 hypothetical protein; Provisional 99.59
KOG2755334 consensus Oxidoreductase [General function predict 99.54
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 99.51
COG2081408 Predicted flavoproteins [General function predicti 99.48
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.27
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 99.13
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.12
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.11
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.09
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.08
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.07
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 99.06
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.05
PRK08013400 oxidoreductase; Provisional 99.05
PRK09126392 hypothetical protein; Provisional 99.01
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.0
PRK06834488 hypothetical protein; Provisional 99.0
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.99
PRK06184502 hypothetical protein; Provisional 98.99
PRK06847375 hypothetical protein; Provisional 98.99
PRK10157428 putative oxidoreductase FixC; Provisional 98.99
PRK05868372 hypothetical protein; Validated 98.98
PRK08244493 hypothetical protein; Provisional 98.96
PLN02463447 lycopene beta cyclase 98.96
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.96
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.95
PRK10015429 oxidoreductase; Provisional 98.95
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.95
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.94
PRK07236386 hypothetical protein; Provisional 98.94
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.94
PRK07190487 hypothetical protein; Provisional 98.93
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.92
PRK11445351 putative oxidoreductase; Provisional 98.91
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 98.91
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.91
PRK07045388 putative monooxygenase; Reviewed 98.9
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.9
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 98.9
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 98.89
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 98.88
PRK07588391 hypothetical protein; Provisional 98.88
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 98.87
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.87
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.86
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.86
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.84
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.84
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.83
PRK06753373 hypothetical protein; Provisional 98.83
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 98.82
PRK08163396 salicylate hydroxylase; Provisional 98.8
PRK06126 545 hypothetical protein; Provisional 98.8
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.8
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.78
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.77
PLN02697529 lycopene epsilon cyclase 98.77
PRK06185407 hypothetical protein; Provisional 98.77
PRK06475400 salicylate hydroxylase; Provisional 98.76
PLN02661357 Putative thiazole synthesis 98.75
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.74
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.74
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.74
PRK07538413 hypothetical protein; Provisional 98.73
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.72
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.72
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.72
PRK12266 508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.72
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.71
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.71
PRK06996398 hypothetical protein; Provisional 98.7
COG0579429 Predicted dehydrogenase [General function predicti 98.68
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.68
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.68
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.66
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.66
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 98.65
PRK08274466 tricarballylate dehydrogenase; Validated 98.64
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.64
PRK11101 546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.64
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.64
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.62
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.62
PRK08294 634 phenol 2-monooxygenase; Provisional 98.62
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.61
PRK11728393 hydroxyglutarate oxidase; Provisional 98.59
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.59
COG2081 408 Predicted flavoproteins [General function predicti 98.57
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.55
PLN02985514 squalene monooxygenase 98.55
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.53
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.52
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.52
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 98.5
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.49
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.49
PLN02927 668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.49
TIGR02053463 MerA mercuric reductase. This model represents the 98.48
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.47
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.46
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 98.46
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.44
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 98.44
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 98.44
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.44
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.44
PRK06370463 mercuric reductase; Validated 98.42
PRK13977 576 myosin-cross-reactive antigen; Provisional 98.41
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.39
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.39
PRK08401466 L-aspartate oxidase; Provisional 98.39
PLN02464 627 glycerol-3-phosphate dehydrogenase 98.38
PRK07208479 hypothetical protein; Provisional 98.37
PRK06116450 glutathione reductase; Validated 98.36
PRK06175433 L-aspartate oxidase; Provisional 98.36
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 98.34
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.34
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.34
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.33
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 98.33
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.33
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 98.33
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; 98.33
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.33
PRK07804 541 L-aspartate oxidase; Provisional 98.33
PRK05257494 malate:quinone oxidoreductase; Validated 98.32
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 98.32
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.32
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.32
PRK08071 510 L-aspartate oxidase; Provisional 98.32
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 98.32
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.32
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 98.32
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.3
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.29
PRK07846451 mycothione reductase; Reviewed 98.29
COG1231450 Monoamine oxidase [Amino acid transport and metabo 98.29
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.28
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.28
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.27
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.27
COG2907447 Predicted NAD/FAD-binding protein [General functio 98.27
PLN02507499 glutathione reductase 98.26
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.26
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.26
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 98.25
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.24
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 98.24
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 98.23
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.23
PRK13512438 coenzyme A disulfide reductase; Provisional 98.22
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 98.22
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.22
PRK14694468 putative mercuric reductase; Provisional 98.22
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.21
PRK06263 543 sdhA succinate dehydrogenase flavoprotein subunit; 98.2
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 98.2
PLN02815 594 L-aspartate oxidase 98.18
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 98.18
PRK08275 554 putative oxidoreductase; Provisional 98.17
PRK07233434 hypothetical protein; Provisional 98.17
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.17
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 98.16
COG3349485 Uncharacterized conserved protein [Function unknow 98.15
PRK14727479 putative mercuric reductase; Provisional 98.15
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 98.14
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.14
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.13
PLN02268435 probable polyamine oxidase 98.13
PRK13748561 putative mercuric reductase; Provisional 98.12
PTZ00058561 glutathione reductase; Provisional 98.12
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.11
PTZ00153659 lipoamide dehydrogenase; Provisional 98.11
KOG0042 680 consensus Glycerol-3-phosphate dehydrogenase [Ener 98.11
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.11
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 98.1
PTZ00052499 thioredoxin reductase; Provisional 98.1
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.1
KOG2415 621 consensus Electron transfer flavoprotein ubiquinon 98.1
PRK07395 553 L-aspartate oxidase; Provisional 98.1
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.1
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.1
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 98.09
PLN02576496 protoporphyrinogen oxidase 98.08
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 98.07
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 98.07
PLN02676487 polyamine oxidase 98.06
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 98.06
PRK12416463 protoporphyrinogen oxidase; Provisional 98.05
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 98.04
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 98.03
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.01
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 98.01
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.0
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.0
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.99
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.99
PLN02568 539 polyamine oxidase 97.99
PTZ00318 424 NADH dehydrogenase-like protein; Provisional 97.97
PRK10262321 thioredoxin reductase; Provisional 97.97
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.97
KOG2960328 consensus Protein involved in thiamine biosynthesi 97.96
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.96
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 97.93
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.93
COG3573 552 Predicted oxidoreductase [General function predict 97.92
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.92
PF03486 409 HI0933_like: HI0933-like protein; InterPro: IPR004 97.91
PLN02546558 glutathione reductase 97.9
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 97.9
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.9
KOG1298509 consensus Squalene monooxygenase [Lipid transport 97.89
TIGR03169 364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.86
PRK12779 944 putative bifunctional glutamate synthase subunit b 97.86
PRK07512 513 L-aspartate oxidase; Provisional 97.85
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.83
PRK12842 574 putative succinate dehydrogenase; Reviewed 97.83
PLN02529 738 lysine-specific histone demethylase 1 97.81
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.8
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, f 97.79
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.79
PRK07121492 hypothetical protein; Validated 97.79
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.78
PLN02487 569 zeta-carotene desaturase 97.77
PRK12831464 putative oxidoreductase; Provisional 97.77
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.76
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.74
KOG2852380 consensus Possible oxidoreductase [General functio 97.73
PLN02328 808 lysine-specific histone demethylase 1 homolog 97.72
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 97.71
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.7
PTZ00367 567 squalene epoxidase; Provisional 97.7
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.68
PRK12837 513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.68
TIGR02462 544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.68
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.65
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.64
PLN02612567 phytoene desaturase 97.62
PRK09853 1019 putative selenate reductase subunit YgfK; Provisio 97.61
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 97.6
PLN02661357 Putative thiazole synthesis 97.6
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 97.59
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.59
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.57
PRK12844 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.56
PRK07843 557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.56
PLN02976 1713 amine oxidase 97.55
PLN03000 881 amine oxidase 97.54
PLN02463 447 lycopene beta cyclase 97.52
PLN02852 491 ferredoxin-NADP+ reductase 97.52
PRK12845 564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.52
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.52
PRK06847 375 hypothetical protein; Provisional 97.51
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.46
PRK12839 572 hypothetical protein; Provisional 97.44
KOG2853509 consensus Possible oxidoreductase [General functio 97.42
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 97.41
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.4
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 97.39
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 97.38
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.37
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.37
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 97.37
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.35
PRK06134 581 putative FAD-binding dehydrogenase; Reviewed 97.34
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.34
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. 97.32
PRK06834 488 hypothetical protein; Provisional 97.32
KOG2495491 consensus NADH-dehydrogenase (ubiquinone) [Energy 97.31
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 97.3
PRK12814652 putative NADPH-dependent glutamate synthase small 97.29
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.28
PF01134 392 GIDA: Glucose inhibited division protein A; InterP 97.28
PRK09077 536 L-aspartate oxidase; Provisional 97.27
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 97.26
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 97.25
PRK12843 578 putative FAD-binding dehydrogenase; Reviewed 97.24
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 97.23
TIGR01789 370 lycopene_cycl lycopene cyclase. This model represe 97.22
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.2
PRK08773 392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.19
PLN02172461 flavin-containing monooxygenase FMO GS-OX 97.17
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.11
PRK07236 386 hypothetical protein; Provisional 97.11
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 97.1
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 97.09
PRK02106 560 choline dehydrogenase; Validated 97.06
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 97.01
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.01
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 97.0
PRK06567 1028 putative bifunctional glutamate synthase subunit b 97.0
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.0
PRK09126 392 hypothetical protein; Provisional 96.99
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.99
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 96.96
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 96.95
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 96.95
PRK13984604 putative oxidoreductase; Provisional 96.92
PRK05714 405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.91
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.91
TIGR00275 400 flavoprotein, HI0933 family. The model when search 96.89
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 96.89
PRK09897 534 hypothetical protein; Provisional 96.87
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 96.84
PRK05192 618 tRNA uridine 5-carboxymethylaminomethyl modificati 96.83
TIGR01790 388 carotene-cycl lycopene cyclase family protein. Thi 96.81
PRK08163 396 salicylate hydroxylase; Provisional 96.81
PF01266 358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 96.79
PRK08850 405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.79
PTZ00188 506 adrenodoxin reductase; Provisional 96.78
PRK07608 388 ubiquinone biosynthesis hydroxylase family protein 96.76
PRK05868 372 hypothetical protein; Validated 96.76
PRK06753 373 hypothetical protein; Provisional 96.76
TIGR01810 532 betA choline dehydrogenase. This enzyme is a membe 96.72
PRK07333 403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 96.71
PRK06184 502 hypothetical protein; Provisional 96.69
PF05834 374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 96.67
PRK10157 428 putative oxidoreductase FixC; Provisional 96.62
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 96.61
KOG1399 448 consensus Flavin-containing monooxygenase [Seconda 96.6
COG0493 457 GltD NADPH-dependent glutamate synthase beta chain 96.6
PRK08401 466 L-aspartate oxidase; Provisional 96.58
PRK08849 384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.57
KOG0399 2142 consensus Glutamate synthase [Amino acid transport 96.55
PRK11728 393 hydroxyglutarate oxidase; Provisional 96.5
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.5
PLN02785 587 Protein HOTHEAD 96.49
TIGR01988 385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 96.47
PRK07190 487 hypothetical protein; Provisional 96.45
PLN02697 529 lycopene epsilon cyclase 96.44
PRK08244 493 hypothetical protein; Provisional 96.43
PRK07588 391 hypothetical protein; Provisional 96.43
PRK08020 391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 96.43
TIGR01984 382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 96.41
KOG4254 561 consensus Phytoene desaturase [Coenzyme transport 96.35
COG2303 542 BetA Choline dehydrogenase and related flavoprotei 96.35
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 96.29
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 96.22
PRK06617 374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.22
PRK05562223 precorrin-2 dehydrogenase; Provisional 96.19
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.18
PF12831 428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 96.17
PRK07045 388 putative monooxygenase; Reviewed 96.16
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.16
KOG2755 334 consensus Oxidoreductase [General function predict 96.14
PRK08013 400 oxidoreductase; Provisional 96.14
TIGR00136 617 gidA glucose-inhibited division protein A. GidA, t 96.11
PLN00093 450 geranylgeranyl diphosphate reductase; Provisional 96.04
TIGR03219 414 salicylate_mono salicylate 1-monooxygenase. Member 96.02
PRK10015 429 oxidoreductase; Provisional 96.02
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.0
TIGR02028 398 ChlP geranylgeranyl reductase. This model represen 95.97
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 95.95
KOG3851 446 consensus Sulfide:quinone oxidoreductase/flavo-bin 95.93
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.9
PRK07494 388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 95.87
TIGR02023 388 BchP-ChlP geranylgeranyl reductase. This model rep 95.79
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 95.79
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 95.77
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.68
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy produc 95.68
PRK05732 395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.66
TIGR00551 488 nadB L-aspartate oxidase. L-aspartate oxidase is t 95.64
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 95.62
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.53
KOG2311 679 consensus NAD/FAD-utilizing protein possibly invol 95.52
KOG1238 623 consensus Glucose dehydrogenase/choline dehydrogen 95.51
PRK06996 398 hypothetical protein; Provisional 95.51
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.47
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 95.46
PRK06183 538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 95.44
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.44
PRK08132 547 FAD-dependent oxidoreductase; Provisional 95.42
COG4529 474 Uncharacterized protein conserved in bacteria [Fun 95.35
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 95.33
PRK05335 436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 95.31
PRK11445 351 putative oxidoreductase; Provisional 95.3
PRK06719157 precorrin-2 dehydrogenase; Validated 95.23
PF04820 454 Trp_halogenase: Tryptophan halogenase; InterPro: I 95.21
TIGR01989 437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 95.17
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.17
KOG4716503 consensus Thioredoxin reductase [Posttranslational 95.15
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 95.08
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.07
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 95.06
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.04
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.97
PRK06718202 precorrin-2 dehydrogenase; Reviewed 94.95
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 94.92
TIGR00137 433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 94.89
KOG0405478 consensus Pyridine nucleotide-disulphide oxidoredu 94.87
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 94.87
PRK06175 433 L-aspartate oxidase; Provisional 94.84
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.79
KOG0404 322 consensus Thioredoxin reductase [Posttranslational 94.79
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 94.78
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 94.73
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 94.71
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.7
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 94.68
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 94.62
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.62
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.59
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.57
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 94.56
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 94.46
PRK06719157 precorrin-2 dehydrogenase; Validated 94.4
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 94.18
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisio 94.18
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information 
Probab=100.00  E-value=6.2e-43  Score=338.06  Aligned_cols=355  Identities=29%  Similarity=0.491  Sum_probs=208.4

Q ss_pred             CCcEEECCChHHHHHHHHHHHcCCCEEEEecCCCCCCccCC---------CCCCCeeeecCCccccCCCCCCCCCCCCCC
Q 035488           20 NGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQN---------RTYDRLKLHLPKQFCQLPNFPFPEDFPRVP   90 (408)
Q Consensus        20 ~~vvIIG~G~aGl~~A~~l~~~g~~v~lie~~~~~gg~w~~---------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   90 (408)
                      ++|+|||||++||++|+.|.+.|++++++|+++.+||+|+.         ..|+.+.++.++.++.+++++++++++.|+
T Consensus         2 krVaVIGaG~sGL~a~k~l~e~g~~~~~fE~~~~iGG~W~~~~~~~~g~~~~y~sl~~n~sk~~~~fsdfp~p~~~p~f~   81 (531)
T PF00743_consen    2 KRVAVIGAGPSGLAAAKNLLEEGLEVTCFEKSDDIGGLWRYTENPEDGRSSVYDSLHTNTSKEMMAFSDFPFPEDYPDFP   81 (531)
T ss_dssp             -EEEEE--SHHHHHHHHHHHHTT-EEEEEESSSSSSGGGCHSTTCCCSEGGGSTT-B-SS-GGGSCCTTS-HCCCCSSSE
T ss_pred             CEEEEECccHHHHHHHHHHHHCCCCCeEEecCCCCCccCeeCCcCCCCccccccceEEeeCchHhcCCCcCCCCCCCCCC
Confidence            57999999999999999999999999999999999999974         358889999999999999999999988876


Q ss_pred             C-------------ccCc--cccccceeEEEEEcCC---CCcEEEEEeecCCCCcceEEEEeCEEEEeeCCCCCCCCCC-
Q 035488           91 H-------------QFDI--NPRFNETVQSAKYDET---FGFWRIKTISSSDSSFCEVEYICRWLVVATGENAEKIEPE-  151 (408)
Q Consensus        91 ~-------------~~~~--~~~~~~~V~~i~~~~~---~~~~~V~~~~~~~~~~~~~~i~ad~vViAtG~~~~~~~p~-  151 (408)
                      .             ++++  .++++++|+++++..+   .+.|+|++.++ +..   .+..+|+||+|||.++.|.+|. 
T Consensus        82 ~~~~v~~Yl~~Ya~~f~L~~~I~fnt~V~~v~~~~d~~~~~~W~V~~~~~-g~~---~~~~fD~VvvatG~~~~P~~P~~  157 (531)
T PF00743_consen   82 SHSEVLEYLESYAEHFGLRKHIRFNTEVVSVERDPDFSATGKWEVTTEND-GKE---ETEEFDAVVVATGHFSKPNIPEP  157 (531)
T ss_dssp             BHHHHHHHHHHHHHHTTGGGGEETSEEEEEEEEETTTT-ETEEEEEETTT-TEE---EEEEECEEEEEE-SSSCESB---
T ss_pred             CHHHHHHHHHHHHhhhCCcceEEEccEEeEeeeccccCCCceEEEEeecC-CeE---EEEEeCeEEEcCCCcCCCCCChh
Confidence            6             6666  4689999999998653   25799987643 222   4668999999999999999995 


Q ss_pred             -CCCCCCcceeeeeccCCCCCCCCCCCeEEEEccCCcHHHHHHHHhccCCccEEEEecCceeeccccc-CCchHHH-HHH
Q 035488          152 -FEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVL-GKSTFQL-AVL  228 (408)
Q Consensus       152 -~~g~~~~~~~~~~~~~~~~~~~~~~~~v~VvG~G~~a~e~a~~l~~~g~~V~~~~r~~~~~~p~~~~-~~~~~~~-~~~  228 (408)
                       +||++.|.|.++|+.+|.+...+.+|+|+|||+|.||+|+|.+|+...++|++.+|++.|++|+... |.+.... ...
T Consensus       158 ~~~G~e~F~G~i~HS~~yr~~~~f~gKrVlVVG~g~Sg~DIa~el~~~a~~v~~s~R~~~wv~pr~~~~G~P~D~~~~~R  237 (531)
T PF00743_consen  158 SFPGLEKFKGEIIHSKDYRDPEPFKGKRVLVVGGGNSGADIAVELSRVAKKVYLSTRRGAWVLPRYWDNGYPFDMVFSTR  237 (531)
T ss_dssp             --CTGGGHCSEEEEGGG--TGGGGTTSEEEEESSSHHHHHHHHHHTTTSCCEEEECC-----------------------
T ss_pred             hhhhhhcCCeeEEccccCcChhhcCCCEEEEEeCCHhHHHHHHHHHHhcCCeEEEEeccccccccccccccccccccccc
Confidence             9999999999999999999999999999999999999999999999999999999999999998753 3322211 111


Q ss_pred             HHhhcchHHHHHHHHHHH-HHHhh--hhhhcCCCCCCCCCcccccCCCCCcccChhhhhhhccCCeEEecCccEEeCCeE
Q 035488          229 MMKYFPLWLVDKILLILA-RLILG--NVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIRSGDIKVVPGIKKFSPGKV  305 (408)
Q Consensus       229 ~~~~l~~~~~~~~~~~~~-~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~i~~~~~~~v  305 (408)
                      ...++.......+.+.+. +.+..  +...++.       ........+.|..++.+...+..+.|+++.+|.++++++|
T Consensus       238 ~~~~l~~~lp~~~~~~~~~~~l~~~~~~~~~gl-------~p~~~~~~~~~~ind~l~~~i~~G~i~vk~~I~~~~~~~v  310 (531)
T PF00743_consen  238 FSSFLQKNLPESLSNWLLEKKLNKRFDHENYGL-------KPKHRFFSQHPTINDELPNRIRSGRIKVKPDIKRFTENSV  310 (531)
T ss_dssp             --------------------------------------------------------------------EE-EEEE-SSEE
T ss_pred             ccccccccccccccccccccccccccccccccc-------cccccccccccccccccccccccccccccccccccccccc
Confidence            111111111111111111 01100  1112222       1112233456788999999999999999888999999999


Q ss_pred             EEecCcEE-ccCEEEEcCCCCCCCCCcccccccccCCCCCCCCCCCCC-C--CCCceEEEeecccc---CccchhhHHHH
Q 035488          306 ELVNGQVL-EIDSVVLATGYRSNVPSWLKENEFFSENGIPKNPFPNGW-K--GKTGLYAVGFTKRG---LSGASLDAMSV  378 (408)
Q Consensus       306 ~~~~g~~~-~~D~vi~atG~~~~~~~l~~~~~~~~~~g~~~~~~~~~~-t--~~~~iya~Gd~~~~---~~~a~~~a~~~  378 (408)
                      .+.||+.+ ++|.||+||||+.+. .|+++..+...++.+.. +...+ +  ..|++.++|.+...   +..+..||+++
T Consensus       311 ~F~DGs~~e~vD~II~~TGY~~~f-pFL~~~~~~~~~~~~~L-Yk~vfp~~~~~ptLafIG~~~~~g~~fp~~ElQArw~  388 (531)
T PF00743_consen  311 IFEDGSTEEDVDVIIFCTGYKFSF-PFLDESLIKVDDNRVRL-YKHVFPPNLDHPTLAFIGLVQPFGSIFPIFELQARWA  388 (531)
T ss_dssp             EETTSEEEEE-SEEEE---EE----TTB-TTTT-S-SSSSSE-ETTTEETETTSTTEEESS-SBSSS-HHHHHHHHHHHH
T ss_pred             cccccccccccccccccccccccc-ccccccccccccccccc-ccccccccccccccccccccccccccccccccccccc
Confidence            99999875 699999999999998 56665533222332221 12233 2  45899999987532   23688999999


Q ss_pred             HHHHHHHhh
Q 035488          379 ALDIAKSWK  387 (408)
Q Consensus       379 a~~i~~~~~  387 (408)
                      |..+.+...
T Consensus       389 a~v~sG~~~  397 (531)
T PF00743_consen  389 ARVFSGRVK  397 (531)
T ss_dssp             HHHHTTSS-
T ss_pred             ccccccccc
Confidence            999888764

Using an NADPH cofactor and FAD prosthetic group, these microsomal proteins catalyse the oxygenation of nucleophilic nitrogen, sulphur, phosphorous and selenium atoms in a range of structurally diverse compounds. FMOs have been implicated in the metabolism of a number of pharmaceuticals, pesticides and toxicants. In man, lack of hepatic FMO-catalysed trimethylamine metabolism results in trimethylaminuria (fish odour syndrome). Five mammalian forms of FMO are now known and have been designated FMO1-FMO5 [, , , , ]. This is a recent nomenclature based on comparison of amino acid sequences, and has been introduced in an attempt to eliminate confusion inherent in multiple, laboratory-specific designations and tissue-based classifications []. Following the determination of the complete nucleotide sequence of Saccharomyces cerevisiae (Baker's yeast) [], a novel gene was found to encode a protein with similarity to mammalian monooygenases.; GO: 0004499 flavin-containing monooxygenase activity, 0050660 flavin adenine dinucleotide binding, 0050661 NADP binding, 0055114 oxidation-reduction process; PDB: 2GVC_E 1VQW_B 2GV8_B 2XVI_B 2XVH_B 2XLS_A 2XLR_A 2XLU_D 2XLP_B 2XVE_A ....
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG2755 consensus Oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
4a9w_A357 Flavin-Containing Monooxygenase From Stenotrophomon 4e-18
4ap3_A 549 Oxidized Steroid Monooxygenase Bound To Nadp Length 1e-11
4aos_A 549 Oxidized Steroid Monooxygenase Bound To Nadp Length 1e-11
4ap1_A 549 Oxidized Steroid Monooxygenase Bound To Nadp Length 2e-11
2ylz_A 542 Snapshots Of Enzymatic Baeyer-Villiger Catalysis: O 2e-11
1w4x_A 542 Phenylacetone Monooxygenase, A Baeyer-villiger Mono 2e-11
2ylw_A 542 Snapshots Of Enzymatic Baeyer-Villiger Catalysis: O 3e-11
2ylx_A 542 Snapshots Of Enzymatic Baeyer-Villiger Catalysis: O 3e-11
3uov_A 545 Crystal Structure Of Otemo (Fad Bound Form 1) Lengt 4e-08
3ucl_A 573 Cyclohexanone-Bound Crystal Structure Of Cyclohexan 1e-07
3gwd_A 540 Closed Crystal Structure Of Cyclohexanone Monooxyge 1e-07
2xvi_A464 Crystal Structure Of The Mutant Bacterial Flavin Co 3e-07
2xve_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 5e-07
2vq7_A461 Bacterial Flavin-Containing Monooxygenase In Comple 1e-06
2xvf_A464 Crystal Structure Of Bacterial Flavin-Containing Mo 2e-06
2xls_A461 Joint-Functions Of Protein Residues And Nadp(H) In 2e-06
2xlr_A461 Joint-Functions Of Protein Residues And Nadp(H) In 2e-06
2xlp_A461 Joint-Functions Of Protein Residues And Nadp(H) In 2e-06
1trb_A320 Convergent Evolution Of Similar Function In Two Str 2e-04
1tdf_A316 Crystal Structure Of Escherichia Coli Thioredoxin R 2e-04
1f6m_A320 Crystal Structure Of A Complex Between Thioredoxin 3e-04
1tde_A316 Crystal Structure Of Escherichia Coli Thioredoxin R 5e-04
1cl0_A320 Crystal Structure Of Reduced Thioredoxin Reductase 5e-04
3ab1_A360 Crystal Structure Of Ferredoxin Nadp+ Oxidoreductas 6e-04
2zbw_A335 Crystal Structure Of Thioredoxin Reductase-Like Pro 8e-04
>pdb|4A9W|A Chain A, Flavin-Containing Monooxygenase From Stenotrophomonas Maltophilia Length = 357 Back     alignment and structure 
Iteration: 1

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 133/313 (42%), Gaps = 45/313 (14%)
Query: 23  VIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPF 82
           V++G G SGL+    L+  G+ ++IL+        WQ+  +  L L  P  +  +P +P 
Sbjct: 7   VVIGGGQSGLSAGYFLRRSGLSYVILDAEASPGGAWQH-AWHSLHLFSPAGWSSIPGWPM 65
Query: 83  PEDFPRVPHQFDINPRFNETVQSAKYDETFGFWRIKTISSSD-SSFCEV---------EY 132
           P      P + ++          A+Y++ +    ++ I     S F E          ++
Sbjct: 66  PASQGPYPARAEVLAYL------AQYEQKYALPVLRPIRVQRVSHFGERLRVVARDGRQW 119
Query: 133 ICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNSGMEVS 192
           + R ++ ATG   E   PE++GL+ F G  +H+  Y + A + G RV ++G GNSG ++ 
Sbjct: 120 LARAVISATGTWGEAYTPEYQGLESFAGIQLHSAHYSTPAPFAGMRVAIIGGGNSGAQI- 178
Query: 193 LDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILLILARLILGN 252
           L   +  A+ + + +     L  +V G+  F+ A    K                     
Sbjct: 179 LAEVSTVAETTWITQHEPAFLADDVDGRVLFERATERWK--------------------- 217
Query: 253 VEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIRSGDIKVVPGIKKFSPGKVELVNGQV 312
            ++ G + P   P    +     PVLD  A      G +  VP   +FSP  ++  +G  
Sbjct: 218 AQQEG-REPDLPPGGFGDIVMVPPVLDARA-----RGVLAAVPPPARFSPTGMQWADGTE 271
Query: 313 LEIDSVVLATGYR 325
              D+V+  TG+R
Sbjct: 272 RAFDAVIWCTGFR 284
>pdb|4AP3|A Chain A, Oxidized Steroid Monooxygenase Bound To Nadp Length = 549 Back     alignment and structure
>pdb|4AOS|A Chain A, Oxidized Steroid Monooxygenase Bound To Nadp Length = 549 Back     alignment and structure
>pdb|4AP1|A Chain A, Oxidized Steroid Monooxygenase Bound To Nadp Length = 549 Back     alignment and structure
>pdb|2YLZ|A Chain A, Snapshots Of Enzymatic Baeyer-Villiger Catalysis: Oxygen Activation And Intermediate Stabilization: Met446gly Mutant Length = 542 Back     alignment and structure
>pdb|1W4X|A Chain A, Phenylacetone Monooxygenase, A Baeyer-villiger Monooxygenase Length = 542 Back     alignment and structure
>pdb|2YLW|A Chain A, Snapshots Of Enzymatic Baeyer-Villiger Catalysis: Oxygen Activation And Intermediate Stabilization: Arg337lys Mutant In Complex With Mes Length = 542 Back     alignment and structure
>pdb|2YLX|A Chain A, Snapshots Of Enzymatic Baeyer-Villiger Catalysis: Oxygen Activation And Intermediate Stabilization: Asp66ala Mutant In Complex With Nadp And Mes Length = 542 Back     alignment and structure
>pdb|3UOV|A Chain A, Crystal Structure Of Otemo (Fad Bound Form 1) Length = 545 Back     alignment and structure
>pdb|3UCL|A Chain A, Cyclohexanone-Bound Crystal Structure Of Cyclohexanone Monooxygenase In The Rotated Conformation Length = 573 Back     alignment and structure
>pdb|3GWD|A Chain A, Closed Crystal Structure Of Cyclohexanone Monooxygenase Length = 540 Back     alignment and structure
>pdb|2XVI|A Chain A, Crystal Structure Of The Mutant Bacterial Flavin Containing Monooxygenase (Y207s) Length = 464 Back     alignment and structure
>pdb|2XVE|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure
>pdb|2VQ7|A Chain A, Bacterial Flavin-Containing Monooxygenase In Complex With Nadp: Native Data Length = 461 Back     alignment and structure
>pdb|2XVF|A Chain A, Crystal Structure Of Bacterial Flavin-Containing Monooxygenase Length = 464 Back     alignment and structure
>pdb|2XLS|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78lys Mutant Length = 461 Back     alignment and structure
>pdb|2XLR|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen-Activation By Flavin-Containing Monooxygenase: Asn78asp Mutant Length = 461 Back     alignment and structure
>pdb|2XLP|A Chain A, Joint-Functions Of Protein Residues And Nadp(H) In Oxygen- Activation By Flavin-Containing Monooxygenase: Asn78ser Mutant Length = 461 Back     alignment and structure
>pdb|1TRB|A Chain A, Convergent Evolution Of Similar Function In Two Structurally Divergent Enzymes Length = 320 Back     alignment and structure
>pdb|1TDF|A Chain A, Crystal Structure Of Escherichia Coli Thioredoxin Reductase Refined At 2 Angstrom Resolution: Implications For A Large Conformational Change During Catalysis Length = 316 Back     alignment and structure
>pdb|1F6M|A Chain A, Crystal Structure Of A Complex Between Thioredoxin Reductase, Thioredoxin, And The Nadp+ Analog, Aadp+ Length = 320 Back     alignment and structure
>pdb|1TDE|A Chain A, Crystal Structure Of Escherichia Coli Thioredoxin Reductase Refined At 2 Angstrom Resolution: Implications For A Large Conformational Change During Catalysis Length = 316 Back     alignment and structure
>pdb|1CL0|A Chain A, Crystal Structure Of Reduced Thioredoxin Reductase From Escherichia Coli Length = 320 Back     alignment and structure
>pdb|3AB1|A Chain A, Crystal Structure Of Ferredoxin Nadp+ Oxidoreductase Length = 360 Back     alignment and structure
>pdb|2ZBW|A Chain A, Crystal Structure Of Thioredoxin Reductase-Like Protein From Thermus Thermophilus Hb8 Length = 335 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 1e-118
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 8e-42
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 7e-40
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 1e-28
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 2e-26
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 1e-21
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 6e-21
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 5e-20
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 6e-19
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 1e-15
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 5e-10
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 1e-09
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 1e-08
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 2e-08
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 6e-07
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 7e-07
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 9e-07
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 2e-06
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 2e-06
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 2e-06
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 3e-06
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 4e-06
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 5e-06
2ywl_A180 Thioredoxin reductase related protein; uncharacter 9e-06
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 2e-05
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 2e-05
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 2e-05
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 2e-05
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 2e-05
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 2e-05
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 3e-05
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 4e-05
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 6e-05
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 7e-05
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 7e-05
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 7e-05
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 1e-04
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 1e-04
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 1e-04
3r9u_A315 Thioredoxin reductase; structural genomics, center 2e-04
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 2e-04
4fk1_A304 Putative thioredoxin reductase; structural genomic 2e-04
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 2e-04
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 2e-04
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 3e-04
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 3e-04
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 3e-04
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 4e-04
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 4e-04
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 5e-04
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 5e-04
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 5e-04
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 6e-04
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 7e-04
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 7e-04
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 7e-04
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 8e-04
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 Back     alignment and structure
 Score =  347 bits (893), Expect = e-118
 Identities = 79/391 (20%), Positives = 143/391 (36%), Gaps = 61/391 (15%)

Query: 23  VIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPF 82
           V++G G SGL+    L+  G+ ++IL+        WQ+  +  L L  P  +  +P +P 
Sbjct: 7   VVIGGGQSGLSAGYFLRRSGLSYVILDAEASPGGAWQHA-WHSLHLFSPAGWSSIPGWPM 65

Query: 83  PEDFPRVPHQ-------------FDINPRFNETVQSAKYDETFGFWRIKTISSSDSSFCE 129
           P      P +             + +       VQ   +       R+            
Sbjct: 66  PASQGPYPARAEVLAYLAQYEQKYALPVLRPIRVQRVSHFG--ERLRVVARDGR------ 117

Query: 130 VEYICRWLVVATGENAEKIEPEFEGLQHFEGNVMHAGDYKSGASYRGKRVLVVGCGNSGM 189
            +++ R ++ ATG   E   PE++GL+ F G  +H+  Y + A + G RV ++G GNSG 
Sbjct: 118 -QWLARAVISATGTWGEAYTPEYQGLESFAGIQLHSAHYSTPAPFAGMRVAIIGGGNSGA 176

Query: 190 EVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILLILARLI 249
           ++  ++    A+ + + +     L  +V G+  F+ A    K                  
Sbjct: 177 QILAEVSTV-AETTWITQHEPAFLADDVDGRVLFERATERWK------------------ 217

Query: 250 LGNVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIRSGDIKVVPGIKKFSPGKVELVN 309
                +   + P   P    +     PVLD         G +  VP   +FSP  ++  +
Sbjct: 218 ----AQQEGREPDLPPGGFGDIVMVPPVLDA-----RARGVLAAVPPPARFSPTGMQWAD 268

Query: 310 GQVLEIDSVVLATGYRSNVPSWLKENEFFSENG--------IPKNPFPNGWKGKTGLYAV 361
           G     D+V+  TG+R  +   LK  +  +  G        +     P+ W    G +  
Sbjct: 269 GTERAFDAVIWCTGFRPALS-HLKGLDLVTPQGQVEVDGSGLRALAVPSVWLLGYGDWN- 326

Query: 362 GFTKRGLSGASLDAMSVALDIAKSWKEETKQ 392
           G     L G +  A      +     +   +
Sbjct: 327 GMASATLIGVTRYAREAVRQVTAYCADHQDR 357
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Length = 463 Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Length = 335 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Length = 332 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Length = 360 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Length = 180 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Length = 335 Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Length = 310 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Length = 333 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Length = 325 Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Length = 311 Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Length = 320 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Length = 338 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Length = 315 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Length = 323 Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Length = 456 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Length = 472 Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 100.0
2xve_A 464 Flavin-containing monooxygenase; oxidoreductase; H 100.0
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 100.0
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 100.0
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 100.0
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 100.0
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 100.0
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 100.0
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 100.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 100.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 100.0
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 100.0
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 100.0
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 100.0
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 100.0
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 100.0
4eqs_A 437 Coenzyme A disulfide reductase; oxidoreductase; HE 100.0
3r9u_A315 Thioredoxin reductase; structural genomics, center 100.0
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 100.0
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 100.0
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 100.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 100.0
4fk1_A304 Putative thioredoxin reductase; structural genomic 100.0
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 100.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 100.0
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 100.0
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 100.0
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 100.0
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 100.0
3oc4_A 452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 100.0
3iwa_A 472 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 100.0
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 100.0
2bc0_A 490 NADH oxidase; flavoprotein, pyridine nucleotide di 100.0
3ntd_A 565 FAD-dependent pyridine nucleotide-disulphide oxido 100.0
3kd9_A 449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 100.0
3ics_A 588 Coenzyme A-disulfide reductase; pyridine nucleotid 100.0
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 100.0
3urh_A 491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 100.0
3l8k_A 466 Dihydrolipoyl dehydrogenase; redox-active center, 100.0
1mo9_A 523 ORF3; nucleotide binding motifs, nucleotide bindin 99.98
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 99.98
1zmd_A 474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 99.98
2wpf_A 495 Trypanothione reductase; oxidoreductase, trypanoso 99.98
2cdu_A 452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 99.98
2hqm_A 479 GR, grase, glutathione reductase; glutathione redu 99.97
2a8x_A 464 Dihydrolipoyl dehydrogenase, E3 component of alpha 99.97
1onf_A 500 GR, grase, glutathione reductase; oxidoreductase; 99.97
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.97
1ojt_A 482 Surface protein; redox-active center, glycolysis, 99.97
1xdi_A 499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.97
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 99.97
2eq6_A 464 Pyruvate dehydrogenase complex, dihydrolipoamide d 99.97
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 99.97
1v59_A 478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 99.97
1dxl_A 470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 99.97
3lad_A 476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.97
3cgb_A 480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 99.97
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 99.97
1fec_A 490 Trypanothione reductase; redox-active center, oxid 99.97
2r9z_A 463 Glutathione amide reductase; NAD, FAD, substrate s 99.97
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 99.97
1nhp_A 447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 99.97
1zk7_A 467 HGII, reductase, mercuric reductase; mercuric ION 99.97
2qae_A 468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 99.97
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 99.97
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 99.97
4dna_A 463 Probable glutathione reductase; structural genomic 99.97
3ic9_A 492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.97
3o0h_A 484 Glutathione reductase; ssgcid, structur genomics, 99.97
2yqu_A 455 2-oxoglutarate dehydrogenase E3 component; lipoami 99.97
1lvl_A 458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.97
3qfa_A 519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.97
3dgz_A 488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.97
4b1b_A 542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.97
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.97
3dgh_A 483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.96
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 99.96
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 99.96
1m6i_A 493 Programmed cell death protein 8; apoptosis, AIF, o 99.96
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 99.96
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 99.96
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 99.96
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.95
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.95
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 99.95
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 99.95
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.94
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 99.94
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 99.93
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.92
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 99.91
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 99.7
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.68
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.42
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.4
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.23
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.19
2cul_A232 Glucose-inhibited division protein A-related PROT 99.17
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 99.14
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.14
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.13
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.11
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.09
2cul_A232 Glucose-inhibited division protein A-related PROT 99.09
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.02
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.02
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.01
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.0
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.99
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.98
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 98.97
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.97
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.96
2bry_A497 NEDD9 interacting protein with calponin homology a 98.96
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.96
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.95
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.93
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.93
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 98.91
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.91
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 98.91
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.89
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 98.87
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.86
3dme_A369 Conserved exported protein; structural genomics, P 98.86
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.85
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.85
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.85
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.85
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.85
3da1_A 561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.83
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.82
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 98.81
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.81
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.81
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 98.8
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.8
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.8
3atr_A453 Conserved archaeal protein; saturating double bond 98.8
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.8
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 98.78
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.71
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.71
2dkh_A 639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.69
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.68
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.68
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.67
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.66
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.64
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.55
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.52
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 98.48
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.47
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.47
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.47
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.46
2rgh_A 571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.46
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.45
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 98.45
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.42
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 98.41
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.39
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.37
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.36
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.36
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.34
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.34
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 98.33
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.33
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.32
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.32
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.32
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.31
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.29
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.28
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.28
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.27
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.26
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.25
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.25
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.25
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 98.25
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.23
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 98.22
3hyw_A 430 Sulfide-quinone reductase; monotopic membrane prot 98.22
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.21
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.21
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 98.21
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.2
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.19
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.19
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.19
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.19
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.19
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 98.19
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 98.19
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.18
3klj_A 385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.17
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 98.17
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.17
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.17
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 98.17
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 98.17
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.16
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.16
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 98.14
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.14
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.13
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.12
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.12
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 98.11
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.11
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.11
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.11
3h8l_A 409 NADH oxidase; membrane protein, complete form, ros 98.11
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.1
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.1
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.1
3vrd_B 401 FCCB subunit, flavocytochrome C flavin subunit; su 98.09
3sx6_A 437 Sulfide-quinone reductase, putative; sulfide:quino 98.09
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 98.09
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.07
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.07
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.06
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.06
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.06
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.05
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.05
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.04
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.04
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.03
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 98.02
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 98.01
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.99
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.98
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.98
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.98
3h28_A 430 Sulfide-quinone reductase; monotopic membrane prot 97.98
4dna_A463 Probable glutathione reductase; structural genomic 97.97
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.97
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 97.96
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.95
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.95
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.95
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.94
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.93
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.93
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.92
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.92
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.91
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.91
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.9
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.89
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 97.87
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.87
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 97.86
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.86
3t37_A 526 Probable dehydrogenase; BET alpha beta fold, ADP b 97.86
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.85
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.84
2pyx_A 526 Tryptophan halogenase; structural genomics, JOI fo 97.84
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.84
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.84
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.83
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.82
4g6h_A 502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.79
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.79
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 97.78
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.77
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.76
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 97.75
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 97.74
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 97.74
4a9w_A 357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 97.73
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 97.73
3pl8_A 623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.71
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.7
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.7
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.68
2bry_A 497 NEDD9 interacting protein with calponin homology a 97.65
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 97.64
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.63
2gqf_A 401 Hypothetical protein HI0933; structural genomics, 97.57
3nlc_A 549 Uncharacterized protein VP0956; FAD-binding protei 97.56
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 97.53
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.53
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 97.53
3alj_A 379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.52
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.42
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.39
2i0z_A 447 NAD(FAD)-utilizing dehydrogenases; structural geno 97.38
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 97.38
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.3
1kdg_A 546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.26
3uox_A 545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.26
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 97.22
4ap3_A 549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.2
3gwf_A 540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.19
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 97.16
2x3n_A 399 Probable FAD-dependent monooxygenase; oxidoreducta 97.15
1ju2_A 536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.15
2vou_A 397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.14
3q9t_A 577 Choline dehydrogenase and related flavoproteins; g 97.12
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 97.09
1n4w_A 504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 97.01
1lqt_A 456 FPRA; NADP+ derivative, oxidoreductase, structural 96.97
1y56_B 382 Sarcosine oxidase; dehydrogenase, protein-protein 96.97
3qvp_A 583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.97
1cjc_A 460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.94
3ces_A 651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 96.93
1y0p_A 571 Fumarate reductase flavoprotein subunit; flavocyto 96.92
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.89
3nix_A 421 Flavoprotein/dehydrogenase; structural genomics, P 96.88
1k0i_A 394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 96.82
1coy_A 507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.82
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 96.81
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 96.8
1qo8_A 566 Flavocytochrome C3 fumarate reductase; oxidoreduct 96.76
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 96.76
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 96.76
1gpe_A 587 Protein (glucose oxidase); oxidoreductase(flavopro 96.75
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 96.75
3fim_B 566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.75
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 96.72
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.66
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.6
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 96.59
2jbv_A 546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.58
3e1t_A 512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 96.57
4at0_A 510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 96.56
3cp8_A 641 TRNA uridine 5-carboxymethylaminomethyl modificati 96.56
2gag_B 405 Heterotetrameric sarcosine oxidase beta-subunit; f 96.55
4hb9_A 412 Similarities with probable monooxygenase; flavin, 96.53
2qa2_A 499 CABE, polyketide oxygenase CABE; FAD, angucycline, 96.53
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 96.51
3atr_A 453 Conserved archaeal protein; saturating double bond 96.49
1w4x_A 542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 96.49
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.46
1d4d_A 572 Flavocytochrome C fumarate reductase; oxidoreducta 96.45
3ihg_A 535 RDME; flavoenzyme, anthracycline, polyketide biosy 96.45
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.42
3cgv_A 397 Geranylgeranyl reductase related protein; NP_39399 96.36
2qa1_A 500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 96.3
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.28
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 96.21
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 96.19
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 96.18
2e5v_A 472 L-aspartate oxidase; archaea, oxidoreductase; HET: 96.04
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.97
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.93
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 95.92
1chu_A 540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 95.87
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.84
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 95.64
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 95.62
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 95.48
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 95.4
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 95.38
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.36
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.34
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 95.33
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.32
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 95.31
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 95.04
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 94.8
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 94.8
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 94.74
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 94.72
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 94.65
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 94.64
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 94.64
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 94.58
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 94.53
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 94.43
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 94.35
3oz2_A 397 Digeranylgeranylglycerophospholipid reductase; str 94.26
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 94.23
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 94.23
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 94.17
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 94.12
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 94.07
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 94.06
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 94.03
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 93.99
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.98
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 93.96
1id1_A153 Putative potassium channel protein; RCK domain, E. 93.82
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 93.82
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 93.76
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 93.64
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 93.63
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 93.59
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 93.58
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 93.57
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 93.56
3g5s_A 443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 93.55
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 93.52
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 93.5
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 93.49
2oln_A 397 NIKD protein; flavoprotein, rossmann fold, oxidore 93.47
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 93.4
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 93.39
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 93.31
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 93.31
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 93.28
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 93.23
3dme_A 369 Conserved exported protein; structural genomics, P 93.19
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 93.17
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 93.14
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 93.14
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 93.12
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 93.12
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 93.11
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 93.11
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 93.05
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 93.03
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 92.99
2gf3_A 389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 92.99
2uzz_A 372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 92.97
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 92.95
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 92.93
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 92.89
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 92.89
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 92.88
1c0p_A 363 D-amino acid oxidase; alpha-beta-alpha motif, flav 92.87
3qha_A296 Putative oxidoreductase; seattle structural genomi 92.87
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 92.81
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 92.72
3l6d_A306 Putative oxidoreductase; structural genomics, prot 92.7
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.68
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 92.68
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 92.54
3c4a_A 381 Probable tryptophan hydroxylase VIOD; alpha-beta p 92.51
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 92.51
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 92.48
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 92.48
3c96_A 410 Flavin-containing monooxygenase; FAD, oxidoreducta 92.47
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 92.39
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 92.37
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 92.35
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 92.3
3nyc_A 381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 92.28
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 92.25
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 92.24
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 92.24
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 92.21
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 92.19
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 92.18
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 92.18
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 92.15
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 92.14
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 92.13
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 92.11
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 92.1
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 92.04
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 92.04
3dje_A 438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 92.03
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 92.03
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 92.01
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 92.0
3g3e_A 351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 91.98
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 91.98
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 91.91
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 91.91
1lss_A140 TRK system potassium uptake protein TRKA homolog; 91.91
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 91.88
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 91.87
3ius_A286 Uncharacterized conserved protein; APC63810, silic 91.86
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 91.85
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 91.74
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 91.74
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 91.72
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 91.71
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 91.71
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 91.7
3slg_A372 PBGP3 protein; structural genomics, seattle struct 91.69
4g65_A461 TRK system potassium uptake protein TRKA; structur 91.69
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 91.68
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 91.66
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 91.61
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 91.57
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 91.5
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 91.49
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 91.48
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 91.42
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 91.42
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 91.4
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 91.32
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 91.27
3c4n_A 405 Uncharacterized protein DR_0571; alpha-beta protei 91.26
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 91.23
2qcu_A 501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 91.21
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 91.2
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 91.18
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 91.17
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 91.14
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 91.11
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 91.1
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
Probab=100.00  E-value=1.3e-40  Score=312.10  Aligned_cols=331  Identities=21%  Similarity=0.334  Sum_probs=248.6

Q ss_pred             ccCCcEEECCChHHHHHHHHHHHcCCCEEEEecCCCCCCccCCCCCCCeeeecCCccccCCCCCCCCCCCCCCC------
Q 035488           18 WVNGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPFPEDFPRVPH------   91 (408)
Q Consensus        18 ~~~~vvIIG~G~aGl~~A~~l~~~g~~v~lie~~~~~gg~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------   91 (408)
                      ..+||+|||||++|+++|..|+++|++|+|||+.+.+||.|.. .|+......+.....++.+..+.....+..      
T Consensus         2 ~~~~vvIIG~G~aGl~~A~~l~~~g~~v~vie~~~~~gg~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (357)
T 4a9w_A            2 DSVDVVVIGGGQSGLSAGYFLRRSGLSYVILDAEASPGGAWQH-AWHSLHLFSPAGWSSIPGWPMPASQGPYPARAEVLA   80 (357)
T ss_dssp             EEEEEEEECCSHHHHHHHHHHHHSSCCEEEECCSSSSSGGGGG-SCTTCBCSSCGGGSCCSSSCCCCCSSSSCBHHHHHH
T ss_pred             CcCCEEEECcCHHHHHHHHHHHHCCCCEEEEECCCCCCCcccC-CCCCcEecCchhhhhCCCCCCCCCccCCCCHHHHHH
Confidence            3568999999999999999999999999999999999999975 377777666666666666554433222222      


Q ss_pred             -------ccCccccccceeEEEEEcCCCCcEE-EEEeecCCCCcceEEEEeCEEEEeeCCCCCCCCCCCCCCCCcceeee
Q 035488           92 -------QFDINPRFNETVQSAKYDETFGFWR-IKTISSSDSSFCEVEYICRWLVVATGENAEKIEPEFEGLQHFEGNVM  163 (408)
Q Consensus        92 -------~~~~~~~~~~~V~~i~~~~~~~~~~-V~~~~~~~~~~~~~~i~ad~vViAtG~~~~~~~p~~~g~~~~~~~~~  163 (408)
                             +++++++++++|++++..+  +.|. |++.+        .++.||+||+|||.++.|..|.+||...+.+..+
T Consensus        81 ~l~~~~~~~~~~~~~~~~v~~i~~~~--~~~~~v~~~~--------g~~~~d~vV~AtG~~~~~~~~~~~g~~~~~~~~~  150 (357)
T 4a9w_A           81 YLAQYEQKYALPVLRPIRVQRVSHFG--ERLRVVARDG--------RQWLARAVISATGTWGEAYTPEYQGLESFAGIQL  150 (357)
T ss_dssp             HHHHHHHHTTCCEECSCCEEEEEEET--TEEEEEETTS--------CEEEEEEEEECCCSGGGBCCCCCTTGGGCCSEEE
T ss_pred             HHHHHHHHcCCEEEcCCEEEEEEECC--CcEEEEEeCC--------CEEEeCEEEECCCCCCCCCCCCCCCccccCCcEE
Confidence                   6688889999999999887  6777 76554        4799999999999888888899999888777889


Q ss_pred             eccCCCCCCCCCCCeEEEEccCCcHHHHHHHHhccCCccEEEEecCceeecccccCCchHHHHHHHHhhcchHHHHHHHH
Q 035488          164 HAGDYKSGASYRGKRVLVVGCGNSGMEVSLDLCNHNAKPSMVVRSSVHVLPREVLGKSTFQLAVLMMKYFPLWLVDKILL  243 (408)
Q Consensus       164 ~~~~~~~~~~~~~~~v~VvG~G~~a~e~a~~l~~~g~~V~~~~r~~~~~~p~~~~~~~~~~~~~~~~~~l~~~~~~~~~~  243 (408)
                      +.+.+.+...+.+++|+|||+|.+|+|+|..|++.+ +|++++|++.+++|....+.   .+...+...+        ..
T Consensus       151 ~~~~~~~~~~~~~~~v~VvG~G~~g~e~a~~l~~~~-~v~~v~~~~~~~~~~~~~~~---~~~~~~~~~~--------~~  218 (357)
T 4a9w_A          151 HSAHYSTPAPFAGMRVAIIGGGNSGAQILAEVSTVA-ETTWITQHEPAFLADDVDGR---VLFERATERW--------KA  218 (357)
T ss_dssp             EGGGCCCSGGGTTSEEEEECCSHHHHHHHHHHTTTS-EEEEECSSCCCBCCTTCCTH---HHHTC---------------
T ss_pred             EeccCCChhhcCCCEEEEECCCcCHHHHHHHHHhhC-CEEEEECCCCeecchhhcCc---cHHHHHHHHH--------hc
Confidence            998888887788999999999999999999999998 59999998656766654311   1111111111        00


Q ss_pred             HHHHHHhhhhhhcCCCCCCCCCcccccCCCCCcccChhhhhhhccCCeEEecCccEEeCCeEEEecCcEEccCEEEEcCC
Q 035488          244 ILARLILGNVEKYGLKRPPTGPIELKNNEGKTPVLDIGALQKIRSGDIKVVPGIKKFSPGKVELVNGQVLEIDSVVLATG  323 (408)
Q Consensus       244 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~i~~~~~~~v~~~~g~~~~~D~vi~atG  323 (408)
                      .         ....+       ..........+.+.....+.+..+.+.....+.+++..++.+.+|+++++|.||+|||
T Consensus       219 ~---------~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~g~i~~~~~v~~~~~~~v~~~~g~~i~~D~vi~a~G  282 (357)
T 4a9w_A          219 Q---------QEGRE-------PDLPPGGFGDIVMVPPVLDARARGVLAAVPPPARFSPTGMQWADGTERAFDAVIWCTG  282 (357)
T ss_dssp             -------------------------------CBCCCHHHHHHHHTTCCCEECCCSEEETTEEECTTSCEEECSEEEECCC
T ss_pred             c---------ccccC-------CCcccccccCcccChhHHHHHhcCceEEecCcceEeCCeeEECCCCEecCCEEEECCC
Confidence            0         00000       0000001112334455556666666666666899999999999999999999999999


Q ss_pred             CCCCCCCcccccccccCCCCCCCCCC-CCCCCCCceEEEe--ecccc----CccchhhHHHHHHHHHHHhhH
Q 035488          324 YRSNVPSWLKENEFFSENGIPKNPFP-NGWKGKTGLYAVG--FTKRG----LSGASLDAMSVALDIAKSWKE  388 (408)
Q Consensus       324 ~~~~~~~l~~~~~~~~~~g~~~~~~~-~~~t~~~~iya~G--d~~~~----~~~a~~~a~~~a~~i~~~~~~  388 (408)
                      ++|++ .+++..++.+++|++.+|.. +++|+.|+|||+|  |++..    ...|..+|+.+|.+|.+.+++
T Consensus       283 ~~p~~-~~l~~~gl~~~~G~i~vd~~~l~~t~~~~vya~Gd~d~~~~~~~~~~~A~~~g~~~a~~i~~~l~g  353 (357)
T 4a9w_A          283 FRPAL-SHLKGLDLVTPQGQVEVDGSGLRALAVPSVWLLGYGDWNGMASATLIGVTRYAREAVRQVTAYCAD  353 (357)
T ss_dssp             BCCCC-GGGTTTTCBCTTSCBCBCTTSCBBSSCTTEEECSSCGGGSTTCSSTTTHHHHHHHHHHHHHHHTC-
T ss_pred             cCCCC-cccCcccccCCCCCccccCCcccCCCCCCeEEeccccccccchhhhhhhHHHHHHHHHHHHHHHHh
Confidence            99998 78888888788899999853 3789999999999  55542    237899999999999999987
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 408
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 2e-17
d2gv8a2107 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase 2e-13
d1w4xa2235 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {T 5e-11
d1w4xa2235 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {T 1e-06
d2gv8a1335 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox 6e-11
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 3e-07
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 4e-07
d1xhca1167 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite 6e-07
d1ps9a2162 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-t 1e-06
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 1e-06
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 1e-06
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 2e-06
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 1e-05
d1trba2126 c.3.1.5 (A:119-244) Thioredoxin reductase {Escheri 2e-05
d1djqa3233 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehyd 3e-05
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 3e-05
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 4e-05
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 7e-05
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 7e-05
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 7e-05
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 8e-05
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 1e-04
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 1e-04
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 2e-04
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 2e-04
d1gtea4196 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de 6e-04
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 6e-04
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 6e-04
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 7e-04
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 8e-04
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 8e-04
d1gtea3153 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenas 0.001
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 0.001
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 0.001
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 0.002
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 0.002
d1d7ya1183 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo 0.003
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 0.003
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 0.003
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 0.004
d1q1ra1185 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas 0.004
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Phenylacetone monooxygenase
species: Thermobifida fusca [TaxId: 2021]

 Score = 79.9 bits (196), Expect = 2e-17
 Identities = 31/167 (18%), Positives = 56/167 (33%), Gaps = 27/167 (16%)

Query: 23  VIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFPF 82
           ++VGAG SGL     L+  G    ++E A  +  +W    Y   +  +            
Sbjct: 11  LVVGAGFSGLYALYRLRELGRSVHVIETAGDVGGVWYWNRYPGARCDIESIEYCYSFSEE 70

Query: 83  PEDFP-----------------RVPHQFDI--NPRFNETVQSAKYDETFGFWRIKTISSS 123
                                  V  +FD+     F+ TV +A +DE    W + T    
Sbjct: 71  VLQEWNWTERYASQPEILRYINFVADKFDLRSGITFHTTVTAAAFDEATNTWTVDT---- 126

Query: 124 DSSFCEVEYICRWLVVATGENAEKIEPEFEGLQ-HFEGNVMHAGDYK 169
                      R+L++A+G+ ++ +      +     GNV     + 
Sbjct: 127 ---NHGDRIRARYLIMASGQLSDALTGALFKIDIRGVGNVALKEKWA 170
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 107 Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 235 Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 235 Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 162 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 126 Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Length = 233 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Length = 153 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.76
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.73
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.71
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.69
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 99.68
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.63
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.6
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.58
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.56
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 99.56
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 99.54
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.53
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.52
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.51
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.51
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.48
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 99.48
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.46
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.46
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.45
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.44
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 99.43
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 99.42
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.41
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.41
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.4
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.38
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.37
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.35
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.34
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.34
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.32
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.32
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.3
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.29
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.29
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.28
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 99.28
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.27
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.27
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 99.26
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.25
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 99.24
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.24
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.23
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 99.21
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 99.21
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 99.21
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 99.2
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 99.2
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.19
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.19
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 99.19
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 99.19
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.18
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.18
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.16
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.16
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 99.15
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.15
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.15
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.15
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 99.12
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.11
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 99.11
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.1
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.1
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 99.1
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 99.1
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 99.1
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 99.09
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 99.09
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.09
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.09
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.08
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 99.07
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 99.07
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.06
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 99.05
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 99.03
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.03
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.03
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 99.02
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 99.01
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 99.0
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.99
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.97
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.95
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.94
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.93
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.93
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.92
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.91
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.9
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.9
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.85
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.84
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 98.82
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.8
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.79
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 98.77
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 98.77
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.77
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.76
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.74
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.73
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.71
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.69
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 98.68
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.66
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.66
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.64
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.62
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.61
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 98.6
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.58
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.57
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.57
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 98.56
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.54
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.53
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.53
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 98.53
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.5
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.49
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.47
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 98.46
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.45
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.38
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.37
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 98.35
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.34
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.33
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 98.33
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.31
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.29
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.22
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.14
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 98.13
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.11
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 98.09
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.06
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.05
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 98.0
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 97.92
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.85
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.84
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.82
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 97.77
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.65
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 97.64
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 97.62
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.59
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.51
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.48
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.43
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 97.42
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.42
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.41
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.36
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 97.33
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.28
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.06
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.03
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 96.99
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.78
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 96.75
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 96.75
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 96.74
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.72
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.71
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.69
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 96.67
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.64
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.56
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.51
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.37
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.37
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 96.34
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.26
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.26
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.24
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.21
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.17
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 95.94
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.89
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.83
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 95.79
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 95.73
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 95.67
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 95.66
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 95.66
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.64
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 95.62
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 95.48
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.42
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 95.36
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.32
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 95.26
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.09
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 94.89
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 94.74
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 94.7
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.7
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.69
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 94.68
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 94.61
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 94.58
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 94.57
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 94.54
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 94.47
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 94.46
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 94.45
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 94.44
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.4
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 94.39
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 94.39
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 94.36
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 94.33
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.33
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.32
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.31
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 94.27
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.26
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.23
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.21
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.17
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.09
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 94.05
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.04
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.89
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.74
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 93.58
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.55
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 93.54
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 93.52
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.42
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.37
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 93.02
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 93.01
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 92.95
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 92.84
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 92.79
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.63
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 92.58
d3coxa1 370 Cholesterol oxidase of GMC family {Brevibacterium 92.58
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 92.53
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 92.47
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 92.42
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 92.42
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 92.36
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 92.33
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 92.31
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 92.17
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 92.15
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 92.13
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 92.04
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 92.03
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 91.95
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 91.73
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 91.72
d2f5va1 379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 91.66
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 91.65
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 91.62
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 91.61
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 91.6
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 91.53
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 91.27
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 91.17
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 91.16
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 91.05
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 90.9
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 90.85
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 90.74
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 90.74
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 90.66
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 90.59
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 90.53
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 90.43
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 90.01
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 89.96
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 89.95
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 89.81
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 89.79
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 89.58
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 89.04
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 88.97
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 88.88
d1kdga1 360 Flavoprotein domain of flavocytochrome cellobiose 88.75
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 88.72
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 88.5
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 88.33
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 88.04
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 87.89
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 87.81
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 87.8
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 87.74
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 87.67
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 87.13
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 87.09
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 87.03
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 86.77
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 86.73
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 86.59
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 86.55
d1id1a_153 Rck domain from putative potassium channel Kch {Es 86.49
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 86.4
d1gpea1 391 Glucose oxidase {Penicillium amagasakiense [TaxId: 85.72
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 85.55
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 85.52
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 85.51
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 85.5
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 85.18
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 85.14
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 85.1
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 84.96
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 84.91
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 84.83
d1fcda2141 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 84.67
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 84.53
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 84.47
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 84.19
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 84.11
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 83.98
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 83.86
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 83.64
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 83.17
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 83.12
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 82.76
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 82.61
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 82.51
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 82.47
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 82.4
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 82.29
d1cf3a1 385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 82.07
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 81.88
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 81.82
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 81.49
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 81.31
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 81.19
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 81.0
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 80.72
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 80.67
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 80.64
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 80.53
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 80.43
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 80.26
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 80.09
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 80.06
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD/NAD-linked reductases, N-terminal and central domains
domain: Phenylacetone monooxygenase
species: Thermobifida fusca [TaxId: 2021]

Probab=99.76  E-value=1.4e-19  Score=161.58  Aligned_cols=131  Identities=22%  Similarity=0.371  Sum_probs=107.7

Q ss_pred             CCcEEECCChHHHHHHHHHHHcCCCEEEEecCCCCCCccCCCCCCCeeeecCCccccCCCCC-------CCCCCC-----
Q 035488           20 NGPVIVGAGPSGLAVAAGLKNQGVPFIILERANCIASLWQNRTYDRLKLHLPKQFCQLPNFP-------FPEDFP-----   87 (408)
Q Consensus        20 ~~vvIIG~G~aGl~~A~~l~~~g~~v~lie~~~~~gg~w~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~-----   87 (408)
                      .||+|||||++||++|++|++.|++|+|+|+.+.+||+|+.+.|++..++.+...+..+..+       +...++     
T Consensus         8 ~dV~IIGAG~sGl~~a~~L~~~G~~v~i~Ek~~~iGGtW~~n~ypg~~~d~~~~~~~~s~~~~~~~~~~~~~~~p~~~e~   87 (298)
T d1w4xa1           8 VDVLVVGAGFSGLYALYRLRELGRSVHVIETAGDVGGVWYWNRYPGARCDIESIEYCYSFSEEVLQEWNWTERYASQPEI   87 (298)
T ss_dssp             EEEEEECCSHHHHHHHHHHHHTTCCEEEECSSSSSCTHHHHCCCTTCBCSSCTTTSSCCSCHHHHHHCCCCBSSCBHHHH
T ss_pred             CCEEEECccHHHHHHHHHHHhCCCCEEEEEcCCCcccccccCCCCCceeccccccccccccccccCCCCCccccCccchH
Confidence            48999999999999999999999999999999999999998889999988877766655432       111111     


Q ss_pred             -----CCCCccCc--cccccceeEEEEEcCCCCcEEEEEeecCCCCcceEEEEeCEEEEeeCCCCCCCCCCCCCCCC
Q 035488           88 -----RVPHQFDI--NPRFNETVQSAKYDETFGFWRIKTISSSDSSFCEVEYICRWLVVATGENAEKIEPEFEGLQH  157 (408)
Q Consensus        88 -----~~~~~~~~--~~~~~~~V~~i~~~~~~~~~~V~~~~~~~~~~~~~~i~ad~vViAtG~~~~~~~p~~~g~~~  157 (408)
                           .+++++++  .++++++|+++..+++.+.|+|++.++       .++++|+||+|||..+.|..|.+++.+.
T Consensus        88 ~~Yl~~~a~~~~L~~~I~f~t~V~~~~~de~~~~W~V~~~~~-------~~~~~~~~i~atG~ls~~~~p~~~~~~i  157 (298)
T d1w4xa1          88 LRYINFVADKFDLRSGITFHTTVTAAAFDEATNTWTVDTNHG-------DRIRARYLIMASGQLSDALTGALFKIDI  157 (298)
T ss_dssp             HHHHHHHHHHTTGGGGEECSCCEEEEEEETTTTEEEEEETTC-------CEEEEEEEEECCCSCCCCTTHHHHTSEE
T ss_pred             HHHHHHHHHHcCCcccccCCcEEEEEEEecCCCceeeccccc-------cccccceEEEeecccccccCCccccccc
Confidence                 11226777  589999999999877668899999875       6899999999999999999998887764
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1fcda2 c.3.1.5 (A:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure